WO2022140560A1 - In vitro assembly of anellovirus capsids enclosing rna - Google Patents

In vitro assembly of anellovirus capsids enclosing rna Download PDF

Info

Publication number
WO2022140560A1
WO2022140560A1 PCT/US2021/064887 US2021064887W WO2022140560A1 WO 2022140560 A1 WO2022140560 A1 WO 2022140560A1 US 2021064887 W US2021064887 W US 2021064887W WO 2022140560 A1 WO2022140560 A1 WO 2022140560A1
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
nucleic acid
genetic element
orf1
anellovirus
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/064887
Other languages
English (en)
French (fr)
Inventor
Roger Joseph Hajjar
Simon Delagrave
Kurt Adam SWANSON
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Flagship Pioneering Innovations V Inc
Original Assignee
Flagship Pioneering Innovations V Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to IL303892A priority Critical patent/IL303892A/en
Priority to KR1020237025029A priority patent/KR20230124682A/ko
Priority to AU2021409952A priority patent/AU2021409952A1/en
Priority to BR112023012460A priority patent/BR112023012460A2/pt
Priority to MX2023007643A priority patent/MX2023007643A/es
Priority to EP21912150.6A priority patent/EP4267157A4/en
Priority to JP2023538735A priority patent/JP2024501287A/ja
Priority to CN202180093903.7A priority patent/CN116887865A/zh
Application filed by Flagship Pioneering Innovations V Inc filed Critical Flagship Pioneering Innovations V Inc
Priority to CA3206361A priority patent/CA3206361A1/en
Priority to US17/846,503 priority patent/US20220372519A1/en
Publication of WO2022140560A1 publication Critical patent/WO2022140560A1/en
Anticipated expiration legal-status Critical
Priority to US19/056,060 priority patent/US20250257368A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/00022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/00023Virus like particles [VLP]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/00041Use of virus, viral particle or viral elements as a vector
    • C12N2750/00043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/10011Circoviridae
    • C12N2750/10022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/10011Circoviridae
    • C12N2750/10023Virus like particles [VLP]

Definitions

  • compositions and methods for producing an anellovector that can be used as a delivery vehicle, e.g., for delivering genetic material, for delivering an effector, e.g., a payload, or for delivering a therapeutic agent or a therapeutic effector to a eukaryotic cell (e.g., a human cell or a human tissue).
  • anellovector e.g., a synthetic anellovector
  • a delivery vehicle e.g., for delivering genetic material, for delivering an effector, e.g., a payload, or for delivering a therapeutic agent or a therapeutic effector to a eukaryotic cell (e.g., a human cell or a human tissue).
  • anellovector e.g., a synthetic anellovector
  • a delivery vehicle e.g., for delivering genetic material, for delivering an effector, e.g., a payload, or for delivering a therapeutic agent or a therapeutic effector to
  • An anellovector (e.g., produced using a composition or method as described herein) generally comprises a genetic element (e.g., a genetic element comprising or encoding an effector, e.g., an exogenous or endogenous effector, e.g., a therapeutic effector) encapsulated in a proteinaceous exterior (e.g., a proteinaceous exterior comprising an Anellovirus capsid protein, e.g., an Anellovirus ORF1 protein or a polypeptide encoded by an Anellovirus ORF1 nucleic acid, e.g., as described herein), which is capable of introducing the genetic element into a cell (e.g., a mammalian cell, e.g., a human cell).
  • a genetic element e.g., a genetic element comprising or encoding an effector, e.g., an exogenous or endogenous effector, e.g., a therapeutic effector
  • the genetic element may comprise RNA.
  • the anellovector is an infectious vehicle or particle comprising a proteinaceous exterior comprising a polypeptide encoded by an Anellovirus ORF1 nucleic acid (e.g., an ORF1 nucleic acid of Alphatorquevirus, Betatorquevirus, or Gammatorquevirus, e.g., an ORF1 of Alphatorquevirus clade 1, Alphatorquevirus clade 2, Alphatorquevirus clade 3, Alphatorquevirus clade 4, Alphatorquevirus clade 5, Alphatorquevirus clade 6, or Alphatorquevirus clade 7, e.g., as described herein).
  • an Anellovirus ORF1 nucleic acid e.g., an ORF1 nucleic acid of Alphatorquevirus, Betatorquevirus, or Gammatorquevirus, e.g., an ORF1 of Alphatorquevirus clade 1, Alphatorquevirus clade 2, Alphatorquevirus clade 3, Alpha
  • the genetic element of an anellovector of the present disclosure is typically a circular and/or single-stranded RNA molecule (e.g., circular and single stranded) having a protein binding sequence that binds to the proteinaceous exterior enclosing it, or a polypeptide attached thereto, which may facilitate enclosure of the genetic element within the proteinaceous exterior and/or enrichment of the genetic element, relative to other nucleic acids, within the proteinaceous exterior.
  • the genetic element of an anellovector is produced using a baculovirus, nucleic acid construct (e.g., a bacmid and/or donor vector), insect cell, and/or animal cell line, e.g., as described herein.
  • the genetic element comprises or encodes an effector (e.g., comprises a nucleic acid effector, such as a non-coding RNA, or encodes a polypeptide effector, e.g., a protein), e.g., which can be expressed in a target cell.
  • the effector is a therapeutic agent or a therapeutic effector, e.g., as described herein.
  • the effector is an endogenous effector or an exogenous effector, e.g., exogenous to a wild-type Anellovirus or a target cell.
  • the effector is exogenous to a wild-type Anellovirus or a target cell.
  • the anellovector can deliver an effector into a cell by contacting the cell and introducing a genetic element encoding the effector into the cell, such that the effector is made or expressed by the cell.
  • the effector is an endogenous effector (e.g., endogenous to the target cell but, e.g., provided in increased amounts by the anellovector).
  • the effector is an exogenous effector.
  • the effector can, in some instances, modulate a function of the cell or modulate an activity or level of a target molecule in the cell. For example, the effector can decrease levels of a target protein in the cell (e.g., as described in Examples 3 and 4 of PCT/US19/65995).
  • the anellovector can deliver and express an effector, e.g., an exogenous protein, in vivo (e.g., as described in Examples 19 and 28 of PCT/US19/65995).
  • Anellovectors can be used, for example, to deliver genetic material to a target cell, tissue or subject; to deliver an effector to a target cell, tissue or subject; or for treatment of diseases and disorders, e.g., by delivering an effector that can operate as a therapeutic agent to a desired cell, tissue, or subject.
  • the compositions and methods described herein can be used to produce the genetic element of a synthetic anellovector, e.g., in a host cell.
  • a synthetic anellovector has at least one structural difference compared to a wild-type virus (e.g., a wild-type Anellovirus, e.g., a described herein), e.g., a deletion, insertion, substitution, modification (e.g., enzymatic modification), relative to the wild- type virus.
  • synthetic anellovectors include an exogenous genetic element enclosed within a proteinaceous exterior, which can be used for delivering the genetic element, or an effector (e.g., an exogenous effector or an endogenous effector) encoded therein (e.g., a polypeptide or nucleic acid effector), into eukaryotic (e.g., human) cells.
  • the anellovector does not cause a detectable and/or an unwanted immune or inflammarory response, e.g., does not cause more than a 1%, 5%, 10%, 15% increase in a molecular marker(s) of inflammation, e.g., TNF-alpha, IL-6, IL-12, IFN, as well as B-cell response e.g. reactive or neutralizing antibodies, e.g., the anellovector may be substantially non-immunogenic to the target cell, tissue or subject.
  • a molecular marker(s) of inflammation e.g., TNF-alpha, IL-6, IL-12, IFN
  • B-cell response e.g. reactive or neutralizing antibodies
  • the anellovector may be substantially non-immunogenic to the target cell, tissue or subject.
  • compositions and methods described herein can be used to produce the genetic element of an anellovector comprising: (i) a proteinaceous exterior comprising an ORF1 molecule; and (ii) a genetic element comprising RNA; wherein the genetic element is enclosed within the proteinaceous exterior.
  • the genetic element consists of at least 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% RNA.
  • the genetic element does not comprise DNA.
  • the genetic element does not comprise ssDNA.
  • the genetic element comprises a DNA region.
  • a DNA or RNA molecule described herein comprises one or more modified nucleotides (e.g., a base modification, sugar modification, or backbone modification).
  • the genetic element is a single-stranded.
  • the genetic element comprises a double stranded region.
  • the genetic element is a linear polypeptide.
  • the genetic element is a circular polynucleotide.
  • the nucleic acid sequence is codon-optimized, e.g., for expression in an insect cell.
  • At least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% of the codons in the nucleic acid sequence are codon-optimized, e.g., for expression in an insect cell.
  • the nucleic acid sequence is codon-optimized, e.g., for expression in a mammalian (e.g., human) cell.
  • at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% of the codons in the nucleic acid sequence are codon-optimized, e.g., for expression in a mammalian (e.g., human) cell.
  • the genetic element is about 10-20, 20-30, 30-40, 50-6060-70, 70-80, 80-90, 90-100, 100-125, 125-150, 150-200, 200-300, 300-400, 400-500, 500-600, 600-700, 700-800, 800-900, 900-1000, 1000-1500, 1500-2000, 2000-2500, 2500-3000, 3000-3500, 3500- 4000, or 4000-4500 nucleotides in length.
  • the genetic element is at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 250, 300, 400, 500, 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000, or 4500 nucleotides in length.
  • compositions and methods described herein can be used to produce the genetic element of an infectious (e.g., to a human cell) Annellovector, vehicle, or particle comprising a capsid (e.g., a capsid comprising an Anellovirus ORF, e.g., ORF1, polypeptide) encapsulating a genetic element comprising a protein binding sequence that binds to the capsid and a heterologous (to the Anellovirus) sequence encoding a therapeutic effector.
  • the Anellovector is capable of delivering the genetic element into a mammalian, e.g., human, cell.
  • the invention features a method of making an anellovector by in vitro assembly.
  • a method of making an anellovector comprises: (a) providing a mixture comprising: (i) a genetic element comprising RNA, and (ii) an ORF1 molecule; and (b) incubating the mixture under conditions suitable for enclosing the genetic element within a proteinacous comprising the ORF1 molecule, thereby making an anellovector; optionally wherein the mixture is not comprised in a cell.
  • a method further comprises, prior to the providing of (a), expressing the ORF1 molecule, e.g., in a host cell (e.g., an insect cell or a mammalian cell).
  • the expressing comprises incubating a host cell (e.g., an insect cell or a mammalian cell) comprising a nucleic acid molecule (e.g., a baculovirus expression vector) encoding the ORF1 molecule under conditions suitable for producing the ORF1 molecule.
  • a method further comprises, prior to the providing of (a), purifying the ORF1 molecule expressed by the host cell.
  • anellovectors, as described herein can be used as effective delivery vehicles for introducing an agent, such as an effector described herein, to a target cell, e.g., a target cell in a subject to be treated therapeutically or prophylactically.
  • the invention features a pharmaceutical composition
  • a pharmaceutical composition comprising an anellovector (e.g., a synthetic anellovector) as described herein.
  • the pharmaceutical composition further comprises a pharmaceutically acceptable carrier or excipient.
  • the pharmaceutical composition comprises a unit dose comprising about 10 5 -10 14 (e.g., about 10 6 -10 13 , 10 7 - 10 12 , 10 8 -10 11 , or 10 9 -10 10 ) genome equivalents of the anellovector per kilogram of a target subject.
  • the pharmaceutical composition comprising the preparation will be stable over an acceptable period of time and temperature, and/or be compatible with the desired route of administration and/or any devices this route of administration will require, e.g., needles or syringes.
  • the pharmaceutical composition is formulated for administration as a single dose or multiple doses.
  • the pharmaceutical composition is formulated at the site of administration, e.g., by a healthcare professional.
  • the pharmaceutical composition comprises a desired concentration of anellovector genomes or genomic equivalents (e.g., as defined by number of genomes per volume).
  • the invention features a method of treating a disease or disorder in a subject, the method comprising administering to the subject an anellovector, e.g., a synthetic anellovector, e.g., as described herein.
  • the invention features a method of delivering an effector or payload (e.g., an endogenous or exogenous effector) to a cell, tissue or subject, the method comprising administering to the subject an anellovector, e.g., a synthetic anellovector, e.g., as described herein, wherein the anellovector comprises a nucleic acid sequence encoding the effector.
  • the payload is a nucleic acid.
  • the payload is a polypeptide.
  • the invention features a method of delivering an anellovector to a cell, comprising contacting the anellovector, e.g., a synthetic anellovector, e.g., as described herein, with a cell, e.g., a eukaryotic cell, e.g., a mammalian cell, e.g., in vivo or ex vivo. Additional features of any of the aforesaid anellovectors, compositions or methods include one or more of the following enumerated embodiments.
  • An anellovector comprising: a) proteinaceous exterior comprising an ORF1 molecule; b) a genetic element comprising RNA, wherein the genetic element is enclosed within the proteinaceous exterior. 2. The anellovector of embodiment 1, wherein the genetic element consists of at least 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% RNA. 3.
  • the anellovector of any of the preceding embodiments, wherein the genetic element is single stranded. 13. The anellovector of any of the preceding embodiments, wherein the genetic element comprises a double stranded region (e.g., a region of RNA pairing with RNA or a DNA pairing with RNA). 14. The anellovector of any of the preceding embodiments, wherein the genetic element is linear. 15. The anellovector of any of the preceding embodiments, wherein the genetic element is circular. 16. The anellovector of any of the preceding embodiments, wherein the genetic element comprises a first region and a second region that can hybridize with the first region. 17.
  • the anellovector of any of the preceding embodiments wherein the genetic element does not comprise a 5’ end or a 3’ end. 18.
  • the genetic elements of the plurality each comprise the same sequence.
  • the genetic elements of the plurality comprise different sequences.
  • the genetic element encodes an exogenous effector. 31.
  • the exogenous effector comprises a therapeutic effector (e.g., a polypeptide or a nucleic acid molecule).
  • the exogenous effector comprises a nucleic acid molecule.
  • the exogenous effector comprises a noncoding nucleic acid molecule, e.g., a functional RNA, e.g., an mRNA, miRNA, or siRNA).
  • the noncoding nucleic acid molecule is a human noncoding nucleic acid molecule, or a nucleic acid molecule comprising a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. 38.
  • a secreted polypeptide or peptide e.g., a cytokine, an antibody molecule, a hormone, a growth factor, or a clotting-associated factor, or a functional fragment thereof.
  • a component of a gene editing system e.g., a component of a CRISPR system, e.g., a Cas9, Cpf1, or a functional fragment thereof. 45.
  • RNA comprises chemically modified RNA, e.g., as described herein. 46.
  • RNA comprises a cap.
  • RNA comprises a poly-A tail, e.g., at least about 5, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, or 100 adenosines in length. 48.
  • the proteinaceous exterior comprises about 60 (e.g., about 40, 50, 60, 70, or 80) copies of the ORF1 molecule.
  • the jelly roll domains of the ORF1 molecules face the interior of the proteinaceous exterior. 51.
  • ORF1 molecule comprises an amino acid sequence as listed in any of Tables N-S and 37A-37C, or an amino acid sequence having at least 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. 52.
  • the ORF1 molecule comprises an arginine-rich region, e.g., comprising the amino acid sequence of an arginine-rich region as listed in any of Tables N-S and 37A-37C, or an amino acid sequence having at least 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. 53.
  • the arginine-rich region comprises at least about 70% (e.g., at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100%) basic residues (e.g., arginine or lysine).
  • ORF1 molecule comprises a jelly roll domain, e.g., comprising the amino acid sequence of a jelly roll domain as listed in any of Tables N-S and 37A-37C, or an amino acid sequence having at least 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. 55.
  • the jelly roll domain comprises one or more (e.g., 1, 2, 3, or 4) of the following characteristics: (i) at least 30% (e.g., at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, or more) of the amino acids of the jelly-roll domain are part of one or more ⁇ -sheets; (ii) the secondary structure of the jelly-roll domain comprises at least four (e.g., at least 4, 5, 6, 7, 8, 9, 10, 11, or 12) ⁇ -strands; and/or (iii) the tertiary structure of the jelly-roll domain comprises at least two (e.g., at least 2, 3, or 4) ⁇ -sheets; and/or (iv) the jelly-roll domain comprises a ratio of ⁇ -sheets to ⁇ -helices of at least 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, or 10:1.
  • the anellovector of embodiment 54, wherein the jelly roll domain comprises two ⁇ - sheets, e.g., arranged in antiparallel orientation relative to each other.
  • the anellovector of embodiment 54, wherein the jelly roll domain comprises eight ⁇ - strands.
  • the anellovector of any of embodiments 52-57, wherein the jelly roll domain comprises a region having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the sequence of a D ⁇ -strand, e.g., as shown in FIG.3. 59.
  • the anellovector of embodiment 52 wherein the D ⁇ -strand comprises 1, 2, or 3, or more basic residues (e.g., arginine or lysine).
  • 61 The anellovector of embodiment 52, wherein the G ⁇ -strand comprises at least about 1, 2, or 3, or more basic residues (e.g., arginine or lysine). 62.
  • the ORF1 molecule comprises an N22 domain, e.g., comprising the amino acid sequence of an N22 domain as listed in any of Tables N-S and 37A-37C, or an amino acid sequence having at least 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the N22 domain comprises the amino acid sequence YNPX 2 DXGX 2 N, wherein X n is each independently a contiguous sequence of any n amino acids.
  • the N22 domain comprises a first beta strand and a second beta strand flanking the amino acid sequence YNPX 2 DXGX 2 N, e.g., wherein the first beta strand comprises the tyrosine (Y) residue of the amino acid sequence YNPX 2 DXGX 2 N and/or wherein the second beta strand comprises the second asparagine (N) residue (from N to C) of the amino acid sequence YNPX 2 DXGX 2 N. 65.
  • the genetic element lacks a sequence encoding an Anellovirus ORF1 protein (e.g., as described herein). 67.
  • a cell e.g., a eukaryotic cell, e.g., a mammalian cell, e.g., a human cell.
  • the anellovector of embodiment 69 wherein a population of at least 1000 of the anellovectors is capable of delivering at least about 100 copies (e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 5000, 10,000, 50,000, 100,000, 500,000, or 1,000,000 copies) of the genetic element into one or more of the cells. 71.
  • 100 copies e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 5000, 10,000, 50,000, 100,000, 500,000, or 1,000,000 copies
  • the anellovector of embodiment 69 or 70 wherein a population of the anellovectors (e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 genome equivalents of the genetic element per cell) is capable of delivering the genetic element into at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, or more of a population of the cells. 72.
  • a population of the anellovectors e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 genome equivalents of the genetic element per cell
  • a population of the anellovectors e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 genome equivalents of the genetic element per cell
  • a population of the anellovectors e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 genome equivalents of the genetic element per cell
  • a population of the anellovectors e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100
  • the anellovector of any of embodiments 69-72, wherein a population of the anellovectors (e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 genome equivalents of the genetic element per cell) is capable of delivering 1-3, 1-4, 1-5, 1-6, 1-7, 1-8, 1-9, 1-10, 5-10, 10-20, 20-50, 50-100, 100-1000, 1000-10 4 , 1 x 10 4 -1 x 10 5 , 1 x 10 4 -1 x 10 6 , 1 x 10 4 -1 x 10 7 , 1 x 10 5 - 1 x 10 6 , 1 x 10 5 -1 x 10 7 , or 1 x 10 6 -1 x 10 7 copies of the genetic element per cell to a population of the cells.
  • a population of the anellovectors e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50,
  • the anellovector of any of the preceding embodiments wherein the anellovector selectively delivers the effector to, or is present at higher levels in (e.g., preferentially accumulates in), a desired cell type, tissue, or organ (e.g., bone marrow, blood, heart, GI, skin, photoreceptors in the retina, epithelial linings, or pancreas).
  • a desired cell type, tissue, or organ e.g., bone marrow, blood, heart, GI, skin, photoreceptors in the retina, epithelial linings, or pancreas.
  • 75 The anellovector of any of the preceding embodiments, wherein the genetic element is protected from or resistant to digestion by an RNase (e.g., by the proteinaceous exterior).
  • the genetic element comprises a protein binding sequence.
  • the anellovector of embodiment 78, wherein the protein binding sequence is capable of binding to the ORF1 molecule.
  • a composition comprising a plurality of the anellovectors of any of the preceding embodiments. 81.
  • composition of embodiment 80 wherein at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% of proteinaceous exteriors comprising an ORF1 molecule in the composition comprise at least one copy of the genetic element.
  • composition of embodiment 80 wherein at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% of proteinaceous exteriors comprising an ORF1 molecule in the composition comprise at least one copy of an anellovector genetic element.
  • composition of any of embodiments 80-82 wherein the composition comprises at least 10 2 , 10 3 , 10 4 , 10 4 , 10 5 , 10 6 , or 10 7 of the same anellovector.
  • composition of any of embodiments 80-84 having one or more (e.g., 1, 2, 3, 4, 5, or 6) of the following characteristics: a) the composition meets a pharmaceutical or good manufacturing practices (GMP) standard; b) the composition was made according to good manufacturing practices (GMP); c) the composition has a pathogen level below a predetermined reference value, e.g., is substantially free of pathogens; d) the composition has a contaminant level below a predetermined reference value, e.g., is substantially free of contaminants (e.g., a denaturant, e.g., urea); e) the composition has a predetermined level of non-infectious particles or a predetermined ratio of particles:infectious units (e.g., ⁇ 300:1, ⁇ 200:1, ⁇ 100:1, or ⁇ 50:1), or f) the pharmaceutical composition has low immunogenicity or is substantially non- immunogenic, e.g., as described herein; optionally wherein the composition comprises
  • composition of embodiment 86 or 87, wherein the contaminant comprises one or more of the following: mycoplasma, endotoxin, host cell nucleic acids (e.g., host cell DNA and/or host cell RNA), animal-derived process impurities (e.g., serum albumin or trypsin), replication-competent agents (RCA), e.g., replication-competent virus or unwanted anellovectors (e.g., an anellovector other than the desired anellovector, e.g., a synthetic anellovector as described herein), free viral capsid protein, adventitious agents, and/or aggregates.
  • mycoplasma e.g., endotoxin
  • host cell nucleic acids e.g., host cell DNA and/or host cell RNA
  • animal-derived process impurities e.g., serum albumin or trypsin
  • replication-competent agents RCA
  • replication-competent virus or unwanted anellovectors e
  • composition of any of embodiments 80-88 wherein the composition comprises less than 10% (e.g., less than about 10%, 5%, 4%, 3%, 2%, 1%, 0.5%, or 0.1%) contaminant by weight.
  • a pharmaceutical composition comprising the anellovector or composition of any of the preceding embodiments, and a pharmaceutically acceptable carrier or excipient. 93.
  • a method of making an anellovector comprising: (a) providing a mixture comprising: (i) a genetic element comprising RNA, and (ii) an ORF1 molecule; and (b) incubating the mixture under conditions suitable for enclosing the genetic element within a proteinaceous exterior comprising the ORF1 molecule, thereby making an anellovector; optionally wherein the mixture is not comprised in a cell.
  • the method of embodiment 93 further comprising, prior to the providing of (a), expressing the ORF1 molecule, e.g., in a host cell (e.g., an insect cell or a mammalian cell). 95.
  • the method of embodiment 94 wherein the expressing comprising incubating a host cell (e.g., an insect cell or a mammalian cell) comprising a nucleic acid molecule (e.g., a baculovirus expression vector) encoding the ORF1 molecule under conditions suitable for producing the ORF1 molecule.
  • a host cell e.g., an insect cell or a mammalian cell
  • a nucleic acid molecule e.g., a baculovirus expression vector
  • a method of purifying an anellovector comprising: (a) providing an anellovector (e.g., as described herein) comprising: (i) a genetic element, e.g., a genetic element comprising RNA, and (ii) a proteinaceous exterior comprising an ORF1 molecule, the proteinaceous exterior enclosing the genetic element; and (b) purifying the anellovector.
  • an anellovector e.g., as described herein
  • the purifying comprises affinity purification, e.g., heparin affinity purification.
  • the purifying comprises size exclusion chromatography (e.g., using a Tris buffer mobile phase).
  • the purifying comprises affinity purification (e.g., heparin affinity purification) followed by size exclusion chromatography.
  • the purifying comprises anion exchange chromatography (e.g., Mustang Q membrane chromatography).
  • the purifying comprises mixed mode chromatography (e.g., using a mixed mode resin, e.g., a Cato700 resin).
  • any of embodiments 96-102 wherein the purifying (e.g., the purifying of the ORF1 molecule or the purifying of the anelloevctor) produces a composition comprising one or more virus-like particles (VLPs) comprising at least about 20, 30, 40, 50, or 60 copies, or 20-30, 30-40, 40-50, or 50-60 copies, of the ORF1 molecule.
  • VLPs virus-like particles
  • the method of embodiment 103, wherein at least 75%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% of the virus-like particles comprise proteinaceous exteriors that are 60mers or are particles of at least 30, 31, 32, 33, 34, or 35 nm in diameter.
  • composition comprises at least 10 5 , 10 6 , 10 7 , 10 8 , 10 9 , 10 10 particles/mL, or comprises 10 5 - 10 6 , 10 6 - 10 7 , 10 7 - 10 9 , 10 8 - 10 9 , 10 9 - 10 10 , or 10 10 - 10 11 particles/mL (e.g., as measured by electron microscopy).
  • 106 The method of any of embodiments 93-105, further comprising, prior to the providing of (a), incubating the ORF1 molecule under conditions suitable for disassembly of a proteinaceous exterior (e.g., a virus-like particle (VLP)) comprising the ORF1 molecule.
  • VLP virus-like particle
  • the conditions suitable for disassembly of the proteinaceous exterior comprising the ORF1 molecule comprise incubation in the presence of a denaturant.
  • the denaturant comprises a chaotropic agent (e.g., urea), or a detergent (e.g., SDS (e.g., 0.1% SDS), Tween, or Triton).
  • a chaotropic agent e.g., urea
  • a detergent e.g., SDS (e.g., 0.1% SDS), Tween, or Triton.
  • any of embodiments 106-108, wherein the conditions suitable for disassembly of the proteinaceous exterior comprising the ORF1 molecule comprise a predetermined conductivity, a high salt solution (e.g., a solution comprising NaCl, e.g., at a concentration of at least about 1M, e.g., at least about 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 2, 3, 4, or 5M), heat (e.g., temperature above about 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, or 95oC), or pH (e.g., acidic pH or basic pH).
  • a high salt solution e.g., a solution comprising NaCl, e.g., at a concentration of at least about 1M, e.g., at least about 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1
  • any of embodiments 106-109, wherein the conditions suitable for disassembly of the proteinaceous exterior comprising the ORF1 moleceule comprise incubation in a solution comprising urea at a concentration of at least 0.1M, 0.2M, 0.3M, 0.4M, 0.5M, 0.6M, 0.7M, 0.8M, 0.9M, 1M, 1.1M, 1.2M, 1.3M, 1.5M, 1.5M, 1.6M, 1.7M, 1.8M, 1.9M, or 2M. 111.
  • the removing of the ORF1 molecule from the conditions suitable for disassembly of the proteinaceous exterior comprises reducing the concentration of the denaturant, e.g., reducing the concentration of the denaturan (e.g., urea) to below 0.1M, 0.2M, 0.3M, 0.4M, 0.5M, 0.6M, 0.7M, 0.8M, 0.9M, 1M, 1.1M, 1.2M, 1.3M, 1.5M, 1.5M, 1.6M, 1.7M, 1.8M, 1.9M, or 2M.
  • the concentration of the denaturant e.g., reducing the concentration of the denaturan (e.g., urea) to below 0.1M, 0.2M, 0.3M, 0.4M, 0.5M, 0.6M, 0.7M, 0.8M, 0.9M, 1M, 1.1M, 1.2M, 1.3M, 1.5M, 1.5M, 1.6M, 1.7M, 1.8M, 1.9M, or 2M
  • any of embodiments 114-118 wherein the removing results in a solution comprising at least 10 5 , 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , or 10 11 anellovectors/mL; or between 10 5 - 10 6 , 10 6 - 10 7 , 10 7 - 10 9 , 10 8 - 10 9 , 10 9 - 10 10 , or 10 10 - 10 11 anellovectors/mL (e.g., as measured by electron microscopy), wherein the anellovectors each enclose at least one copy (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 400, 500, 600, 700, 800, 900, or 1000 copies) of the genetic element (e.g., the mRNA) 120.
  • the genetic element e.g., the mRNA
  • the method of any of embodiments 114-119, wherein at least 75%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% of the anellovectors comprise proteinaceous exteriors that are 60mers or particles or are particles of at least 30, 31, 32, 33, 34, or 35 nm in diameter.
  • a method of manufacturing an anellovector composition comprising: (a) providing a plurality of anellovectors or compositions according to any of the preceding embodiments; (b) optionally evaluating the plurality for one or more of: a contaminant described herein, an optical density measurement (e.g., OD 260), particle number (e.g., by HPLC), infectivity (e.g., particle:infectious unit ratio, e.g., as determined by fluorescence and/or ELISA); and (c) formulating the plurality of anellovectors, e.g., as a pharmaceutical composition suitable for administration to a subject, e.g., if one or more of the parameters of (b) meet a specified threshold.
  • a contaminant described herein e.g., OD 260
  • particle number e.g., by HPLC
  • infectivity e.g., particle:infectious unit ratio, e.g., as determined by fluorescence and/or
  • a method of treating a disease or disorder in a subject in need thereof comprising administering to the subject an anellovector or composition of any of the preceding embodiments, thereby treating a disease or disorder (e.g., as described herein) in the subject.
  • a method of modulating, e.g., enhancing or inhibiting, a biological function (e.g., as described herein) in a subject the method comprising administering the anellovector or the composition of any of the preceding embodiments to the subject. 127.
  • a method of delivering a genetic element to a cell comprising contacting the anellovector or composition of any of the preceding embodiments with a cell, e.g., a eukaryotic cell, e.g., a mammalian cell, e.g., a human cell. 128.
  • a cell e.g., a eukaryotic cell, e.g., a mammalian cell, e.g., a human cell. 128.
  • a cell e.g., a eukaryotic cell, e.g., a mammalian cell, e.g., a human cell. 128.
  • a cell e.g., a eukaryotic cell, e.g., a mammalian cell, e.g., a human cell. 128.
  • Use of the anellovector or composition of any of the preceding embodiments for treating a disease or disorder (e.g
  • FIG.1 is a series of electron micrographs showing that recombinant capsid proteins from anellovirus strains form virus-like particles (VLPs) in vitro. Capsid proteins produced in different cell lines form VLPs in vitro as observed by negative staining electron microscopy.
  • VLPs virus-like particles
  • Capsid proteins produced in different cell lines form VLPs in vitro as observed by negative staining electron microscopy.
  • A Ring 2 ORF1 VLP purified from insect cells with an observed diameter of approximately 35 nm.
  • B Ring 10 ORF1 VLP purified from insect cells with an observed diameter of approximately 35 nm.
  • C CAV VP1 VLP purified from mammalian cells with an observed diameter approximately 20 nm.
  • FIG.2 is a diagram showing the eight beta-strand jelly roll domain (or jelly roll fold) observed in the structure of Beak and Feather Disease Virus (BFDV).
  • the beta strands are labeled B though I.
  • the strands form four antiparallel beta sheets with an orientation of B-I-D-G and C-H-E-F.
  • the B-I-D-G sheet forms the interior of the viral capsid.
  • FIG.3 is an amino acid sequence alignment depicting the jelly roll sequences for Anellovirus ORF1 protein as compared to jelly roll domain of Beak and Feather Disease Virus (BFDV)/ Hepatitis E capsid protein (HepE).
  • FIGS.4A-4E are a series of diagrams showing an exemplary method of producing Anellovirus ORF1 protein-based virus-like particles (VLPs) enclosing mRNA molecules encoding eGFP.
  • VLPs Anellovirus ORF1 protein-based virus-like particles
  • A ORF1 protein was produced in cells and isolated as described herein.
  • B VLPs that formed from the ORF1 proteins were then disassembled in a 2 M urea solution.
  • C When the urea was removed in the absence of mRNA, few VLPs reformed (titer of less than 10 8 particles/mL detected by electron microscopy).
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1-encoding nucleotide sequence of Table 1 (e.g., nucleotides 571 – 2613 of the nucleic acid sequence of Table 1)”, then some embodiments relate to nucleic acid molecules comprising a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to nucleotides 571 – 2613 of the nucleic acid sequence of Table 1.
  • amplification refers to replication of a nucleic acid molecule or a portion thereof, to produce one or more additional copies of the nucleic acid molecule or a portion thereof (e.g., a genetic element or a genetic element region). In some embodiments, amplification results in partial replication of a nucleic acid sequence. In some embodiments, amplification occurs via rolling circle replication.
  • anellovector refers to a vehicle comprising a genetic element, e.g., an RNA, e.g., a circular RNA, enclosed in a proteinaceous exterior. In some embodiments, the genetic element is substantially protected from digestion with RNase by a proteinaceous exterior.
  • a “synthetic anellovector,” as used herein, generally refers to an anellovector that is not naturally occurring, e.g., has a sequence that is different relative to a wild-type virus (e.g., a wild-type Anellovirus as described herein).
  • the synthetic anellovector is engineered or recombinant, e.g., comprises a genetic element that comprises a difference or modification relative to a wild-type viral genome (e.g., a wild-type Anellovirus genome as described herein).
  • enclosed within a proteinaceous exterior encompasses 100% coverage by a proteinaceous exterior, as well as less than 100% coverage, e.g., 95%, 90%, 85%, 80%, 70%, 60%, 50% or less.
  • gaps or discontinuities e.g., that render the proteinaceous exterior permeable to water, ions, peptides, or small molecules
  • RNase e.g., RNase-activated nucleic acid
  • the anellovector is purified, e.g., it is separated from its original source and/or substantially free (>50%, >60%, >70%, >80%, >90%) of other components.
  • the anellovector is capable of introducing the genetic element into a target cell (e.g., via infection).
  • the anellovector is an infective synthetic viral particle containing certain Anellovirus elements, such as an Anellovirus ORF1 molecule.
  • antibody molecule refers to a protein, e.g., an immunoglobulin chain or fragment thereof, comprising at least one immunoglobulin variable domain sequence.
  • an antibody molecule encompasses full-length antibodies and antibody fragments (e.g., scFvs).
  • an antibody molecule is a multispecific antibody molecule, e.g., the antibody molecule comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
  • the multispecific antibody molecule is a bispecific antibody molecule.
  • a bispecific antibody molecule is generally characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
  • the term “backbone” or “backbone region,” as used herein, refers to a region within a nucleic acid molecule (e.g., within a bacmid or donor vector, e.g., as described herein) that comprises one or more elements involved in (e.g., necessary and/or sufficient for) replication and/or maintenance of the nucleic acid molecule in a host cell.
  • a backbone region such as a “baculovirus backbone region,” comprises one or more baculoviral elements (e.g., a baculovirus genome or a functional fragment thereof), e.g., suitable for replication of the nucleic acid construct in insect cells (e.g., Sf9 cells).
  • the backbone further comprises a selectable marker.
  • a nucleic acid molecule comprises a genetic element region and a backbone region (e.g., a baculovirus backbone region and/or a backbone region suitable for replication in bacterial cells).
  • bacmid refers to a nucleic acid molecule comprising sufficient baculovirus backbone elements such that it is suitable for replication in insect cells, and furthermore is suitable for replication in bacterial cells.
  • the nucleic acid molecule is suitable for replication in bacterial cells (e.g., E. coli cells, e.g., DH 10Bac cells).
  • a “circular” nucleic acid refers to a nucleic acid that forms a structure without free 5’ or 3’ ends. In some embodiments, the circular nucleic acid is closed through covalent or non- covalent bonds.
  • the circular nucleic acid may be made by covalently linking the ends of a linear nucleic acid, e.g., with a phosphate-sugar bond or a synthetic linker moeity.
  • the circular nucleic acid comprises two ends that are in proximity and are not free (not substantially accessible to an exonuclease).
  • the circular nucleic acid may be made by hybridizing the ends of a linear nucleic acid directly or through a nucleic acid splint.
  • a “DNA region” refers to a portion of a polynucleotide strand comprising a plurality of DNA nucleotides.
  • a DNA region is a plurality of DNA nucleotides incorporated into an RNA strand.
  • a DNA region comprises about 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, or 90-100 DNA nucleotides within a polynucleotide strand.
  • a nucleic acid “encoding” refers to a nucleic acid sequence encoding an amino acid sequence or a polynucleotide, e.g., an mRNA or functional polynucleotide (e.g., a non-coding RNA, e.g., an siRNA or miRNA).
  • exogenous agent e.g., an effector, a nucleic acid (e.g., RNA), a gene, payload, protein
  • an exogenous agent refers to an agent that is either not comprised by, or not encoded by, a corresponding wild- type virus, e.g., an Anellovirus as described herein.
  • the exogenous agent does not naturally exist, such as a protein or nucleic acid that has a sequence that is altered (e.g., by insertion, deletion, or substitution) relative to a naturally occurring protein or nucleic acid.
  • the exogenous agent does not naturally exist in the host cell.
  • the exogenous agent exists naturally in the host cell but is exogenous to the virus. In some embodiments, the exogenous agent exists naturally in the host cell, but is not present at a desired level or at a desired time.
  • a “heterologous” agent or element e.g., an effector, a nucleic acid sequence, an amino acid sequence
  • another agent or element e.g., an effector, a nucleic acid sequence, an amino acid sequence
  • a heterologous nucleic acid sequence may be present in the same nucleic acid as a naturally occurring nucleic acid sequence (e.g., a sequence that is naturally occurring in the Anellovirus).
  • a heterologous agent or element is exogenous relative to an Anellovirus from which other (e.g., the remainder of) elements of the anellovector are based.
  • the term “genetic element” refers to a nucleic acid molecule that is or can be enclosed within (e.g, protected from RNase digestion by) a proteinaceous exterior, e.g., to form an anellovector as described herein.
  • genetic element construct refers to a nucleic acid construct (e.g., a plasmid, bacmid, donor vector, cosmid, or minicircle) comprising a genetic element sequence, or fragment thereof.
  • a bacmid or donor vector as described herein is a genetic element construct comprising a genetic element sequence, or fragment thereof.
  • genetic element region refers to a region of a construct that comprises the sequence of a genetic element.
  • the genetic element region comprises a sequence having sufficient identity to a wild-type Anellovirus sequence, or a fragment thereof, to be enclosed by a proteinaceous exterior, thereby forming an anellovector (e.g., a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the wild-type Anellovirus sequence or fragment thereof).
  • the genetic element region comprises a protein binding sequence, e.g., as described herein (e.g., a 5’ UTR, 3’ UTR, and/or a GC-rich region as described herein, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto).
  • the construct comprising a genetic element region is not enclosed in a proteinaceous exterior, but a genetic element produced from the construct can be enclosed in a proteinaceous exterior.
  • the construct comprising the genetic element region further comprises a vector backbone (e.g., a bacmid backbone or a donor vector backbone).
  • the construct comprises one or more baculovirus elements (e.g., a baculovirus genome, e.g., comprising the genetic element region).
  • baculovirus elements e.g., a baculovirus genome, e.g., comprising the genetic element region.
  • the term “mutant” when used with respect to a genome refers to a sequence having at least one change relative to a corresponding wild-type Anellovirus sequence.
  • the mutant genome or fragment thereof comprises at least one single nucleotide polymorphism, addition, deletion, or frameshift relative to the corresponding wild-type Anellovirus sequence.
  • the mutant genome or fragment thereof comprises a deletion of at least one Anellovirus ORF (e.g., one or more of ORF1, ORF2, ORF2/2, ORF2/3, ORF1/1, and/or ORF1/2) relative to the corresponding wild-type Anellovirus sequence.
  • the mutant genome or fragment thereof comprises a deletion of all Anellovirus ORFs (e.g., all of ORF1, ORF2, ORF2/2, ORF2/3, ORF1/1, and ORF1/2) relative to the corresponding wild-type Anellovirus sequence.
  • the mutant genome or fragment thereof comprises a deletion of at least one Anellovirus noncoding region (e.g., one or more of a 5’ UTR, 3’ UTR, and/or GC-rich region) relative to the corresponding wild-type Anellovirus sequence.
  • the mutant genome or fragment thereof comprises or encodes an exogenous effector.
  • ORF molecule refers to a polypeptide having an activity and/or a structural feature of an Anellovirus ORF protein (e.g., a polypeptide comprising an Anellovirus ORF1, ORF2, ORF2/2, ORF2/3, ORF1/1, and/or ORF1/2 protein), or a functional fragment thereof.
  • the polypeptide may comprise an activity and/or structural feature of any of the Anellovirus ORFs described herein (e.g., any of an Anellovirus ORF1, ORF2, ORF2/2, ORF2/3, ORF1/1, and/or ORF1/2), or a functional fragment thereof.
  • polypeptide comprises an activity and/or structural feature of the corresponding Anellovirus ORF protein, or a functional fragment thereof (for example, as defined below for “ORF1 molecule”).
  • ORF2 molecule comprises an activity and/or structural feature of an Anellovirus ORF2 protein, or a functional fragment thereof.
  • ORF1 molecule refers to a polypeptide having an activity and/or a structural feature of an Anellovirus ORF1 protein (e.g., an Anellovirus ORF1 protein as described herein), or a functional fragment thereof.
  • An ORF1 molecule may, in some instances, comprise one or more of (e.g., 1, 2, 3 or 4 of): a first region comprising at least 60% basic residues (e.g., at least 60% arginine residues), a second region compising at least about six beta strands (e.g., at least 4, 5, 6, 7, 8, 9, 10, 11, or 12 beta strands), a third region comprising a structure or an activity of an Anellovirus N22 domain (e.g., as described herein, e.g., an N22 domain from an Anellovirus ORF1 protein as described herein), and/or a fourth region comprising a structure or an activity of an Anellovirus C-terminal domain (CTD) (e.g., as described herein, e.g., a CTD from an Anellovirus ORF1 protein as described herein).
  • CTD Anellovirus C-terminal domain
  • the ORF1 molecule comprises, in N-terminal to C-terminal order, the first, second, third, and fourth regions.
  • an anellovector comprises an ORF1 molecule comprising, in N-terminal to C- terminal order, the first, second, third, and fourth regions.
  • An ORF1 molecule may, in some instances, comprise a polypeptide encoded by an Anellovirus ORF1 nucleic acid.
  • An ORF1 molecule may, in some instances, further comprise a heterologous sequence, e.g., a hypervariable region (HVR), e.g., an HVR from an Anellovirus ORF1 protein, e.g., as described herein.
  • HVR hypervariable region
  • An “Anellovirus ORF1 protein,” as used herein, refers to an ORF1 protein encoded by an Anellovirus genome (e.g., a wild-type Anellovirus genome, e.g., as described herein).
  • ORF2 molecule refers to a polypeptide having an activity and/or a structural feature of an Anellovirus ORF2 protein (e.g., an Anellovirus ORF2 protein as described herein), or a functional fragment thereof.
  • An “Anellovirus ORF2 protein,” as used herein, refers to an ORF2 protein encoded by an Anellovirus genome (e.g., a wild-type Anellovirus genome, e.g., as described herein).
  • proteinaceous exterior refers to an exterior component that is predominantly (e.g., >50%, >60%, > 70%, >80%, > 90%) protein.
  • regulatory nucleic acid refers to a nucleic acid sequence that modifies expression, e.g., transcription and/or translation, of a DNA sequence that encodes an expression product.
  • the expression product comprises RNA or protein.
  • regulatory sequence refers to a nucleic acid sequence that modifies transcription of a target gene product.
  • the regulatory sequence is a promoter or an enhancer.
  • a “substantially non-pathogenic” organism, particle, or component refers to an organism, particle (e.g., a virus or an anellovector, e.g., as described herein), or component thereof that does not cause or induce an unacceptable disease or pathogenic condition, e.g., in a host organism, e.g., a mammal, e.g., a human.
  • administration of an anellovector to a subject can result in minor reactions or side effects that are acceptable as part of standard of care.
  • non-pathogenic refers to an organism or component thereof that does not cause or induce an undesirable condition (e.g., a disease or pathogenic condition), e.g., in a host organism, e.g., a mammal, e.g., a human.
  • a “substantially non-integrating” genetic element refers to a genetic element, e.g., a genetic element in a virus or anellovector, e.g., as described herein, wherein less than about 0.01%, 0.05%, 0.1%, 0.5%, or 1% of the genetic element that enter into a host cell (e.g., a eukaryotic cell) or organism (e.g., a mammal, e.g., a human) integrate into the genome.
  • a host cell e.g., a eukaryotic cell
  • organism e.g., a mammal, e.g., a human
  • the genetic element does not detectably integrate into the genome of, e.g., a host cell.
  • integration of the genetic element into the genome can be detected using techniques as described herein, e.g., nucleic acid sequencing, PCR detection and/or nucleic acid hybridization.
  • integration frequency is determined by quantitative gel purification assay of genomic DNA separated from free vector, e.g., as described in Wang et al. (2004, Gene Therapy 11: 711-721, incorporated herein by reference in its entirety).
  • a “substantially non-immunogenic” organism, particle, or component refers to an organism, particle (e.g., a virus or anellovector, e.g., as described herein), or component thereof, that does not cause or induce an undesired or untargeted immune response, e.g., in a host tissue or organism (e.g., a mammal, e.g., a human).
  • a substantially non-immunogenic organism, particle, or component does not produce a clinically significant immune response.
  • the substantially non-immunogenic anellovector does not produce a clinically significant immune response against a protein comprising an amino acid sequence or encoded by a nucleic acid sequence of an Anellovirus or anellovector genetic element.
  • an immune response e.g., an undesired or untargeted immune response
  • assaying antibody e.g., neutralizing antibody
  • presence or level e.g., presence or level of an anti-anellovector antibody, e.g., presence or level of an antibody against an anellovector as described herein
  • Antibodies e.g., neutralizing antibodies
  • Anti-viral antibodies e.g., methods of detecting anti-AAV antibodies, e.g., as described in Calcedo et al. (2013; Front. Immunol.4(341): 1-7; incorporated herein by reference).
  • a “subsequence” as used herein refers to a nucleic acid sequence or an amino acid sequence that is comprised in a larger nucleic acid sequence or amino acid sequence, respectively.
  • a subsequence may comprise a domain or functional fragment of the larger sequence.
  • the subsequence may comprise a fragment of the larger sequence capable of forming secondary and/or tertiary structures when isolated from the larger sequence similar to the secondary and/or tertiary structures formed by the subsequence when present with the remainder of the larger sequence.
  • a subsequence can be replaced by another sequence (e.g., a subseqence comprising an exogenous sequence or a sequence heterologous to the remainder of the larger sequence, e.g., a corresponding subsequence from a different Anellovirus).
  • This invention relates generally to anellovectors, e.g., synthetic anellovectors, and uses thereof.
  • the present disclosure provides anellovectors, compositions comprising anellovectors, and methods of making or using anellovectors.
  • Anellovectors are generally useful as delivery vehicles, e.g., for delivering a therapeutic agent to a eukaryotic cell.
  • an anellovector described herein will include a genetic element comprising an RNA sequence (e.g., an RNA sequence encoding an effector, e.g., an exogenous effector or an endogenous effector) enclosed within a proteinaceous exterior.
  • An anellovector may include one or more deletions of sequences (e.g., regions or domains as described herein) relative to an Anellovirus sequence (e.g., as described herein).
  • Anellovectors can be used as a substantially non-immunogenic vehicle for delivering the genetic element, or an effector encoded therein (e.g., a polypeptide or nucleic acid effector, e.g., as described herein), into eukaryotic cells, e.g., to treat a disease or disorder in a subject comprising the cells.
  • TABLE OF CONTENTS I. Compositions and Methods for Making Anellovectors by In Vitro Assembly
  • A. Components and Assembly of Anellovectors i. ORF1 molecules for assembly of Anellovectors ii. ORF2 molecules for assembly of Anellovectors
  • Genetic Elements i. Genetic Elements comprising RNA a. RNA-only genetic elements b.
  • RNA-based genetic elements c. RNA/DNA conjugates
  • Genetic Element Constructs D. Production of RNA-based genetic elements E. Production of protein components i. Baculovirus expression systems ii. Insect cell systems iii. Mammalian cell systems F. Effectors G. In vitro assembly methods H. Enrichment and Purification II. Anellovectors A. Anelloviruses B. ORF1 molecules C. ORF2 molecules D. Genetic elements E. Protein binding sequences F.5’ UTR regions G. GC-rich regions H. Effectors I. Regulatory Sequences J. Other Sequences K. Proteinaceous exterior III. Methods of use IV. Administration/Delivery I.
  • compositions and methods for Making Anellovectors by In Vitro Assembly provides, in some aspects, compositions and methods that can be used for producing anellovectors, e.g., anellovectors having a genetic element comprising RNA, as described herein.
  • the compositions and methods described herein can be used to produce a genetic element or a genetic element construct.
  • the compositions and methods described herein can be used to produce a genetic element or a genetic element construct by in vitro assembly.
  • compositions and methods described herein can be used to produce one or more Anellovirus ORF molecules (e.g., an ORF1, ORF2, ORF2/2, ORF2/3, ORF1/1, or ORF1/2 molecule, or a functional fragment or splice variant thereof).
  • the compositions and methods described herein can be used to produce a proteinaceous exterior or a component thereof (e.g., an ORF1 molecule), e.g., in a host cell (e.g., an insect cell, e.g., an Sf9 cell).
  • a host cell e.g., an insect cell, e.g., an Sf9 cell.
  • Components and Assembly of Anellovectors The compositions and methods herein can be used to produce anellovectors.
  • an anellovector generally comprises a genetic element (e.g., an RNA molecule) enclosed within a proteinaceous exterior (e.g., comprising a polypeptide encoded by an Anellovirus ORF1 nucleic acid, e.g., as described herein).
  • the genetic element comprises one or more sequences encoding Anellovirus ORFs (e.g., one or more of an Anellovirus ORF1, ORF2, ORF2/2, ORF2/3, ORF1/1, or ORF1/2).
  • an Anellovirus ORF or ORF molecule includes a polypeptide comprising an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a corresponding Anellovirus ORF sequence, e.g., as described in PCT/US2018/037379 or PCT/US19/65995 (each of which is incorporated by reference herein in their entirety).
  • the genetic element comprises a sequence encoding an Anellovirus ORF1, or a splice variant or functional fragment thereof (e.g., a jelly-roll region, e.g., as described herein).
  • the proteinaceous exterior comprises a polypeptide encoded by an Anellovirus ORF1 nucleic acid (e.g., an Anellovirus ORF1 molecule or a splice variant or functional fragment thereof).
  • an anellovector is assembled by enclosing a genetic element (e.g., as described herein) within a proteinaceous exterior (e.g., as described herein).
  • the genetic element is enclosed within the proteinaceous exterior in a host cell (e.g., an insect cell, e.g., an Sf9 cell).
  • the host cell expresses one or more polypeptides comprised in the proteinaceous exterior (e.g., a polypeptide encoded by an Anellovirus ORF1 nucleic acid, e.g., an ORF1 molecule).
  • the host cell comprises a nucleic acid sequence encoding an Anellovirus ORF1 molecule, e.g., a splice variant or a functional fragment of an Anellovirus ORF1 polypeptide (e.g., a wild-type Anellovirus ORF1 protein or a polypeptide encoded by a wild-type Anellovirus ORF1 nucleic acid, e.g., as described herein).
  • the nucleic acid sequence encoding the Anellovirus ORF1 molecule is comprised in a nucleic acid construct (e.g., a plasmid, viral vector, virus, minicircle, bacmid, or artificial chromosome) comprised in the host cell.
  • the nucleic acid sequence encoding the Anellovirus ORF1 molecule is integrated into the genome of the host cell.
  • the host cell comprises the genetic element and/or a nucleic acid construct comprising the sequence of the genetic element.
  • the nucleic acid construct is selected from a plasmid, viral nucleic acid, minicircle, bacmid, or artificial chromosome.
  • the genetic element is excised from the nucleic acid construct (e.g., bacmid) and, optionally, converted from a double-stranded form to a single-stranded form (e.g., by denaturation).
  • the genetic element is generated by a polymerase based on a template sequence in the nucleic acid construct (e.g., bacmid).
  • the polymerase produces a single-stranded copy of the genetic element sequence, which can optionally be circularized to form a genetic element as described herein.
  • the host cell comprises a genetic element construct (e.g., a bacmid, plasmid, or minicircle) and a bacmid comprising one or more sequences encoding Anellovirus ORF molecules (e.g., ORF1, ORF2, ORF2/2, ORF2/3, ORF1/1, and/or ORF1/2 ORF molecules), or functional fragments thereof.
  • proteinaceous exterior proteins are expressed from the bacmid.
  • the proteinaceous exterior proteins expressed from the bacmid enclose a genetic element, thereby forming an anellovector.
  • the bacmid comprises a backbone suitable for replication of the nucleic acid construct in insect cells (e.g., Sf9 cells), e.g., a baculovirus backbone region.
  • the bacmid comprises a backbone region suitable for replication of the genetic element construct in bacterial cells (e.g., E. coli cells, e.g., DH 10Bac cells).
  • the genetic element construct comprises a backbone suitable for replication of the nucleic acid construct in insect cells (e.g., Sf9 cells), e.g., a baculovirus backbone region.
  • the genetic element construct comprises a backbone region suitable for replication of the genetic element construct in bacterial cells (e.g., E. coli cells, e.g., DH 10Bac cells).
  • the bacmid is introduced into the host cell via a baculovirus particle.
  • the bacmid is produced by a producer cell, e.g., an insect cell (e.g., an Sf9 cell) or a bacterial cell (e.g., an E.
  • the producer cell comprises a bacmid and/or a donor vector, e.g., as described herein.
  • the producer cell further comprises sufficient cellular machinery for replication of the bacmid and/or donor vector.
  • ORF1 Molecules e.g., for assembly of Anellovectors
  • An anellovector can be made, for example, by enclosing a genetic element within a proteinaceous exterior.
  • the enclosure occurs in a cell-free system or in a cell.
  • the proteinaceous exterior of an Anellovector generally comprises a polypeptide encoded by an Anellovirus ORF1 nucleic acid (e.g., an Anellovirus ORF1 molecule or a splice variant or functional fragment thereof, e.g., as described herein).
  • an Anellovirus ORF1 nucleic acid e.g., an Anellovirus ORF1 molecule or a splice variant or functional fragment thereof, e.g., as described herein.
  • An ORF1 molecule may, in some embodiments, comprise one or more of: a first region comprising an arginine rich region, e.g., a region having at least 60% basic residues (e.g., at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% basic residues; e.g., between 60%-90%, 60%- 80%, 70%-90%, or 70-80% basic residues), and a second region comprising jelly-roll domain, e.g., at least six beta strands (e.g., 4, 5, 6, 7, 8, 9, 10, 11, or 12 beta strands).
  • a first region comprising an arginine rich region, e.g., a region having at least 60% basic residues (e.g., at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% basic residues; e.g., between 60%-90%, 60%- 80%, 70%-90%, or 70-80% basic residues), and
  • the proteinaceous exterior comprises one or more (e.g., 1, 2, 3, 4, or all 5) of an Anellovirus ORF1 arginine-rich region, jelly-roll region, N22 domain, hypervariable region, and/or C-terminal domain.
  • the proteinaceous exterior comprises an Anellovirus ORF1 jelly-roll region (e.g., as described herein).
  • the proteinaceous exterior comprises an Anellovirus ORF1 arginine-rich region (e.g., as described herein).
  • the proteinaceous exterior comprises an Anellovirus ORF1 N22 domain (e.g., as described herein).
  • the proteinaceous exterior comprises an Anellovirus hypervariable region (e.g., as described herein). In some embodiments, the proteinaceous exterior comprises an Anellovirus ORF1 C-terminal domain (e.g., as described herein). In some embodiments, the anellovector comprises an ORF1 molecule and/or a nucleic acid encoding an ORF1 molecule. Generally, an ORF1 molecule comprises a polypeptide having the structural features and/or activity of an Anellovirus ORF1 protein (e.g., an Anellovirus ORF1 protein as described herein), or a functional fragment thereof.
  • the ORF1 molecule comprises a truncation relative to an Anellovirus ORF1 protein (e.g., an Anellovirus ORF1 protein as described herein).
  • the ORF1 molecule is truncated by at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, or 700 amino acids of the Anellovirus ORF1 protein.
  • an ORF1 molecule comprises an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to an Alphatorquevirus, Betatorquevirus, or Gammatorquevirus ORF1 protein, e.g., as described herein.
  • An ORF1 molecule can generally bind to a nucleic acid molecule, such as DNA (e.g., a genetic element, e.g., as described herein).
  • an ORF1 molecule localizes to the nucleus of a cell.
  • an ORF1 molecule localizes to the nucleolus of a cell.
  • an ORF1 molecule may be capable of binding to other ORF1 molecules, e.g., to form a proteinaceous exterior (e.g., as described herein). Such an ORF1 molecule may be described as having the capacity to form a capsid.
  • the proteinaceous exterior may enclose a nucleic acid molecule (e.g., a genetic element as described herein).
  • a plurality of ORF1 molecules may form a multimer, e.g., to produce a proteinaceous exterior.
  • the multimer may be a homomultimer. In other embodiments, the multimer may be a heteromultimer.
  • ORF2 Molecules for assembly of Anellovectors Producing an anellovector using the compositions or methods described herein may involve expression of an Anellovirus ORF2 molecule (e.g., as described herein), or a splice variant or functional fragment thereof.
  • the anellovector comprises an ORF2 molecule, or a splice variant or functional fragment thereof, and/or a nucleic acid encoding an ORF2 molecule, or a splice variant or functional fragment thereof.
  • the anellovector does not comprise an ORF2 molecule, or a splice variant or functional fragment thereof, and/or a nucleic acid encoding an ORF2 molecule, or a splice variant or functional fragment thereof.
  • producing the anellovector comprises expression of an ORF2 molecule, or a splice variant or functional fragment thereof, but the ORF2 molecule is not incorporated into the anellovector.
  • Genetic Elements Genetic Elements comprising RNA
  • a genetic element is or comprises a nucleic acid.
  • a genetic element is a single-stranded polynucleotide.
  • a genetic element comprises one or more double stranded regions.
  • a genetic element comprises RNA. In some embodiments, the genetic element comprises an RNA hairpin structure. In some embodiments, the genetic element is an mRNA, e.g., a chemically modified mRNA. In some embodiments, a genetic element consists of at least 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% RNA. In some embodiments, the genetic element comprises a DNA strand and an RNA strand, e.g., wherein at least a portion of the DNA strand hybridizes to at least a portion of the RNA strand.
  • the genetic element does not encode any of an Anellovirus ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, or ORF2t/3.
  • the RNA genetic element encodes an effector, e.g., an effector protein.
  • the RNA genetic element is or comprises an effector, e.g., a functional RNA.
  • RNA is selected from the group consisting of mRNA, rRNA, tRNA (e.g., a TREM), regulatory RNA, non-coding RNA, long non-coding RNA (lncRNA), circular RNA (circRNA), double stranded RNA (dsRNA), guide RNA (gRNA), small interfering RNA (siRNA), short hairpin RNA (shRNA), piwi-interacting RNA (piRNA), small nucleolar RNA (snoRNA), small nuclear RNA (snRNA), extracellular RNA (exRNA), small Cajal body-specific RNA (scaRNA), microRNA (miRNA), and other RNAi molecules.
  • TREM TREM
  • regulatory RNA non-coding RNA
  • lncRNA long non-coding RNA
  • circRNA circular RNA
  • dsRNA double stranded RNA
  • gRNA guide RNA
  • small interfering RNA small interfering RNA
  • shRNA short hairpin RNA
  • the genetic element comprises RNA, e.g., chemically modified RNA.
  • RNA comprises one or more chemical modifications to one or more bases.
  • RNA comprises one or more chemical modifications to one or more sugars.
  • at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides of RNA of a genetic element are chemically modified.
  • RNA comprises one or more backbone modifications.
  • a modification comprises a non-naturally occurring modification, e.g., a modification described in any one of Tables 5-9.
  • a non-naturally occurring modification can be made according to methods known in the art.
  • a genetic element described herein comprises a non-naturally occurring modification provided in Table 5, or a combination thereof.
  • Table 5 Exemplary non-naturally occurring modifications Name Symbol Base Naturally 6-(alkyl)adenine -- A NO 2' -b-Ethynyladenosine TP -- A NO 8-Trifluoromethyladenosine TP -- A NO 5-(trifluoromethyl)cytosine -- C NO 2'-b-Trifluoromethylcytidine TP -- C NO 8-oxo-guanosine -- G NO deaza guanine -- G NO 4' -Ethynylguanosine TP -- G NO 2 (thio)pseudouracil -- U NO 5 (methylaminomethyl)-4 (thio)uracil -- U NO 5-aminoallyl-uridine -- U NO dihydropseudouridine -- U NO 1-(4-Chlorobenzy
  • RNAs RNAs
  • Table 6 Additional exemplary modifications Name Symbol Base Naturally 3-methylcytidine m3C C YES N2, 7,2 '-O-trimethylguanosine m27 G YES 5-(carboxyhydroxymethyl)uridine chm5U U YES TP
  • a genetic element described herein comprises a non-naturally occurring modification provided in Table 7, or a combination thereof.
  • a genetic element described herein comprises a non-naturally occurring modification provided in Table 8, or a combination thereof.
  • Table 8 Exemplary backbone modifications chiral phosphorothioates
  • a genetic element described herein comprises a non-naturally occurring modification provided in Table 9, or a combination thereof.
  • Table 9 Exemplary non-naturally occurring backbone modificiations 5'phosphorothioate
  • the genetic element comprises a cap.
  • a cap is typically placed at the 5’ end of an mRNA, but a cap can also be positioned at the 3’ end of an RNA.
  • a cap protects the genetic element from exonuclease degradation, and can help in delivery and/or localization within a cell.
  • the cap can be present at the 5’-terminus (5’-cap) or at the 3’-terminal (3’-cap) or can be present on both termini.
  • Non-limiting examples of a 5’-cap include, but are not limited to, glyceryl, inverted deoxy abasic residue (moiety); 4’,5’-methylene nucleotide; 1-(beta-D-erythrofuranosyl) nucleotide, 4’-thio nucleotide; carbocyclic nucleotide; 1,5-anhydrohexitol nucleotide; L-nucleotides; alpha-nucleotides; modified base nucleotide; phosphorodithioate linkage; threo-pentofuranosyl nucleotide; acyclic 3’,4’-seco nucleotide; acyclic 3,4-dihydroxybutyl nucleotide; acyclic 3,5- dihydroxypentyl nucleotide, 3’-3’-inverted nucleotide moiety; 3’-3’-inverted abasic moiety; 3’-2
  • Non-limiting examples of the 3’-cap include, but are not limited to, glyceryl, inverted deoxy abasic residue (moiety), 4’, 5’-methylene nucleotide; 1-(beta-D-erythrofuranosyl) nucleotide; 4’-thio nucleotide, carbocyclic nucleotide; 5’-amino-alkyl phosphate; 1,3-diamino-2-propyl phosphate; 3- aminopropyl phosphate; 6-aminohexyl phosphate; 1,2-aminododecyl phosphate; hydroxypropyl phosphate; 1,5-anhydrohexitol nucleotide; L-nucleotide; alpha-nucleotide; modified base nucleotide; phosphorodithioate; threo-pentofuranosyl nucleotide; acyclic 3’,4’-seco nucle
  • the genetic element comprises a poly-A tail.
  • a poly-A tail comprises at least about 5, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, or 100 adenosines in length.
  • RNA lacks a poly-A tail.
  • the RNA comprises no more than about 5, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, or 100 sequential adenosines.
  • a genetic element is linear.
  • a genetic element is circular.
  • a genetic element comprises a first region and a second region that can hybridize with the first region.
  • a genetic element comprises a first region and a second region that can hybridize with the first region to form a circle. In some embodiments, a genetic element does not comprise a 5’ or a 3’ end. In some embodiments, a genetic element does not comprise one or both of a free phosphate and a free sugar. In some embodiments, every phosphate in a genetic element is coalently linked to a first sugar by a first oxygen atom comprised by the phosphate and a second sugar by a second oxygen atom comprised by a phosphate.
  • every sugar in a genetic element is covalently linked to a first phosphate by a first carbon atom comprised by the sugar and a second phosphate by a second carbon atom comprised by the sugar.
  • a genetic element is produced by circularizing a linear RNA. Circular RNAs are described, e.g., in US Patent Publication 20200306286, which is herein incorporated by reference in its entirety.
  • a genetic element is about 10-20, 20-30, 30-40, 50-6060-70, 70-80, 80- 90, 90-100, 100-125, 125-150, 150-200, 200-300, 300-400, 400-500, 500-600, 600-700, 700-800, 800- 900, 900-1000, 1000-1500, 1500-2000, 2000-2500, 2500-3000, 3000-3500, 3500-4000, or 4000-4500 nucleotides in length.
  • a genetic element is at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 250, 300, 400, 500, 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000, or 4500 nucleotides in length.
  • RNA-only genetic elements In some embodiments, a genetic element consists of or consists essentially of RNA. For example, in some embodiments, a genetic element is substantially free of DNA.
  • a genetic element comprises single stranded RNA. In some embodiments, a genetic element comprises at least one double stranded region.
  • a double stranded region of a genetic element comprises a region of RNA pairing with RNA.
  • Hybridized RNA-ssDNA genetic elements comprises a DNA region.
  • a genetic element comprising RNA further comprises a DNA region.
  • a genetic element may be single stranded, wherein a first portion of the single strand comprises ribonucleotides and a second portion of the single strand comprises deoxyribonucleotides.
  • a genetic element comprising a DNA region comprises one or more DNA nucleotides with chemical modification.
  • a genetic element comprises a DNA region, wherein all nucleotides of the DNA region are chemically modified. In some embodiments, at least a portion of a genetic element is single stranded. In some embodiments, a genetic element is single stranded. In some embodiments, a genetic element comprises ssDNA. In some embodiments, a genetic element comprises a double stranded region. In some embodiments, a double stranded region of a genetic element comprises a region of RNA pairing with RNA. In some such embodiments, a double stranded region of a genetic element comprises a region of DNA pairing with RNA.
  • a DNA region hybridizes to at least a portion of the RNA of the genetic element.
  • a DNA region is about 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-150, 150-200, 200-300, 300-400, 400-500, 500-600, 600-700, 700-800, 800-900, or 900-1000 nucleotides in length.
  • RNA/DNA conjugates In some embodiments, a genetic element comprises a DNA region. In some embodiments, a genetic element comprising RNA further comprises a DNA region. In some embodiments, a genetic element comprising a DNA region comprises one or more DNA nucleotides with chemical modification.
  • a genetic element comprising a DNA region, wherein all nucleotides of the DNA region are chemically modified. In some embodiments, at least a portion of a genetic element is single stranded. In some embodiments, a genetic element is single stranded. In some embodiments, a genetic element comprises ssDNA. In some embodiments, a genetic element comprises a double stranded region. In some embodiments, a double stranded region of a genetic element comprises a region of RNA pairing with RNA. In some such embodiments, a double stranded region of a genetic element comprises a region of DNA pairing with RNA.
  • a DNA region is covalently linked to the RNA of the genetic element.
  • a DNA region is about 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-150, 150-200, 200-300, 300-400, 400-500, 500-600, 600-700, 700-800, 800-900, or 900-1000 nucleotides in length.
  • Genetic Element Constructs In some embodiments, a genetic element is produced from a genetic element construct.
  • the genetic element construct is DNA, e.g., double stranded DNA, and the genetic element may be produced by transcription, generating an RNA genetic element.
  • the genetic element of an anellovector as described herein may be produced from a genetic element construct that comprises a genetic element region and optionally other sequence such as a bacmid (e.g., comprising a baculovirus genome or a fragment thereof, e.g., one or more baculovirus elements) or donor vector backbone.
  • the genetic element construct comprises an Anellovirus 5’ UTR (e.g., as described herein).
  • a genetic element construct may be any nucleic acid construct suitable for delivery of the sequence of the genetic element into a host cell or cell-free system in which the genetic element can be enclosed within a proteinaceous exterior.
  • the genetic element construct comprises a promoter.
  • transcription from the genetic element construct produces an RNA genetic element.
  • the genetic element construct is a linear nucleic acid molecule.
  • the genetic element construct is a circular nucleic acid molecule (e.g., a plasmid, bacmid, donor vector, or a minicircle, e.g., as described herein).
  • the genetic element construct may, in some embodiments, be double-stranded. In other embodiments, the genetic element is single-stranded.
  • the genetic element construct comprises DNA. In some embodiments, the genetic element construct comprises RNA. In some embodiments, the genetic element construct comprises one or more modified nucleotides. Plasmids In some embodiments, the genetic element construct is a plasmid.
  • the plasmid will generally comprise the sequence of a genetic element as described herein as well as an origin of replication suitable for replication in a host cell (e.g., a bacterial origin of replication for replication in bacterial cells) and a selectable marker (e.g., an antibiotic resistance gene). In some embodiments, the sequence of the genetic element can be excised from the plasmid. In some embodiments, the plasmid is capable of replication in a bacterial cell.
  • the plasmid is capable of replication in a mammalian cell (e.g., a human cell).
  • a plasmid is at least 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, or 5000 bp in length.
  • the plasmid is less than 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, or 10,000 bp in length.
  • the plasmid has a length between 300-400, 400-500, 500-600, 600-700, 700-800, 800-900, 900-1000, 1000-1500, 1500-2000, 2000-2500, 2500-3000, 3000-4000, or 4000-5000 bp.
  • Small circular nucleic acid constructs In some embodiments, the genetic element construct is a circular nucleic acid construct, e.g., lacking a vector backbone (e.g., lacking a bacterial origin of replication and/or selectable marker). In embodiments, the genetic element is a single- or double-stranded circular nucleic acid construct. In embodiments, the circular nucleic acid construct is produced by in vitro circularization (IVC), e.g., as described herein.
  • IVC in vitro circularization
  • the double-stranded circular nucleic acid construct can be introduced into a host cell, in which it can be converted into or used as a template for generating single-stranded circular genetic elements, e.g., as described herein.
  • the circular nucleic acid constructdoes not comprise a plasmid backbone or a functional fragment thereof.
  • the circular nucleic acid construct is at least 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2700, 2800, 2900, 3000, 3100, 3200, 3300, 3400, 3500, 3600, 3700, 3800, 3900, 4000, 4100, 4200, 4300, 4400, or 4500 bp in length.
  • the circular nucleic acid construct is less than 2900, 3000, 3100, 3200, 3300, 3400, 3500, 3600, 3700, 3800, 3900, 4000, 4100, 4200, 4300, 4400, 4500, 4600, 4700, 4800, 4900, 5000, 5500, or 6000 bp in length.
  • the circular nucleic acid construct is between 2000-2100, 2100-2200, 2200-2300, 2300-2400, 2400-2500, 2500-2600, 2600-2700, 2700-2800, 2800- 2900, 2900-3000, 3000-3100, 3100-3200, 3200-3300, 3300-3400, 3400-3500, 3500-3600, 3600-3700, 3700-3800, 3800-3900, 3900-4000, 4000-4100, 4100-4200, 4200-4300, 4300-4400, or 4400-4500 bp in length.
  • the circular nucleic acid construct is a minicircle.
  • a genetic element construct (e.g., a bacmid or donor vector) as described herein comprises one or more sequences encoding one or more Anellovirus ORFs, e.g., proteinaceous exterior components (e.g., polypeptides encoded by an Anellovirus ORF1 nucleic acid, e.g., as described herein).
  • the genetic element construct may comprise a nucleic acid sequence encoding an Anellovirus ORF1 molecule.
  • Such genetic element constructs can be suitable for introducing the genetic element and the Anellovirus ORF(s) into a host cell in cis.
  • a genetic element construct as described herein does not comprise sequences encoding one or more Anellovirus ORFs, e.g., proteinaceous exterior components (e.g., polypeptides encoded by an Anellovirus ORF1 nucleic acid, e.g., as described herein).
  • the genetic element construct may not comprise a nucleic acid sequence encoding an Anellovirus ORF1 molecule.
  • Such genetic element constructs can be suitable for introducing the genetic element into a host cell, with the one or more Anellovirus ORFs to be provided in trans (e.g., via introduction of a second nucleic acid construct encoding one or more of the Anellovirus ORFs, or via an Anellovirus ORF cassette integrated into the genome of the host cell).
  • the genetic element construct comprises a backbone suitable for replication of the nucleic acid construct in insect cells (e.g., Sf9 cells), e.g., a baculovirus backbone region.
  • the genetic element construct comprises a backbone region suitable for replication of the genetic element construct in bacterial cells (e.g., E.
  • the genetic element construct (e.g., bacmid or donor vector) comprises a sequence encoding an Anellovirus ORF1 molecule, or a splice variant or functional fragment thereof (e.g., a jelly-roll region, e.g., as described herein).
  • the portion of the genetic element that does not comprise the sequence of the genetic element comprises the sequence encoding the Anellovirus ORF1 molecule, or splice variant or functional fragment thereof (e.g., in a cassette comprising a promoter and the sequence encoding the Anellovirus ORF1 molecule, or splice variant or functional fragment thereof).
  • the portion of the construct comprising the sequence of the genetic element comprises a sequence encoding an Anellovirus ORF1 molecule, or a splice variant or functional fragment thereof (e.g., a jelly-roll region, e.g., as described herein).
  • enclosure of such a genetic element in a proteinaceous exterior produces a replication-component anellovector (e.g., an anellovector that upon infecting a cell, enables the cell to produce additional copies of the anellovector without introducing further nucleic acid constructs, e.g., encoding one or more Anellovirus ORFs as described herein, into the cell).
  • the genetic element does not comprise a sequence encoding an Anellovirus ORF1 molecule, or a splice variant or functional fragment thereof (e.g., a jelly-roll region, e.g., as described herein).
  • enclosure of such a genetic element in a proteinaceous exterior produces a replication-incompetent anellovector (e.g., an anellovector that, upon infecting a cell, does not enable the infected cell to produce additional anellovectors, e.g., in the absence of one or more additional constructs, e.g., encoding one or more Anellovirus ORFs as described herein).
  • a genetic element construct (e.g., bacmid or donor vector) comprises one or more cassettes for expression of a polypeptide or noncoding RNA (e.g., a miRNA or an siRNA).
  • the genetic element construct comprises a cassette for expression of an effector (e.g., an exogenous or endogenous effector), e.g., a polypeptide or noncoding RNA, as described herein.
  • the genetic element construct comprises a cassette for expression of an Anellovirus protein (e.g., an Anellovirus ORF1, ORF2, ORF2/2, ORF2/3, ORF1/1, or ORF1/2, or a functional fragment thereof).
  • the expression cassettes may, in some embodiments, be located within the genetic element sequence.
  • an expression cassette for an effector is located within the genetic element sequence.
  • an expression cassette for an Anellovirus protein is located within the genetic element sequence.
  • the expression cassettes are located at a position within the genetic element construct outside of the sequence of the genetic element (e.g., in the backbone).
  • an expression cassette for an Anellovirus protein is located at a position within the genetic element construct outside of the sequence of the genetic element (e.g., in the backbone).
  • a polypeptide expression cassette generally comprises a promoter and a coding sequence encoding a polypeptide, e.g., an effector (e.g., an exogenous or endogenous effector as described herein) or an Anellovirus protein (e.g., a sequence encoding an Anellovirus ORF1, ORF2, ORF2/2, ORF2/3, ORF1/1, or ORF1/2, or a functional fragment thereof).
  • an effector e.g., an exogenous or endogenous effector as described herein
  • an Anellovirus protein e.g., a sequence encoding an Anellovirus ORF1, ORF2, ORF2/2, ORF2/3, ORF1/1, or ORF1/2, or a functional fragment thereof.
  • promoters that can be included in an polypeptide expression cassette (e.g., to drive expression of the polypeptide) include, without limitation, constitutive promoters (e.g., CMV, RSV, PGK, EF1a, or SV40), cell or tissue-specific promoters (e.g., skeletal ⁇ -actin promoter, myosin light chain 2A promoter, dystrophin promoter, muscle creatine kinase promoter, liver albumin promoter, hepatitis B virus core promoter, osteocalcin promoter, bone sialoprotein promoter, CD2 promoter, immunoglobulin heavy chain promoter, T cell receptor a chain promoter, neuron-specific enolase (NSE) promoter, or neurofilament light-chain promoter), and inducible promoters (e.g., zinc-inducible sheep metallothionine (MT) promoter; the dexamethasone (Dex)-inducible mouse mammary tumor virus (MMTV)
  • the expression cassette further comprises an enhancer, e.g., as described herein.
  • an enhancer e.g., as described herein.
  • An RNA-based genetic element may be produced by a variety of methods. For example, a genetic element construct comprising DNA can be transcribed to produce a genetic element that comprises RNA, e.g., as described above. The transcription may take place, e.g., in a cell or a cell-free system. RNA may be synthesized in vitro, for example, by solid phase synthesis. Production of protein components Protein components of an anellovector, e.g., ORF1, can be produced in a variety of ways described herein.
  • Baculovirus expression systems A viral expression system, e.g., a baculovirus expression system, may be used to express proteins (e.g., for production of anellovectors), e.g., as described herein.
  • Baculoviruses are rod-shaped viruses with a circular, supercoiled double-stranded DNA genome. Genera of baculoviruses include: Alphabaculovirus (nucleopolyhedroviruses (NPVs) isolated from Lepidoptera), Betabaculoviruses (granuloviruses (GV) isolated from Lepidoptera), Gammabaculoviruses (NPVs isolated from Hymenoptera) and Deltabaculoviruses (NPVs isolated from Diptera).
  • Alphabaculovirus nucleopolyhedroviruses
  • Betabaculoviruses granuloviruses (GV) isolated from Lepidoptera
  • Gammabaculoviruses NPVs isolated from Hymen
  • GVs typically contain only one nucleocapsid per envelope
  • NPVs typically contain either single (SNPV) or multiple (MNPV) nucleocapsids per envelope.
  • SNPV single
  • MNPV multiple nucleocapsids per envelope.
  • the enveloped virions are further occluded in granulin matrix in GVs and polyhedrin in NPVs.
  • Baculoviruses typically have both lytic and occluded life cycles.
  • the lytic and occluded life cycles manifest independently throughout the three phases of virus replication: early, late, and very late phase.
  • viral DNA replication takes place following viral entry into the host cell, early viral gene expression and shut- off of the host gene expression machinery.
  • baculoviruses infect insect species, they can be used as biological agents to produce exogenous proteins in baculoviruses-permissive insect cells or larvae.
  • baculovirus such as Autographa californica multiple nuclear polyhedrosis virus (AcMNPV) and Bombyx mori (silkworm) nuclear polyhedrosis virus (BmNPV) may be used in exogenous protein expression.
  • AcMNPV Autographa californica multiple nuclear polyhedrosis virus
  • BmNPV Bombyx mori nuclear polyhedrosis virus
  • baculoviral expression systems are commercially available, e.g., from ThermoFisher.
  • the proteins described herein may be expressed using a baculovirus expression vector (e.g., a bacmid) that comprises one or more components described herein.
  • a baculovirus expression vector e.g., a bacmid
  • a baculovirus expression vector may include one or more of (e.g., all of) a selectable marker (e.g., kanR), an origin of replication (e.g., one or both of a bacterial origin of replication and an insect cell origin of replication), a recombinase recognition site (e.g., an att site), and a promoter.
  • a baculovirus expression vector e.g., a bacmid as described herein
  • the genes encoding the proteins described herein are cloned into a baculovirus expression vector (e.g., a bacmid as described herein) containing a baculovirus promoter.
  • a baculovirual vector comprises one or more non-baculoviral promoters, e.g., a mammalian promoter or an Anellovirus promoter.
  • the genes encoding the proteins described herein are cloned into a donor vector (e.g., as described herein), which is then contacted with an empty baculovirus expression vector (e.g., an empty bacmid) such that the genes encoding the proteins described herein are transferred (e.g., by homologous recombination or transposase activity) from the donor vector into the baculovirus expression vector (e.g., bacmid).
  • the baculovirus promoter is flanked by baculovirus DNA from the nonessential polyhedrin gene locus.
  • a protein described herein is under the transcriptional control of the AcNPV polyhedrin promoter in the very late phase of viral replication.
  • a strong promoter suitable for use in baculoviral expression in insect cells include, but are not limited to, baculovirus p10 promoters, polyhedrin (polh) promoters, p6.9 promoters and capsid protein promoters.
  • Weak promoters suitable for use in baculoviral expression in insect cells include ie1, ie2, ie0, et1, 39K (aka pp31) and gp64 promoters of baculoviruses.
  • a recombinant baculovirus is produced by homologous recombination between a baculoviral genome (e.g., a wild-type or mutant baculoviral genome), and a transfer vector.
  • a baculoviral genome e.g., a wild-type or mutant baculoviral genome
  • the transfer vector further contains a baculovirus promoter flanked by DNA from a nonessential gene locus, e.g., polyhedrin gene.
  • one or more genes encoding a protein described herein are inserted into the baculoviral genome by homologous recombination between the baculoviral genome and the transfer vector.
  • the baculoviral genome is linearized at one or more unique sites. In some embodiments, the linearized sites are located near the target site for insertion of genes encoding the proteins described herein into the baculoviral genome. In some embodiments, a linearized baculoviral genome missing a fragment of the baculoviral genome downstream from a gene, e.g., polyhedrin gene, can be used for homologous recombination. In some embodiments, the baculoviral genome and transfer vector are co-transfected into insect cells.
  • the method of producing the recombinant baculovirus comprises the steps of preparing the baculoviral genome for performing homologous recombination with a transfer vector containing the genes encoding one or more protein described herein and co-transfecting the transfer vector and the baculoviral genome DNA into insect cells.
  • the baculoviral genome comprises a region homologous to a region of the transfer vector. These homologous regions may enhance the probability of recombination between the baculoviral genome and the transfer vector.
  • the homology region in the transfer vector is located upstream or downstream of the promoter.
  • baculoviral genome, and transfer vector are mixed at a weight ratio of about 1:1 to 10:1.
  • a recombinant baculovirus is generated by a method comprising site- specific transposition with Tn7, e.g., whereby the genes encoding the proteins described herein are inserted into bacmid DNA, e.g., propagated in bacteria, e.g., E. coli (e.g., DH 10Bac cells).
  • the genes encoding the proteins described herein are cloned into a pFASTBAC® vector and transformed into competent cells, e.g., DH10BAC® competent cells, containing the bacmid DNA with a mini-attTn7 target site.
  • the baculovirus expression vector e.g., pFASTBAC® vector
  • pFASTBAC® donor plasmids include: pFASTBAC 1, pFASTBAC HT, and pFASTBAC DUAL.
  • recombinant bacmid DNA containing-colonies are identified and bacmid DNA is isolated to transfect insect cells.
  • a baculoviral vector is introduced into an insect cell together with a helper nucleic acid. The introduction may be concurrent or sequential.
  • the helper nucleic acid provides one or more baculoviral proteins, e.g., to promote packaging of the baculoviral vector.
  • recombinant baculovirus produced in insect cells e.g., by homologous recombination
  • infect insect cells e.g., in the mid-logarithmic growth phase
  • recombinant bacmid DNA produced by site- specific transposition in bacteria e.g., E. coli
  • a transfection agent e.g., Cellfectin® II.
  • baculovirus expression systems are discussed in US patent applications Nos.14/447,341, 14/277,892, and 12/278,916, which are hereby incorporated by reference.
  • Insect cell systems The proteins described herein may be expressed in insect cells infected or transfected with recombinant baculovirus or bacmid DNA, e.g., as described above.
  • insect cells include: the Sf9 and Sf21 cells derived from Spodoptera frugiperda and the Tn-368 and High FiveTM BTI-TN-5B1-4 cells (also referred to as Hi5 cells) derived from Trichoplusia ni.
  • insect cell lines Sf21 and Sf9 derived from the ovaries of the pupal fall army worm Spodoptera frugiperda, can be used for the expression of recombinant proteins using the baculovirus expression system.
  • Sf21 and Sf9 insect cells may be cultured in commercially available serum-supplemented or serum-free media.
  • Suitable media for culturing insect cells include: Grace’s Supplemented (TNM-FH), IPL-41, TC-100, Schneider’s Drosophila, SF-900 II SFM, and EXPRESS- FIVETM SFM.
  • some serum-free media formulations utilize a phosphate buffer system to maintain a culture pH in the range of 6.0-6.4 (Licari et al. Insect cell hosts for baculovirus expression vectors contain endogenous exoglycosidase activity. Biotechnology Progress 9: 146-152 (1993) and Drugmand et al. Insect cells as factories for biomanufacturing.
  • a pH of 6.0-6.8 for cultivating various insect cell lines may be used.
  • insect cells are cultivated in suspension or as a monolayer at a temperature between 25° to 30°C with aeration. Additional information on insect cells is discussed, for example, in US Patent Application Nos.14/564,512 and 14/775,154, each of which is hereby incorporated by reference.
  • Mammalian cell systems the proteins described herein may be expressed in vitro in animal cell lines infected or transfected with a vector encoding the protein, e.g., as described herein.
  • Animal cell lines envisaged in the context of the present disclosure include porcine cell lines, e..g, immortalised porcine cell lines such as, but not limited to the porcine kidney epithelial cell lines PK-15 and SK, the monomyeloid cell line 3D4/31 and the testicular cell line ST. Also, other mammalian cells lines are included, such as CHO cells (Chinese hamster ovaries), MARC-145, MDBK, RK-13, EEL. Additionally or alternatively, particular embodiments of the methods of the invention make use of an animal cell line which is an epithelial cell line, i.e. a cell line of cells of epithelial lineage.
  • porcine cell lines e..g, immortalised porcine cell lines such as, but not limited to the porcine kidney epithelial cell lines PK-15 and SK, the monomyeloid cell line 3D4/31 and the testicular cell line ST.
  • other mammalian cells lines are included, such as CHO cells (Chinese
  • Cell lines suitable for expressing the proteins described herein include, but are not limited to cell lines of human or primate origin, such as human or primate kidney carcinoma cell lines.
  • Effectors The compositions and methods described herein can be used to produce a genetic element of an anellovector comprising a sequence encoding an effector (e.g., an exogenous effector or an endogenous effector), e.g., as described herein.
  • the genetic element is the effector, e.g., the genetic element is a functional RNA.
  • the effector may be, in some instances, an endogenous effector or an exogenous effector.
  • the effector is a therapeutic effector.
  • the effector comprises a polypeptide (e.g., a therapeutic polypeptide or peptide, e.g., as described herein).
  • the effector comprises a non-coding RNA (e.g., an miRNA, siRNA, shRNA, mRNA, lncRNA, RNA, DNA, antisense RNA, or gRNA).
  • the effector comprises a regulatory nucleic acid, e.g., as described herein.
  • An anellovector may be produced, e.g., by in vitro assembly.
  • the genetic element is contacted to ORF1 in vitro under conditions that allow for assembly.
  • baculovirus constructs are used to produce Anellovirus proteins. These proteins may then be used, e.g., for in vitro assembly to encapsidate a genetic element, e.g., a genetic element comprising RNA.
  • a polynucleotide encoding one or more Anellovirus protein is fused to a promoter for expression in a host cell, e.g., an insect or animal cell.
  • the polynucleotide is cloned into a baculovirus expression system.
  • a host cell e.g., an insect cell is infected with the baculovirus expression system and incubated for a period of time.
  • an infected cell is incubated for about 1, 2, 3, 4, 5, 10, 15, or 20 days. In some embodiments, an infected cell is lysed to recover the Anellovirus protein. In some embodiments, an isolated Anellovirus protein is purified. In some embodiments, an Anellovirus protein is purified using purification techniques including but not limited to chelating purification, heparin purification, gradient sedimentation purification and/or SEC purification. In some embodiments, a purified Anellovirus protein is mixed with a genetic element to encapsidate the genetic element, e.g., a genetic element comprising RNA. In some embodiments, a genetic element is encapisdated using an ORF1 protein, ORF2 protein, or modified version thereof.
  • the first nucleic acid may be an mRNA e.g., chemically modified mRNA
  • the second nucleic acid may be DNA.
  • DNA encoding Anellovirus (AV) ORF1 e.g., wildtype ORF1 protein, ORF1 proteins harboring mutations, e.g., to improve assembly efficiency, yield or stability, chimeric ORF1 protein, or fragments thereof
  • insect cell lines e.g., Sf9 and/or HighFive
  • animal cell lines e.g., chicken cell lines (MDCC)
  • bacterial cells e.g., E.
  • DNA encoding AV ORF1 may be untagged.
  • DNA encoding AV ORF1 may contain tags fused N-terminally and/or C-terminally.
  • DNA encoding AV ORF1 may harbor mutations, insertions or deletions within the ORF1 protein to introduce a tag, e.g., to aid in purification and/or identity determination, e.g., through immunostaining assays (including but not limited to ELISA or Western Blot).
  • DNA encoding AV ORF1 may be expressed alone or in combination with any number of helper proteins.
  • DNA encoding AV ORF1 is expressed in combination with AV ORF2 and/or ORF3 proteins.
  • ORF1 proteins harboring mutations to improve assembly efficiency may include, but are not limited to, ORF1 proteins that harbor mutations introduced into the N-terminal Arginine Arm (ARG arm) to alter the pI of the ARG arm permitting pH sensitive nucleic acid binding to trigger particle assembly (SEQ ID 3-5).
  • ORF1 proteins harboring mutations that improve stability may include mutations to an interprotomer contacting beta strands F and G of the canonical jellyroll beta-barrel to alter hydrophobic state of the protomer surface and improve thermodynamic favorability of capsid formation.
  • chimeric ORF1 proteins may include, but are not limited to, ORF1 proteins which have a portion or portions of their sequence replaced with comparable portions from another capsid protein, e.g., Beak and Feather Disease Virus (BFDV) capsid protein, or Hepatitis E capsid protein, e.g., ARG arm or F and G beta strands of Ring 9 ORF1 replaced with the comparable components from BFDV capsid protein.
  • chimeric ORF1 proteins may also include ORF1 proteins which have a portion or portions of their sequence replaced with comparable portions of another AV ORF1 protein (e.g., jellyroll fragments or the C-terminal portion of Ring 2 ORF1 replaced with comparable portions of Ring 9 ORF1).
  • the present disclosure describes a method of making an anellovector, the method comprising: (a) providing a mixture comprising: (i) a genetic element comprising RNA, and (ii) an ORF1 molecule; and (b) incubating the mixture under conditions suitable for enclosing the genetic element within a proteinaceous exterior comprising the ORF1 molecule, thereby making an anellovector; optionally wherein the mixture is not comprised in a cell.
  • the method further comprises, prior to the providing of (a), expressing the ORF1 molecule, e.g., in a host cell (e.g., an insect cell or a mammalian cell).
  • the expressing comprises incubating a host cell (e.g., an insect cell or a mammalian cell) comprising a nucleic acid molecule (e.g., a baculovirus expression vector) encoding the ORF1 molecule under conditions suitable for producing the ORF1 molecule.
  • a host cell e.g., an insect cell or a mammalian cell
  • a nucleic acid molecule e.g., a baculovirus expression vector
  • the method further comprises, prior to the providing of (a), purifying the ORF1 molecule expressed by the host cell.
  • the method is performed in a cell-free system.
  • the present disclosure describes a method of manufacturing an anellovector composition, comprising: (a) providing a plurality of anellovectors or compositions according to any of the preceding embodiments; (b) optionally evaluating the plurality for one or more of: a contaminant described herein, an optical density measurement (e.g., OD 260), particle number (e.g., by HPLC), infectivity (e.g., particle:infectious unit ratio, e.g., as determined by fluorescence and/or ELISA); and (c) formulating the plurality of anellovectors, e.g., as a pharmaceutical composition suitable for administration to a subject, e.g., if one or more of the parameters of (b) meet a specified threshold.
  • an optical density measurement e.g., OD 260
  • particle number e.g., by HPLC
  • infectivity e.g., particle:infectious unit ratio, e.g., as determined by fluorescence and
  • Harvested anellovectors can be purified and/or enriched, e.g., to produce an anellovector preparation.
  • the harvested anellovectors are isolated from other constituents or contaminants present in the harvest solution, e.g., using methods known in the art for purifying viral particles (e.g., purification by sedimentation, chromatography, and/or ultrafiltration).
  • the harvested anellovectors are purified by affinity purification (e.g., heparin affinity purification).
  • the harvested anellovectors are purified by size exclusion chromatography (e.g., using a Tris buffer mobile phase).
  • the harvested anellovectors are purified by anion exchange chromatography (e.g., Mustang Q membrane chromatography).
  • the harvested anellovectors are purified by mixed mode chromatography (e.g., using a mixed mode resin, e.g., a Cato700 resin).
  • the purification steps comprise removing one or more of serum, host cell DNA, host cell proteins, particles lacking the genetic element, and/or phenol red from the preparation.
  • the harvested anellovectors are enriched relative to other constituents or contaminants present in the harvest solution, e.g., using methods known in the art for enriching viral particles.
  • the resultant preparation or a pharmaceutical composition comprising the preparation will be stable over an acceptable period of time and temperature, and/or be compatible with the desired route of administration and/or any devices this route of administration will require, e.g., needles or syringes.
  • the disclosure provides compositions and methods of using and making an anellovector, anellovector preparations, and therapeutic compositions.
  • the anellovector comprises one or more nucleic acids or polypeptides comprising a sequence, structure, and/or function that is based on an Anellovirus (e.g., an Anellovirus as described herein), or fragments or portions thereof, or other substantially non-pathogenic virus, e.g., a symbiotic virus, commensal virus, native virus.
  • an Anellovirus-based anellovector comprises at least one element exogenous to that Anellovirus, e.g., an exogenous effector or a nucleic acid sequence encoding an exogenous effector disposed within a genetic element of the anellovector.
  • an Anellovirus-based anellovector comprises at least one element heterologous to another element from that Anellovirus, e.g., an effector-encoding nucleic acid sequence that is heterologous to another linked nucleic acid sequence, such as a promoter element.
  • an anellovector comprises a genetic element (e.g., circular DNA, e.g., single stranded DNA), which comprise at least one element that is heterologous relative to the remainder of the genetic element and/or the proteinaceous exterior (e.g., an exogenous element encoding an effector, e.g., as described herein).
  • An anellovector may be a delivery vehicle (e.g., a substantially non-pathogenic delivery vehicle) for a payload into a host, e.g., a human.
  • the anellovector is capable of replicating in a eukaryotic cell, e.g., a mammalian cell, e.g., a human cell.
  • the anellovector is substantially non-pathogenic and/or substantially non-integrating in the mammalian (e.g., human) cell.
  • the anellovector is substantially non-immunogenic in a mammal, e.g., a human.
  • the anellovector is replication-deficient.
  • the anellovector is replication-competent.
  • the anellovector comprises a curon, or a component thereof (e.g., a genetic element, e.g., comprising a sequence encoding an effector, and/or a proteinaceous exterior), e.g., as described in PCT Application No. PCT/US2018/037379, which is incorporated herein by reference in its entirety.
  • the anellovector comprises an anellovector, or a component thereof (e.g., a genetic element, e.g., comprising a sequence encoding an effector, and/or a proteinaceous exterior), e.g., as described in PCT Application No.
  • the invention includes an anellovector comprising (i) a genetic element comprising a promoter element, a sequence encoding an effector, (e.g., an endogenous effector or an exogenous effector, e.g., a payload), and a protein binding sequence (e.g., an exterior protein binding sequence, e.g., a packaging signal), wherein the genetic element is a single-stranded DNA, and has one or both of the following properties: is circular and/or integrates into the genome of a eukaryotic cell at a frequency of less than about 0.001%, 0.005%, 0.01%, 0.05%, 0.1%, 0.5%, 1%, 1.5%, or 2% of the genetic element that enters the cell; and (ii) a proteinaceous exterior; wherein the genetic element is enclosed within the proteinaceous exterior; and wherein the anellovector is capable of delivering the genetic element
  • the genetic element integrates at a frequency of less than about 0.001%, 0.005%, 0.01%, 0.05%, 0.1%, 0.5%, 1%, 1.5%, or 2% of the genetic element that enters a cell. In some embodiments, less than about 0.01%, 0.05%, 0.1%, 0.5%, 1%, 2%, 3%, 4%, or 5% of the genetic elements from a plurality of the anellovectors administered to a subject will integrate into the genome of one or more host cells in the subject.
  • the genetic elements of a population of anellovectors integrate into the genome of a host cell at a frequency less than that of a comparable population of AAV viruses, e.g., at about a 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, or more lower frequency than the comparable population of AAV viruses.
  • the invention includes an anellovector comprising: (i) a genetic element comprising a promoter element and a sequence encoding an effector (e.g., an endogenous effector or an exogenous effector, e.g., a payload), and a protein binding sequence (e.g., an exterior protein binding sequence), wherein the genetic element has at least 75% (e.g., at least 75, 76, 77, 78, 79, 80, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%) sequence identity to a wild-type Anellovirus sequence (e.g., a wild-type Torque Teno virus (TTV), Torque Teno mini virus (TTMV), or TTMDV sequence, e.g., a wild-type Anellovirus sequence as described herein); and (ii) a proteinaceous exterior; wherein the genetic element is enclosed within the proteinaceous exterior; and wherein the anellovector is
  • the invention includes an anellovector comprising: a) a genetic element comprising (i) a sequence encoding an exterior protein (e.g., a non- pathogenic exterior protein), (ii) an exterior protein binding sequence that binds the genetic element to the non-pathogenic exterior protein, and (iii) a sequence encoding an effector (e.g., an endogenous or exogenous effector); and b) a proteinaceous exterior that is associated with, e.g., envelops or encloses, the genetic element.
  • an exterior protein e.g., a non- pathogenic exterior protein
  • an exterior protein binding sequence that binds the genetic element to the non-pathogenic exterior protein
  • an effector e.g., an endogenous or exogenous effector
  • the anellovector includes sequences or expression products from (or having >70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% homology to) a non-enveloped, circular, single-stranded DNA virus.
  • Animal circular single-stranded DNA viruses generally refer to a subgroup of single strand DNA (ssDNA) viruses, which infect eukaryotic non-plant hosts, and have a circular genome.
  • ssDNA viruses are distinguishable from ssDNA viruses that infect prokaryotes (i.e. Microviridae and Inoviridae) and from ssDNA viruses that infect plants (i.e. Geminiviridae and Nanoviridae).
  • the anellovector modulates a host cellular function, e.g., transiently or long term.
  • the cellular function is stably altered, such as a modulation that persists for at least about 1 hr to about 30 days, or at least about 2 hrs, 6 hrs, 12 hrs, 18 hrs, 24 hrs, 2 days, 3, days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 22 days, 23 days, 24 days, 25 days, 26 days, 27 days, 28 days, 29 days, 30 days, 60 days, or longer or any time therebetween.
  • the cellular function is transiently altered, e.g., such as a modulation that persists for no more than about 30 mins to about 7 days, or no more than about 1 hr, 2 hrs, 3 hrs, 4 hrs, 5 hrs, 6 hrs, 7 hrs, 8 hrs, 9 hrs, 10 hrs, 11 hrs, 12 hrs, 13 hrs, 14 hrs, 15 hrs, 16 hrs, 17 hrs, 18 hrs, 19 hrs, 20 hrs, 21 hrs, 22 hrs, 24 hrs, 36 hrs, 48 hrs, 60 hrs, 72 hrs, 4 days, 5 days, 6 days, 7 days, or any time therebetween.
  • the genetic element comprises a promoter element.
  • the promoter element is selected from an RNA polymerase II-dependent promoter, an RNA polymerase III- dependent promoter, a PGK promoter, a CMV promoter, an EF-1 ⁇ promoter, an SV40 promoter, a CAGG promoter, or a UBC promoter, TTV viral promoters, Tissue specific, U6 (pollIII), minimal CMV promoter with upstream DNA binding sites for activator proteins (TetR-VP16, Gal4-VP16, dCas9-VP16, etc).
  • the promoter element comprises a TATA box.
  • the promoter element is endogenous to a wild-type Anellovirus, e.g., as described herein.
  • the genetic element comprises one or more of the following characteristics: single-stranded, circular, negative strand, and/or DNA.
  • the genetic element comprises an episome.
  • the portions of the genetic element excluding the effector have a combined size of about 2.5-5 kb (e.g., about 2.8-4kb, about 2.8-3.2kb, about 3.6-3.9kb, or about 2.8-2.9kb), less than about 5kb (e.g., less than about 2.9kb, 3.2 kb, 3.6kb, 3.9kb, or 4kb), or at least 100 nucleotides (e.g., at least 1kb).
  • an anellovector, or the genetic element comprised in the anellovector is introduced into a cell (e.g., a human cell).
  • the effector e.g., an RNA, e.g., an miRNA
  • the genetic element of an anellovector is expressed in a cell (e.g., a human cell), e.g., once the anellovector or the genetic element has been introduced into the cell.
  • introduction of the anellovector, or genetic element comprised therein, into a cell modulates (e.g., increases or decreases) the level of a target molecule (e.g., a target nucleic acid, e.g., RNA, or a target polypeptide) in the cell, e.g., by altering the expression level of the target molecule by the cell.
  • introduction of the anellovector, or genetic element comprised therein decreases level of interferon produced by the cell.
  • introduction of the anellovector, or genetic element comprised therein, into a cell modulates (e.g., increases or decreases) a function of the cell.
  • introduction of the anellovector, or genetic element comprised therein, into a cell modulates (e.g., increases or decreases) the viability of the cell.
  • introduction of the anellovector, or genetic element comprised therein, into a cell decreases viability of a cell (e.g., a cancer cell).
  • an anellovector e.g., a synthetic anellovector described herein induces an antibody prevalence of less than 70% (e.g., less than about 60%, 50%, 40%, 30%, 20%, or 10% antibody prevalence).
  • antibody prevalence is determined according to methods known in the art.
  • antibody prevalence is determined by detecting antibodies against an Anellovirus (e.g., as described herein), or an anellovector based thereon, in a biological sample, e.g., according to the anti- TTV antibody detection method described in Tsuda et al. (1999; J. Virol. Methods 77: 199-206; incorporated herein by reference) and/or the method for determining anti-TTV IgG seroprevalence described in Kakkola et al. (2008; Virology 382: 182-189; incorporated herein by reference).
  • Antibodies against an Anellovirus or an anellovector based thereon can also be detected by methods in the art for detecting anti-viral antibodies, e.g., methods of detecting anti-AAV antibodies, e.g., as described in Calcedo et al. (2013; Front. Immunol.4(341): 1-7; incorporated herein by reference).
  • a replication deficient, replication defective, or replication incompetent genetic element does not encode all of the necessary machinery or components required for replication of the genetic element.
  • a replication defective genetic element does not encode a replication factor.
  • a replication defective genetic element does not encode one or more ORFs (e.g., ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, and/or ORF2t/3, e.g., as described herein).
  • the machinery or components not encoded by the genetic element may be provided in trans (e.g., encoded in a nucleic acid comprised by the host cell, e.g., integrated into the genome of the host cell), e.g., such that the genetic element can undergo replication in the presence of the machinery or components provided in trans.
  • a packaging deficient, packaging defective, or packaging incompetent genetic element cannot be packaged into a proteinaceous exterior (e.g., wherein the proteinaceous exterior comprises a capsid or a portion thereof, e.g., comprising a polypeptide encoded by an ORF1 nucleic acid, e.g., as described herein).
  • a packaging deficient genetic element is packaged into a proteinaceous exterior at an efficiency less than 10% (e.g., less than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.01%, or 0.001%) compared to a wild-type Anellovirus (e.g., as described herein).
  • the packaging defective genetic element cannot be packaged into a proteinaceous exterior even in the presence of factors (e.g., ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, or ORF2t/3) that would permit packaging of the genetic element of a wild-type Anellovirus (e.g., as described herein).
  • a packaging deficient genetic element is packaged into a proteinaceous exterior at an efficiency less than 10% (e.g., less than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.01%, or 0.001%) compared to a wild-type Anellovirus (e.g., as described herein), even in the presence of factors (e.g., ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, or ORF2t/3) that would permit packaging of the genetic element of a wild-type Anellovirus (e.g., as described herein).
  • factors e.g., ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, or ORF2t/3
  • a packaging competent genetic element can be packaged into a proteinaceous exterior (e.g., wherein the proteinaceous exterior comprises a capsid or a portion thereof, e.g., comprising a polypeptide encoded by an ORF1 nucleic acid, e.g., as described herein).
  • a packaging competent genetic element is packaged into a proteinaceous exterior at an efficiency of at least 20% (e.g., at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100%, or higher) compared to a wild-type Anellovirus (e.g., as described herein).
  • the packaging competent genetic element can be packaged into a proteinaceous exterior in the presence of factors (e.g., ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, or ORF2t/3) that would permit packaging of the genetic element of a wild-type Anellovirus (e.g., as described herein).
  • factors e.g., ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, or ORF2t/3
  • a packaging competent genetic element is packaged into a proteinaceous exterior at an efficiency of at least 20% (e.g., at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100%, or higher) compared to a wild-type Anellovirus (e.g., as described herein) in the presence of factors (e.g., ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, or ORF2t/3) that would permit packaging of the genetic element of a wild-type Anellovirus (e.g., as described herein).
  • factors e.g., ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, or ORF2t/3
  • an anellovector e.g., as described herein, comprises sequences or expression products derived from an Anellovirus.
  • an anellovector includes one or more sequences or expression products that are exogenous relative to the Anellovirus.
  • an anellovector includes one or more sequences or expression products that are endogenous relative to the Anellovirus.
  • an anellovector includes one or more sequences or expression products that are heterologous relative to one or more other sequences or expression products in the anellovector.
  • Anelloviruses generally have single-stranded circular DNA genomes with negative polarity.
  • the genetic element comprises a nucleotide sequence encoding an amino acid sequence or a functional fragment thereof or a sequence having at least about 60%, 70% 80%, 85%, 90% 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to any one of the amino acid sequences described herein, e.g., an Anellovirus amino acid sequence.
  • an anellovector as described herein comprises one or more nucleic acid molecules (e.g., a genetic element as described herein) comprising a sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus sequence, e.g., as described herein, or a fragment thereof.
  • nucleic acid molecules e.g., a genetic element as described herein
  • an anellovector as described herein comprises one or more nucleic acid molecules (e.g., a genetic element as described herein) comprising a sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to one or more of a TATA box, cap site, initiator element, transcriptional start site, 5’ UTR conserved domain, ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, ORF2t/3, three open-reading frame region, poly(A) signal, GC-rich region, or any combination thereof, of an Anellovirus, e.g., as described herein.
  • nucleic acid molecules e.g., a genetic element as described herein
  • the nucleic acid molecule comprises a sequence encoding a capsid protein, e.g., an ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, ORF2t/3 sequence of any of the Anelloviruses described herein.
  • the nucleic acid molecule comprises a sequence encoding a capsid protein comprising an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus ORF1 protein (or a splice variant or functional fragment thereof) or a polypeptide encoded by an Anellovirus ORF1 nucleic acid.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1 nucleic acid sequence of Table A1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1/1 nucleotide sequence of Table A1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1/2 nucleotide sequence of Table A1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2 nucleotide sequence of Table A1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2/2 nucleotide sequence of Table A1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2/3 nucleotide sequence of Table A1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2t/3 nucleotide sequence of Table A1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus TATA box nucleotide sequence of Table A1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus initiator element nucleotide sequence of Table A1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus transcriptional start site nucleotide sequence of Table A1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus 5’ UTR conserved domain nucleotide sequence of Table A1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus three open-reading frame region nucleotide sequence of Table A1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus poly(A) signal nucleotide sequence of Table A1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus GC-rich nucleotide sequence of Table A1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1 nucleic acid sequence of Table B1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1/1 nucleotide sequence of Table B1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1/2 nucleotide sequence of Table B1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2 nucleotide sequence of Table B1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2/2 nucleotide sequence of Table B1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2/3 nucleotide sequence of Table B1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus TATA box nucleotide sequence of Table B1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus initiator element nucleotide sequence of Table B1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus transcriptional start site nucleotide sequence of Table B1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus 5’ UTR conserved domain nucleotide sequence of Table B1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus three open-reading frame region nucleotide sequence of Table B1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus poly(A) signal nucleotide sequence of Table B1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus GC-rich nucleotide sequence of Table B1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1 nucleic acid sequence of Table C1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1/1 nucleotide sequence of Table C1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1/2 nucleotide sequence of Table C1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2 nucleotide sequence of Table C1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2/2 nucleotide sequence of Table C1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2/3 nucleotide sequence of Table C1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus TAIP nucleotide sequence of Table C1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus TATA box nucleotide sequence of Table C1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus initiator element nucleotide sequence of Table C1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus transcriptional start site nucleotide sequence of Table C1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus 5’ UTR conserved domain nucleotide sequence of Table C1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus three open-reading frame region nucleotide sequence of Table C1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus poly(A) signal nucleotide sequence of Table C1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus GC-rich nucleotide sequence of Table C1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1 nucleic acid sequence of Table D1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1/1 nucleotide sequence of Table D1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1/2 nucleotide sequence of Table D1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2 nucleotide sequence of Table D1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2/2 nucleotide sequence of Table D1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2/3 nucleotide sequence of Table D1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus TAIP nucleotide sequence of Table D1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus TATA box nucleotide sequence of Table D1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus initiator element nucleotide sequence of Table D1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus transcriptional start site nucleotide sequence of Table D1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus 5’ UTR conserved domain nucleotide sequence of Table D1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus three open-reading frame region nucleotide sequence of Table D1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus poly(A) signal nucleotide sequence of Table D1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus GC-rich nucleotide sequence of Table D1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1 nucleic acid sequence of Table E1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1/1 nucleotide sequence of Table E1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1/2 nucleotide sequence of Table E1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2 nucleotide sequence of Table E1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2/2 nucleotide sequence of Table E1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF2/3 nucleotide sequence of Table E1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus TAIP nucleotide sequence of Table E1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus TATA box nucleotide sequence of Table E1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus initiator element nucleotide sequence of Table E1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus transcriptional start site nucleotide sequence of Table E1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus 5’ UTR conserved domain nucleotide sequence of Table E1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus three open-reading frame region nucleotide sequence of Table E1. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus poly(A) signal nucleotide sequence of Table E1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus GC-rich nucleotide sequence of Table E1.
  • the genetic element comprises a nucleotide sequence encoding an amino acid sequence or a functional fragment thereof or a sequence having at least about 60%, 70% 80%, 85%, 90% 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to any one of the amino acid sequences described herein, e.g., an Anellovirus amino acid sequence.
  • an anellovector as described herein comprises one or more nucleic acid molecules (e.g., a genetic element as described herein) comprising a sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus sequence, e.g., as described herein, or a fragment thereof.
  • the anellovector comprises a nucleic acid sequence selected from a sequence as shown in any of Tables A1-M2, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto.
  • the anellovector comprises a polypeptide comprising a sequence as shown in any of Tables Tables A2-M2, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto.
  • an anellovector as described herein comprises one or more nucleic acid molecules (e.g., a genetic element as described herein) comprising a sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to one or more of a TATA box, cap site, initiator element, transcriptional start site, 5’ UTR conserved domain, ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, ORF2t/3, three open-reading frame region, poly(A) signal, GC-rich region, or any combination thereof, of any of the Anelloviruses described herein (e.g., an Anellovirus sequence as annotated, or as encoded by a sequence listed, in any of Tables A-M).
  • nucleic acid molecules e.g., a genetic element as described herein
  • the nucleic acid molecule comprises a sequence encoding a capsid protein, e.g., an ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, ORF2t/3 sequence of any of the Anelloviruses described herein (e.g., an Anellovirus sequence as annotated, or as encoded by a sequence listed, in any of Tables A-M).
  • a capsid protein e.g., an ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, ORF2t/3 sequence of any of the Anelloviruses described herein (e.g., an Anellovirus sequence as annotated, or as encoded by a sequence listed, in any of Tables A-M).
  • the nucleic acid molecule comprises a sequence encoding a capsid protein comprising an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus ORF1 or ORF2 protein (e.g., an ORF1 or ORF2 amino acid sequence as shown in any of Tables A2-M2, or an ORF1 or ORF2 amino acid sequence encoded by a nucleic acid sequence as shown in any of Tables A1-M1).
  • an Anellovirus ORF1 or ORF2 protein e.g., an ORF1 or ORF2 amino acid sequence as shown in any of Tables A2-M2, or an ORF1 or ORF2 amino acid sequence encoded by a nucleic acid sequence as shown in any of Tables A1-M1.
  • the nucleic acid molecule comprises a sequence encoding a capsid protein comprising an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus ORF1 protein (e.g., an ORF1 amino acid sequence as shown in any of Tables A2-M2, or an ORF1 amino acid sequence encoded by a nucleic acid sequence as shown in any of Tables A1-M1).
  • an anellovector as described herein is a chimeric anellovector.
  • a chimeric anellovector further comprises one or more elements, polypeptides, or nucleic acids from a virus other than an Anellovirus.
  • the chimeric anellovector comprises a plurality of polypeptides (e.g., Anellovirus ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, and/or ORF2t/3) comprising sequences from a plurality of different Anelloviruses (e.g., as described herein).
  • a chimeric anellovector may comprise an ORF1 molecule from one Anellovirus (e.g., a Ring1 ORF1 molecule, or an ORF1 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto) and an ORF2 molecule from a different Anellovirus (e.g., a Ring2 ORF2 molecule, or an ORF2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto).
  • Anellovirus e.g., a Ring1 ORF1 molecule, or an ORF1 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto
  • a chimeric anellovector may comprise a first ORF1 molecule from one Anellovirus (e.g., a Ring1 ORF1 molecule, or an ORF1 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto) and a second ORF1 molecule from a different Anellovirus (e.g., a Ring2 ORF1 molecule, or an ORF1 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto).
  • Anellovirus e.g., a Ring1 ORF1 molecule, or an ORF1 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
  • the anellovector comprises a chimeric polypeptide (e.g., Anellovirus ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, and/or ORF2t/3), e.g., comprising at least one portion from an Anellovirus (e.g., as described herein) and at least one portion from a different virus (e.g., as described herein).
  • a chimeric polypeptide e.g., Anellovirus ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, and/or ORF2t/3
  • an Anellovirus e.g., as described herein
  • a different virus e.g., as described herein
  • the anellovector comprises a chimeric polypeptide (e.g., Anellovirus ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, and/or ORF2t/3), e.g., comprising at least one portion from one Anellovirus (e.g., as described herein) and at least one portion from a different Anellovirus (e.g., as described herein).
  • a chimeric polypeptide e.g., Anellovirus ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, and/or ORF2t/3
  • the anellovector comprises a chimeric ORF1 molecule comprising at least one portion of an ORF1 molecule from one Anellovirus (e.g., as described herein), or an ORF1 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto, and at least one portion of an ORF1 molecule from a different Anellovirus (e.g., as described herein), or an ORF1 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
  • the chimeric ORF1 molecule comprises an ORF1 jelly-roll domain from one Anellovirus, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto, and an ORF1 amino acid subsequence (e.g., as described herein) from a different Anellovirus, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the chimeric ORF1 molecule comprises an ORF1 arginine-rich region from one Anellovirus, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto, and an ORF1 amino acid subsequence (e.g., as described herein) from a different Anellovirus, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the chimeric ORF1 molecule comprises an ORF1 hypervariable domain from one Anellovirus, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto, and an ORF1 amino acid subsequence (e.g., as described herein) from a different Anellovirus, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the chimeric ORF1 molecule comprises an ORF1 N22 domain from one Anellovirus, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto, and an ORF1 amino acid subsequence (e.g., as described herein) from a different Anellovirus, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the chimeric ORF1 molecule comprises an ORF1 C-terminal domain from one Anellovirus, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto, and an ORF1 amino acid subsequence (e.g., as described herein) from a different Anellovirus, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the anellovector comprises a chimeric ORF1/1 molecule comprising at least one portion of an ORF1/1 molecule from one Anellovirus (e.g., as described herein), or an ORF1/1 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto, and at least one portion of an ORF1/1 molecule from a different Anellovirus (e.g., as described herein), or an ORF1/1 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
  • the anellovector comprises a chimeric ORF1/2 molecule comprising at least one portion of an ORF1/2 molecule from one Anellovirus (e.g., as described herein), or an ORF1/2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto, and at least one portion of an ORF1/2 molecule from a different Anellovirus (e.g., as described herein), or an ORF1/2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
  • the anellovector comprises a chimeric ORF2 molecule comprising at least one portion of an ORF2 molecule from one Anellovirus (e.g., as described herein), or an ORF2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto, and at least one portion of an ORF2 molecule from a different Anellovirus (e.g., as described herein), or an ORF2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
  • the anellovector comprises a chimeric ORF2/2 molecule comprising at least one portion of an ORF2/2 molecule from one Anellovirus (e.g., as described herein), or an ORF2/2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto, and at least one portion of an ORF2/2 molecule from a different Anellovirus (e.g., as described herein), or an ORF2/2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
  • the anellovector comprises a chimeric ORF2/3 molecule comprising at least one portion of an ORF2/3 molecule from one Anellovirus (e.g., as described herein), or an ORF2/3 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto, and at least one portion of an ORF2/3 molecule from a different Anellovirus (e.g., as described herein), or an ORF2/3 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
  • the anellovector comprises a chimeric ORF2T/3 molecule comprising at least one portion of an ORF2T/3 molecule from one Anellovirus (e.g., as described herein), or an ORF2T/3 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto, and at least one portion of an ORF2T/3 molecule from a different Anellovirus (e.g., as described herein), or an ORF2T/3 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity thereto.
  • exemplary Anellovirus genomes for which sequences or subsequences comprised therein can be utilized in the compositions and methods described herein are described, for example, in PCT Application Nos. PCT/US2018/037379 and PCT/US19/65995 (incorporated herein by reference in their entirety).
  • the exemplary Anellovirus sequences comprise a nucleic acid sequence as listed in any of Tables A1, A3, A5, A7, A9, A11, B1-B5, 1, 3, 5, 7, 9, 11, 13, 15, or 17 of PCT/US19/65995, incorporated herein by reference.
  • the exemplary Anellovirus sequences comprise an amino acid sequence as listed in any of Tables A2, A4, A6, A8, A10, A12, C1-C5, 2, 4, 6, 8, 10, 12, 14, 16, or 18 of PCT/US19/65995, incorporated herein by reference.
  • the exemplary Anellovirus sequences comprise an ORF1 molecule sequence, or a nucleic acid sequence encoding same, e.g., as listed in any of Tables 21, 23, 25, 27, 29, 31, 33, 35, D2, D4, D6, D8, D10, or 37A-37C of PCT/US19/65995, incorporated herein by reference. Table A1.
  • Anellovirus nucleic acid sequence (Alphatorquevirus, Clade 3) Name Ring1 AAGCAAAACTTATAATAAAACTGTGGCAACCTGCAGTAATTAAAAGATGC GGTCCCCTTCCAACAGCAGTTGCAGCAGCAGTACCAAGAGCAGCTCAAGC Annotations: Putative Domain Base range TATA Box 83 – 88 Cap Site 104 – 111 Transcriptional Start Site 111 5’ UTR conserveed Domain 170 – 240 ORF2 336 – 719 ORF2/2 336 – 715 ; 2363 – 2789 ORF2/3 336 – 715 ; 2565 – 3015 ORF2t/3 336 – 388 ; 2565 – 3015 ORF1 599 – 2830 ORF1/1 599 – 715 ; 2363 – 2830 ORF1/2 599 – 715 ; 2565 – 2789 Three open-reading frame region 2551 – 2786 Poly(A) Signal 3011 – 3016 GC-
  • Anellovirus amino acid sequences (Alphatorquevirus, Clade 3) Ring1 (Alphatorquevirus Clade 3) GYIPYSYKFGAGQMPDGSNYIPFQFRAKWYPTVLHQQQVMEDISRSGPFAPKVEKP Table B1.
  • Anellovirus nucleic acid sequence (Betatorquevirus) Name Ring2 CGTCCTAGATGGTATGGACGAGGTTGGATTAGACGCCCTTTTCGCAGAAG ATACTCCTTCGACTATAGACACGGGAACTACACAACAACAGCTTTGTCAC Annotations: Putative Domain Base range TATA Box 237– 243 Cap Site 260 – 267 Transcriptional Start Site 267 5’ UTR conserveed Domain 323 – 393 ORF2 424 – 723 ORF2/2 424 – 719 ; 2274 – 2589 ORF2/3 424 – 719 ; 2449 – 2812 ORF1 612 – 2612 ORF1/1 612 – 719 ; 2274 – 2612 ORF1/2 612 – 719 ; 2449 – 2589 Three open-reading frame region 2441 – 2586 Poly(A) Signal 2808 – 2813 GC-rich region 2868 – 2929 Table B2.
  • Anellovirus amino acid sequences (Betatorquevirus) ORF2/2 MSDCFKPTCYNNKTKQTHWINNLHLTHDLICFCPTPTRHLLLALAEQQETIEVSKQE Table C1.
  • Exemplary Anellovirus nucleic acid sequence (Gammatorquevirus) Name Ring4 Genus/Clade Gammatorquevirus Accession Number Full Sequence: 3176 bp GGCTTTATTAAAGAAAGATCTCTTAAAAGAATGTCAACTTACTTCTCAAC TCATACAGATCAGCAAGCAACTTCAGAGGAAGACATTCCCAAAAAGAAAA Annotations: Putative Domain Base range TATA Box 87– 93 Cap Site 110 – 117 Transcriptional Start Site 117 5’ UTR conserveed Domain 185 – 254 ORF2 286 – 660 ORF2/2 286 – 656 ; 1998 – 2442 ORF2/3 286 – 656 ; 2209 – 2641 TAIP 385 - 484 ORF1 501 – 24
  • Exemplary Anellovirus amino acid sequences (Gammatorquevirus) Ring4 (Gammatorquevirus) TETQEDLQQLIKQQQEQQLLLKRNILQLIHKLKENQQMLQLHTGMLP (SEQ ID NO: Table D1.
  • Anellovirus nucleic acid sequence (Betatorquevirus) Name Ring9 Genus/Clade Betatorquevirus Accession Number MH649263.1 Full Sequence: 2845 bp TTTAAACCCCCATCACAATTAGACAGCAGCGACTTTGAACACATGACAGA ATTAGCAGAACCAATGTTTATACAAGTTAGATACAACCCAGAAAGAGACA Annotations: Putative Domain Base range TATA Box 142 – 148 Initiation Element 162 – 177 Transcriptional Start Site 172 5’ UTR conserveed Domain 226 – 296 ORF2 328 – 651 ORF2/2 328 – 647; 2121 – 2457 ORF2/3 328 – 647; 2296 – 2680 ORF1 510 – 2477 ORF1/1 510 – 647; 2121 – 2477 ORF1/2 510 – 647; 2296 – 2457 Three open-reading frame region 2296 – 2454 GC-rich region 2734 – 2845 Table D2.
  • Exemplary Anellovirus amino acid sequences (Betatorquevirus) Ring9 (Betatorquevirus) ORF1/2 MPPYWRQKYYRRRYRPFSWRTRRIIQRRKRWRYRKPRKTYWRRKLRVPNT Table E1.
  • Exemplary Anellovirus nucleic acid sequence (Betatorquevirus) Name Ring10 Genus/Clade Betatorquevirus Accession Number JX134044.1 Full Sequence: 2912 bp ACCTACCACAATGGTTACTATTATTTGGCTACCCAGACTACATAAAAAGA ACACAAAACTTTGCATTAGTAGACACAAATTACATACTAGTAGACCACTG Annotation s: Putative Domain Base range TATA Box 152 – 158 Initiation Element 172 – 187 Transcriptional Start Site 182 5’ UTR conserveed Domain 239 – 309 ORF2 343 – 633 ORF2/2 343 – 629; 2196 – 2505 ORF2/3 343 – 629; 2371 – 2734 ORF
  • an anellovector comprises a nucleic acid comprising a sequence listed in PCT Application No. PCT/US2018/037379, incorporated herein by reference in its entirety.
  • an anellovector comprises a polypeptide comprising a sequence listed in PCT Application No. PCT/US2018/037379, incorporated herein by reference in its entirety.
  • an anellovector comprises a nucleic acid comprising a sequence listed in PCT Application No. PCT/US19/65995, incorporated herein by reference in its entirety. In some embodiments, an anellovector comprises a polypeptide comprising a sequence listed in PCT Application No. PCT/US19/65995, incorporated herein by reference in its entirety.
  • ORF1 Molecules In some embodiments, the anellovector comprises an ORF1 molecule and/or a nucleic acid encoding an ORF1 molecule. Generally, an ORF1 molecule comprises a polypeptide having the structural features and/or activity of an Anellovirus ORF1 protein (e.g., an Anellovirus ORF1 protein as described herein).
  • the ORF1 molecule comprises a truncation relative to an Anellovirus ORF1 protein (e.g., an Anellovirus ORF1 protein as described herein).
  • An ORF1 molecule may be capable of binding to other ORF1 molecules, e.g., to form a proteinaceous exterior (e.g., as described herein), e.g., a capsid.
  • the proteinaceous exterior may enclose a nucleic acid molecule (e.g., a genetic element as described herein).
  • a plurality of ORF1 molecules may form a multimer, e.g., to form a proteinaceous exterior.
  • the multimer may be a homomultimer.
  • an ORF1 molecule may, in some embodiments, comprise one or more of: a first region comprising an arginine rich region, e.g., a region having at least 60% basic residues (e.g., at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% basic residues; e.g., between 60%-90%, 60%-80%, 70%-90%, or 70-80% basic residues), and a second region comprising jelly-roll domain, e.g., at least six beta strands (e.g., 4, 5, 6, 7, 8, 9, 10, 11, or 12 beta strands).
  • a first region comprising an arginine rich region, e.g., a region having at least 60% basic residues (e.g., at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% basic residues; e.g., between 60%-90%, 60%-80%, 70%-90%, or 70-80% basic residues)
  • an ORF1 molecule as described herein comprises one or more lysine-to- histidine mutations relative to a wild-type ORF1 protein sequence (e.g., as described herein).
  • the ORF1 molecuel comprises one or more lysine-to-histidine mutations in the arginine- rich region and/or the first beta strand.
  • arginine-rich region has at least 70% (e.g., at least about 70, 80, 90, 95, 96, 97, 98, 99, or 100%) sequence identity to an arginine-rich region sequence described herein or a sequence of at least about 40 amino acids comprising at least 60%, 70%, or 80% basic residues (e.g., arginine, lysine, or a combination thereof).
  • 70% e.g., at least about 70, 80, 90, 95, 96, 97, 98, 99, or 100% sequence identity to an arginine-rich region sequence described herein or a sequence of at least about 40 amino acids comprising at least 60%, 70%, or 80% basic residues (e.g., arginine, lysine, or a combination thereof).
  • a jelly-roll domain or region comprises (e.g., consists of) a polypeptide (e.g., a domain or region comprised in a larger polypeptide) comprising one or more (e.g., 1, 2, or 3) of the following characteristics: (i) at least 30% (e.g., at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, or more) of the amino acids of the jelly-roll domain are part of one or more ⁇ -sheets; (ii) the secondary structure of the jelly-roll domain comprises at least four (e.g., at least 4, 5, 6, 7, 8, 9, 10, 11, or 12) ⁇ -strands; and/or (iii) the tertiary structure of the jelly-roll domain comprises at least two (e.g., at least 2, 3, or 4) ⁇ -sheets; and/or (iv) the jelly-roll domain comprises a ratio of ⁇ -sheets to ⁇ -helices of at least
  • a jelly-roll domain comprises two ⁇ -sheets.
  • one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the ⁇ -sheets comprises about eight (e.g., 4, 5, 6, 7, 8, 9, 10, 11, or 12) ⁇ -strands.
  • one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the ⁇ -sheets comprises eight ⁇ -strands.
  • one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the ⁇ -sheets comprises seven ⁇ -strands.
  • one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the ⁇ -sheets comprises six ⁇ -strands. In certain embodiments, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the ⁇ -sheets comprises five ⁇ -strands. In certain embodiments, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the ⁇ -sheets comprises four ⁇ - strands. In some embodiments, the jelly-roll domain comprises a first ⁇ -sheet in antiparallel orientation to a second ⁇ -sheet. In certain embodiments, the first ⁇ -sheet comprises about four (e.g., 3, 4, 5, or 6) ⁇ - strands.
  • the second ⁇ -sheet comprises about four (e.g., 3, 4, 5, or 6) ⁇ -strands.
  • the first and second ⁇ -sheet comprise, in total, about eight (e.g., 6, 7, 8, 9, 10, 11, or 12) ⁇ -strands.
  • a jelly-roll domain is a component of a capsid protein (e.g., an ORF1 molecule as described herein).
  • a jelly-roll domain has self-assembly activity.
  • a polypeptide comprising a jelly-roll domain binds to another copy of the polypeptide comprising the jelly-roll domain.
  • a jelly-roll domain of a first polypeptide binds to a jelly-roll domain of a second copy of the polypeptide.
  • N22 Domain An ORF1 molecule may also include a third region comprising the structure or activity of an Anellovirus N22 domain (e.g., as described herein, e.g., an N22 domain from an Anellovirus ORF1 protein as described herein), and/or a fourth region comprising the structure or activity of an Anellovirus C-terminal domain (CTD) (e.g., as described herein, e.g., a CTD from an Anellovirus ORF1 protein as described herein).
  • CTD Anellovirus C-terminal domain
  • the ORF1 molecule comprises, in N-terminal to C-terminal order, the first, second, third, and fourth regions.
  • Hypervariable Region The ORF1 molecule may, in some embodiments, further comprise a hypervariable region (HVR), e.g., an HVR from an Anellovirus ORF1 protein, e.g., as described herein. In some embodiments, the HVR is positioned between the second region and the third region.
  • the HVR comprises comprises at least about 55 (e.g., at least about 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, or 65) amino acids (e.g., about 45-160, 50-160, 55-160, 60-160, 45-150, 50-150, 55-150, 60-150, 45-140, 50-140, 55-140, or 60-140 amino acids).
  • amino acids e.g., about 45-160, 50-160, 55-160, 60-160, 45-150, 50-150, 55-150, 60-150, 45-140, 50-140, 55-140, or 60-140 amino acids.
  • a polypeptide e.g., an ORF1 molecule
  • a polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to one or more Anellovirus ORF1 subsequences, e.g., as described in any of Tables N-Z).
  • an anellovector described herein comprises an ORF1 molecule comprising an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to one or more Anellovirus ORF1 subsequences, e.g., as described in any of Tables N-Z.
  • an anellovector described herein comprises a nucleic acid molecule (e.g., a genetic element) encoding an ORF1 molecule comprising an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to one or more Anellovirus ORF1 subsequences, e.g., as described in any of Tables N-Z.
  • the one or more Anellovirus ORF1 subsequences comprises one or more of an arginine (Arg)-rich domain, a jelly-roll domain, a hypervariable region (HVR), an N22 domain, or a C-terminal domain (CTD) (e.g., as listed in any of Tables N-Z), or sequences having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto.
  • Arg arginine
  • HVR hypervariable region
  • N22 domain e.g., N22 domain
  • CTD C-terminal domain
  • the ORF1 molecule comprises a plurality of subsequences from different Anelloviruses (e.g., any combination of ORF1 subsequences selected from the Alphatorquevirus Clade 1-7 subsequences listed in Tables N-Z).
  • the ORF1 molecule comprises one or more of an Arg-rich domain, a jelly-roll domain, an N22 domain, and a CTD from one Anellovirus, and an HVR from another.
  • the ORF1 molecule comprises one or more of a jelly-roll domain, an HVR, an N22 domain, and a CTD from one Anellovirus, and an Arg-rich domain from another.
  • the ORF1 molecule comprises one or more of an Arg-rich domain, an HVR, an N22 domain, and a CTD from one Anellovirus, and a jelly-roll domain from another. In embodiments, the ORF1 molecule comprises one or more of an Arg-rich domain, a jelly-roll domain, an HVR, and a CTD from one Anellovirus, and an N22 domain from another. In embodiments, the ORF1 molecule comprises one or more of an Arg-rich domain, a jelly-roll domain, an HVR, and an N22 domain from one Anellovirus, and a CTD from another.
  • Anelloviruses for which the ORF1 molecules, or splice variants or functional fragments thereof, can be utilized in the compositions and methods described herein (e.g., to form the proteinaceous exterior of an anellovector, e.g., by enclosing a genetic element) are described, for example, in PCT Application Nos. PCT/US2018/037379 and PCT/US19/65995 (incorporated herein by reference in their entirety). Table N.
  • Anellovirus ORF1 amino acid subsequence (Alphatorquevirus, Clade 3) Name Ring1 Genus/Clade Alphatorquevirus, Clade 3 Accession Number AJ620231.1 Protein Accession Number CAF05750.1 Full Sequence: 743 AA ATNFTSHINDRIMKGPFGGGHSTMRFSLYILFEEHLRHMNFWTRSNDNLE Annotations: Putative Domain AA range Arg-Rich Region 1 – 68 Jelly-roll domain 69 - 280 Hypervariable Region 281 - 413 N22 414 – 579 C-terminal Domain 580 - 743 Table O.
  • Exemplary Anellovirus ORF1 amino acid subsequence (Alphatorquevirus, Clade 3) Hypervariable NTFNNDNSDSKLKEFLNKAFPTTGTKGTSLNALNTFRTEGCISHPQLKKPNPQI Table P.
  • Exemplary Anellovirus ORF1 amino acid subsequence (Betatorquevirus) Name Ring2 Genus/Clade Betatorquevirus Accession Number JX134045.1 Protein Accession Number AGG91484.1 Full Sequence: 666 AA 1 PAHQIQYPIPRNEHETTSLQSPGEAPESILYSFDYRHGNYTTTALSRISQ Annotations: Putative Domain AA range Arg-Rich Region 1 – 38 Jelly-roll domain 39 - 246 Hypervariable Region 247 - 374 N22 375 – 537 C-terminal Domain 538 – 666 Table Q.
  • Exemplary Anellovirus ORF1 amino acid subsequence (Betatorquevirus) Ri 2 ORF1 (B t t i ) Table R.
  • Exemplary Anellovirus ORF1 amino acid subsequence (Gammatorquevirus) Name Ring4 Genus/Clade Gammatorquevirus Accession Number Protein Accession Number Full Sequence: 662 AA 1 10 20 30 40 50 Annotations: Putative Domain AA range Arg-Rich Region 1 – 58 Jelly-roll domain 59 - 260 Hypervariable Region 261 - 339 N22 340 – 499 C-terminal Domain 500 – 662 Table S.
  • the first region can bind to a nucleic acid molecule (e.g., DNA).
  • the basic residues are selected from arginine, histidine, or lysine, or a combination thereof.
  • the first region comprises at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% arginine residues (e.g., between 60%-90%, 60%-80%, 70%-90%, or 70-80% arginine residues).
  • the first region comprises about 30-120 amino acids (e.g., about 40-120, 40-100, 40- 90, 40-80, 40-70, 50-100, 50-90, 50-80, 50-70, 60-100, 60-90, or 60-80 amino acids).
  • the first region comprises the structure or activity of a viral ORF1 arginine-rich region (e.g., an arginine-rich region from an Anellovirus ORF1 protein, e.g., as described herein).
  • the first region comprises a nuclear localization sigal.
  • the second region comprises a jelly-roll domain, e.g., the structure or activity of a viral ORF1 jelly-roll domain (e.g., a jelly-roll domain from an Anellovirus ORF1 protein, e.g., as described herein).
  • the second region is capable of binding to the second region of another ORF1 molecule, e.g., to form a proteinaceous exterior (e.g., capsid) or a portion thereof.
  • the fourth region is exposed on the surface of a proteinaceous exterior (e.g., a proteinaceous exterior comprising a multimer of ORF1 molecules, e.g., as described herein).
  • the first region, second region, third region, fourth region, and/or HVR each comprise fewer than four (e.g., 0, 1, 2, or 3) beta sheets.
  • one or more of the first region, second region, third region, fourth region, and/or HVR may be replaced by a heterologous amino acid sequence (e.g., the corresponding region from a heterologous ORF1 molecule).
  • the heterologous amino acid sequence has a desired functionality, e.g., as described herein.
  • the ORF1 molecule comprises a plurality of conserved motifs (e.g., motifs comprising about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, or more amino acids) (e.g., as shown in Figure 34 of PCT/US19/65995).
  • conserved motifs e.g., motifs comprising about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, or more amino acids
  • the conserved motifs may show 60, 70, 80, 85, 90, 95, or 100% sequence identity to an ORF1 protein of one or more wild-type Anellovirus clades (e.g., Alphatorquevirus, clade 1; Alphatorquevirus, clade 2; Alphatorquevirus, clade 3; Alphatorquevirus, clade 4; Alphatorquevirus, clade 5; Alphatorquevirus, clade 6; Alphatorquevirus, clade 7; Betatorquevirus; and/or Gammatorquevirus).
  • Anellovirus clades e.g., Alphatorquevirus, clade 1; Alphatorquevirus, clade 2; Alphatorquevirus, clade 3; Alphatorquevirus, clade 4; Alphatorquevirus, clade 5; Alphatorquevirus, clade 6; Alphatorquevirus, clade 7; Betatorquevirus; and/or Gammatorquevirus.
  • the conserved motifs each have a length between 1-1000 (e.g., between 5-10, 5-15, 5-20, 10-15, 10-20, 15-20, 5-50, 5-100, 10-50, 10-100, 10-1000, 50-100, 50-1000, or 100-1000) amino acids.
  • the conserved motifs consist of about 2-4% (e.g., about 1-8%, 1-6%, 1-5%, 1-4%, 2-8%, 2- 6%, 2-5%, or 2-4%) of the sequence of the ORF1 molecule, and each show 100% sequence identity to the corresponding motifs in an ORF1 protein of the wild-type Anellovirus clade.
  • the conserved motifs consist of about 5-10% (e.g., about 1-20%, 1-10%, 5-20%, or 5-10%) of the sequence of the ORF1 molecule, and each show 80% sequence identity to the corresponding motifs in an ORF1 protein of the wild-type Anellovirus clade.
  • the conserved motifs consist of about 10-50% (e.g., about 10-20%, 10-30%, 10-40%, 10-50%, 20-40%, 20-50%, or 30-50%) of the sequence of the ORF1 molecule, and each show 60% sequence identity to the corresponding motifs in an ORF1 protein of the wild-type Anellovirus clade.
  • the conserved motifs comprise one or more amino acid sequences as listed in Table 19.
  • an ORF1 molecule or a nucleic acid molecule encoding same comprises at least one difference (e.g., a mutation, chemical modification, or epigenetic alteration) relative to a wild- type ORF1 protein, e.g., as described herein.
  • conserveed ORF1 Motif in N22 Domain a polypeptide (e.g., an ORF1 molecule) described herein comprises the amino acid sequence YNPX 2 DXGX 2 N (SEQ ID NO: 829), wherein X n is a contiguous sequence of any n amino acids.
  • X 2 indicates a contiguous sequence of any two amino acids.
  • the YNPX 2 DXGX 2 N (SEQ ID NO: 829) is comprised within the N22 domain of an ORF1 molecule, e.g., as described herein.
  • a genetic element described herein comprises a nucleic acid sequence (e.g., a nucleic acid sequence encoding an ORF1 molecule, e.g., as described herein) encoding the amino acid sequence YNPX 2 DXGX 2 N (SEQ ID NO: 829), wherein X n is a contiguous sequence of any n amino acids.
  • a polypeptide (e.g., an ORF1 molecule) comprises a conserved secondary structure, e.g., flanking and/or comprising a portion of the YNPX 2 DXGX 2 N (SEQ ID NO: 829) motif, e.g., in an N22 domain.
  • the conserved secondary structure comprises a first beta strand and/or a second beta strand.
  • the first beta strand is about 5-6 (e.g., 3, 4, 5, 6, 7, or 8) amino acids in length.
  • the first beta strand comprises the tyrosine (Y) residue at the N-terminal end of the YNPX 2 DXGX 2 N (SEQ ID NO: 829) motif.
  • the YNPX 2 DXGX 2 N (SEQ ID NO: 829) motif comprises a random coil (e.g., about 8-9 amino acids of random coil).
  • the second beta strand is about 7-8 (e.g., 5, 6, 7, 8, 9, or 10) amino acids in length.
  • the second beta strand comprises the asparagine (N) residue at the C-terminal end of the YNPX 2 DXGX 2 N (SEQ ID NO: 829) motif.
  • an ORF1 molecule comprises a region comprising one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all) of the secondary structural elements (e.g., beta strands) shown in Figure 48 of PCT/US19/65995.
  • an ORF1 molecule comprises a region comprising one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all) of the secondary structural elements (e.g., beta strands) shown in Figure 48 of PCT/US19/65995, flanking a YNPX 2 DXGX 2 N (SEQ ID NO: 829) motif (e.g., as described herein).
  • a polypeptide (e.g., an ORF1 molecule) described herein comprises one or more secondary structural elements comprised by an Anellovirus ORF1 protein (e.g., as described herein).
  • an ORF1 molecule comprises one or more secondary structural elements comprised by the jelly-roll domain of an Anellovius ORF1 protein (e.g., as described herein).
  • an ORF1 jelly-roll domain comprises a secondary structure comprising, in order in the N-terminal to C- terminal direction, a first beta strand, a second beta strand, a first alpha helix, a third beta strand, a fourth beta strand, a fifth beta strand, a second alpha helix, a sixth beta strand, a seventh beta strand, an eighth beta strand, and a ninth beta strand.
  • an ORF1 molecule comprises a secondary structure comprising, in order in the N-terminal to C-terminal direction, a first beta strand, a second beta strand, a first alpha helix, a third beta strand, a fourth beta strand, a fifth beta strand, a second alpha helix, a sixth beta strand, a seventh beta strand, an eighth beta strand, and/or a ninth beta strand.
  • a pair of the conserved secondary structural elements are separated by an interstitial amino acid sequence, e.g., comprising a random coil sequence, a beta strand, or an alpha helix, or a combination thereof.
  • Interstitial amino acid sequences between the conserved secondary structural elements may comprise, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or more amino acids.
  • an ORF1 molecule may further comprise one or more additional beta strands and/or alpha helices (e.g., in the jelly-roll domain).
  • consecutive beta strands or consecutive alpha helices may be combined.
  • the first beta strand and the second beta strand are comprised in a larger beta strand.
  • the third beta strand and the fourth beta strand are comprised in a larger beta strand.
  • the fourth beta strand and the fifth beta strand are comprised in a larger beta strand.
  • the sixth beta strand and the seventh beta strand are comprised in a larger beta strand.
  • the seventh beta strand and the eighth beta strand are comprised in a larger beta strand.
  • the eighth beta strand and the ninth beta strand are comprised in a larger beta strand.
  • the first beta strand is about 5-7 (e.g., 3, 4, 5, 6, 7, 8, 9, or 10) amino acids in length.
  • the second beta strand is about 15-16 (e.g., 13, 14, 15, 16, 17, 18, or 19) amino acids in length.
  • the first alpha helix is about 15-17 (e.g., 13, 14, 15, 16, 17, 18, 19, or 20) amino acids in length.
  • the third beta strand is about 3-4 (e.g., 1, 2, 3, 4, 5, or 6) amino acids in length.
  • the fourth beta strand is about 10-11 (e.g., 8, 9, 10, 11, 12, or 13) amino acids in length.
  • the fifth beta strand is about 6-7 (e.g., 4, 5, 6, 7, 8, 9, or 10) amino acids in length.
  • the second alpha helix is about 8-14 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or 17) amino acids in length.
  • the second alpha helix may be broken up into two smaller alpha helices (e.g., separated by a random coil sequence).
  • each of the two smaller alpha helices are about 4-6 (e.g., 2, 3, 4, 5, 6, 7, or 8) amino acids in length.
  • the sixth beta strand is about 4-5 (e.g., 2, 3, 4, 5, 6, or 7) amino acids in length.
  • the seventh beta strand is about 5-6 (e.g., 3, 4, 5, 6, 7, 8, or 9) amino acids in length.
  • the eighth beta strand is about 7-9 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, or 13) amino acids in length.
  • the ninth beta strand is about 5-7 (e.g., 3, 4, 5, 6, 7, 8, 9, or 10) amino acids in length.
  • Exemplary jelly-roll domain secondary structures are described in Example 47 and Figure 47 of PCT/US19/65995.
  • an ORF1 molecule comprises a region comprising one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all) of the secondary structural elements (e.g., beta strands and/or alpha helices) of any of the jelly-roll domain secondary structures shown in Figure 47 of PCT/US19/65995.
  • Consensus ORF1 Domain Sequences In some embodiments, an ORF1 molecule, e.g., as described herein, comprises one or more of a jelly-roll domain, N22 domain, and/or C-terminal domain (CTD).
  • the jelly-roll domain comprises an amino acid sequence having a jelly-roll domain consensus sequence as described herein (e.g., as listed in any of Tables 37A-37C).
  • the N22 domain comprises an amino acid sequence having a N22 domain consensus sequence as described herein (e.g., as listed in any of Tables 37A-37C).
  • the CTD domain comprises an amino acid sequence having a CTD domain consensus sequence as described herein (e.g., as listed in any of Tables 37A-37C).
  • the amino acids listed in any of Tables 37A-37C in the format “(Xa-b)” comprise a contiguous series of amino acids, in which the series comprises at least a, and at most b, amino acids. In certain embodiments, all of the amino acids in the series are identical. In other embodiments, the series comprises at least two (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 21) different amino acids.
  • Table 37A Alphatorquevius ORF1 domain consensus sequences D i S SEQ ID NO QEEEE(X0-30)EQTVQQQLRQQLREQRRLRVQLQLLFQQLLKT Table 37B.
  • the jelly-roll domain comprises a jelly-roll domain amino acid sequence as listed in any of Tables 21, 23, 25, 27, 29, 31, 33, 35, D2, D4, D6, D8, D10, or 37A-37C, or an amino acid sequence having at least 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto.
  • the N22 domain comprises a N22 domain amino acid sequence as listed in any of Tables 21, 23, 25, 27, 29, 31, 33, 35, D2, D4, D6, D8, D10, or 37A-37C, or an amino acid sequence having at least 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto.
  • the CTD domain comprises a CTD domain amino acid sequence as listed in any of Tables 21, 23, 25, 27, 29, 31, 33, 35, D2, D4, D6, D8, D10, or 37A-37C, or an amino acid sequence having at least 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto.
  • an Anellovirus ORF1 protein sequence or a nucleic acid sequence encoding an ORF1 protein, can be identified from the genome of an Anellovirus (e.g., a putative Anellovirus genome identified, for example, by nucleic acid sequencing techniques, e.g., deep sequencing techniques).
  • an Anellovirus e.g., a putative Anellovirus genome identified, for example, by nucleic acid sequencing techniques, e.g., deep sequencing techniques.
  • an ORF1 protein sequence is identified by one or more (e.g., 1, 2, or all 3) of the following selection criteria: (i) Length Selection: Protein sequences (e.g., putative Anellovirus ORF1 sequences passing the criteria described in (ii) or (iii) below) may be size-selected for those greater than about 600 amino acid residues to identify putative Anellovirus ORF1 proteins. In some embodiments, an Anellovirus ORF1 protein sequence is at least about 600, 650, 700, 750, 800, 850, 900, 950, or 1000 amino acid residues in length.
  • an Alphatorquevirus ORF1 protein sequence is at least about 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 900, or 1000 amino acid residues in length.
  • a Betatorquevirus ORF1 protein sequence is at least about 650, 660, 670, 680, 690, 700, 750, 800, 900, or 1000 amino acid residues in length.
  • a Gammatorquevirus ORF1 protein sequence is at least about 650, 660, 670, 680, 690, 700, 750, 800, 900, or 1000 amino acid residues in length.
  • a nucleic acid sequence encoding an Anellovirus ORF1 protein is at least about 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 nucleotides in length.
  • a nucleic acid sequence encoding an Alphatorquevirus ORF1 protein sequence is at least about 2100, 2150, 2200, 2250, 2300, 2400, or 2500 nucleotides in length.
  • a nucleic acid sequence encoding a Betatorquevirus ORF1 protein sequence is at least about 1900, 1950, 2000, 2500, 2100, 2150, 2200, 2250, 2300, 2400, or 2500 or 1000 nucleotides in length.
  • a nucleic acid sequence encoding a Gammatorquevirus ORF1 protein sequence is at least about 1900, 1950, 2000, 2500, 2100, 2150, 2200, 2250, 2300, 2400, or 2500 or 1000 nucleotides in length.
  • Presence of ORF1 motif Protein sequences (e.g., putative Anellovirus ORF1 sequences passing the criteria described in (i) above or (iii) below) may be filtered to identify those that contain the conserved ORF1 motif in the N22 domain described above.
  • a putative Anellovirus ORF1 sequence comprises the sequence YNPXXDXGXXN.
  • a putative Anellovirus ORF1 sequence comprises the sequence Y[NCS]PXXDX[GASKR]XX[NTSVAK].
  • Presence of arginine-rich region Protein sequences (e.g., putative Anellovirus ORF1 sequences passing the criteria described in (i) and/or (ii) above) may be filtered for those that include an arginine-rich region (e.g., as described herein).
  • a putative Anellovirus ORF1 sequence comprises a contiguous sequence of at least about 30, 35, 40, 45, 50, 55, 60, 65, or 70 amino acids that comprises at least 30% (e.g., at least about 20%, 25%, 30%, 35%, 40%, 45%, or 50%) arginine residues. In some embodiments, a putative Anellovirus ORF1 sequence comprises a contiguous sequence of about 35-40, 40-45, 45-50, 50-55, 55-60, 60-65, or 65-70 amino acids that comprises at least 30% (e.g., at least about 20%, 25%, 30%, 35%, 40%, 45%, or 50%) arginine residues.
  • the arginine-rich region is positioned at least about 30, 40, 50, 60, 70, or 80 amino acids downstream of the start codon of the putative Anellovirus ORF1 protein. In some embodiments, the arginine-rich region is positioned at least about 50 amino acids downstream of the start codon of the putative Anellovirus ORF1 protein.
  • ORF2 Molecules In some embodiments, the anellovector comprises an ORF2 molecule and/or a nucleic acid encoding an ORF2 molecule.
  • an ORF2 molecule comprises a polypeptide having the structural features and/or activity of an Anellovirus ORF2 protein (e.g., an Anellovirus ORF2 protein as described herein, e.g., as listed in any of Tables A2, A4, A6, A8, A10, A12, C1-C5, 2, 4, 6, 8, 10, 12, 14, 16, or 18), or a functional fragment thereof.
  • an Anellovirus ORF2 protein e.g., an Anellovirus ORF2 protein as described herein, e.g., as listed in any of Tables A2, A4, A6, A8, A10, A12, C1-C5, 2, 4, 6, 8, 10, 12, 14, 16, or 18
  • an ORF2 molecule comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus ORF2 protein sequence as shown in any of Tables A2, A4, A6, A8, A10, A12, C1-C5, 2, 4, 6, 8, 10, 12, 14, 16, or 18.
  • an ORF2 molecule comprises an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to an Alphatorquevirus, Betatorquevirus, or Gammatorquevirus ORF2 protein.
  • an ORF2 molecule e.g., an ORF2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to an Alphatorquevirus ORF2 protein
  • an ORF2 molecule e.g., an ORF2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to a Betatorquevirus ORF2 protein
  • an ORF2 molecule (e.g., an ORF2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to a Gammatorquevirus ORF2 protein) has a length of about 100-200 amino acids (e.g., about 100-150 amino acids).
  • the ORF2 molecule comprises a helix-turn-helix motif (e.g., a helix- turn-helix motif comprising two alpha helices flanking a turn region).
  • the ORF2 molecule does not comprise the amino acid sequence of the ORF2 protein of TTV isolate TA278 or TTV isolate SANBAN.
  • an ORF2 molecule has protein phosphatase activity.
  • an ORF2 molecule or a nucleic acid molecule encoding same comprises at least one difference (e.g., a mutation, chemical modification, or epigenetic alteration) relative to a wild-type ORF2 protein, e.g., as described herein (e.g., as shown in any of Tables A2, A4, A6, A8, A10, A12, C1-C5, 2, 4, 6, 8, 10, 12, 14, 16, or 18).
  • a polypeptide (e.g., an ORF2 molecule) described herein comprises the amino acid sequence [W/F]X 7 HX 3 CX 1 CX 5 H (SEQ ID NO: 949), wherein X n is a contiguous sequence of any n amino acids.
  • X 7 indicates a contiguous sequence of any seven amino acids.
  • X 3 indicates a contiguous sequence of any three amino acids.
  • X 1 indicates any single amino acid.
  • X 5 indicates a contiguous sequence of any five amino acids.
  • the [W/F] can be either tryptophan or phenylalanine.
  • the [W/F]X 7 HX 3 CX 1 CX 5 H (SEQ ID NO: 949) is comprised within the N22 domain of an ORF2 molecule, e.g., as described herein.
  • a genetic element described herein comprises a nucleic acid sequence (e.g., a nucleic acid sequence encoding an ORF2 molecule, e.g., as described herein) encoding the amino acid sequence [W/F]X 7 HX 3 CX 1 CX 5 H (SEQ ID NO: 949), wherein X n is a contiguous sequence of any n amino acids.
  • the anellovector comprises a genetic element.
  • the genetic element has one or more of the following characteristics: is substantially non-integrating with a host cell’s genome, is an episomal nucleic acid, is a single stranded RNA, is circular, is about 1 to 10 kb, exists within the nucleus of the cell, can be bound by endogenous proteins, produces an effector, such as a polypeptide or nucleic acid (e.g., an RNA, iRNA, microRNA) that targets a gene, activity, or function of a host or target cell.
  • the genetic element is a substantially non-integrating.
  • the genetic element comprises a packaging signal, e.g., a sequence that binds a capsid protein.
  • the genetic element has less than 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5% sequence identity to a wild type Anellovirus nucleic acid sequence, e.g., has less than 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5% sequence identity to an Anellovirus nucleic acid sequence, e.g., as described herein.
  • the genetic element has less than 500450, 400, 350, 300, 250, 200, 150, or 100 contiguous nucleotides that are at least 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an Anellovirus nucleic acid sequence.
  • the genetic element has a length less than 20kb (e.g., less than about 19kb, 18kb, 17kb, 16kb, 15kb, 14kb, 13kb, 12kb, 11kb, 10kb, 9kb, 8kb, 7kb, 6kb, 5kb, 4kb, 3kb, 2kb, 1kb, or less).
  • the genetic element has, independently or in addition to, a length greater than 1000b (e.g., at least about 1.1kb, 1.2kb, 1.3kb, 1.4kb, 1.5kb, 1.6kb, 1.7kb, 1.8kb, 1.9kb, 2kb, 2.1kb, 2.2kb, 2.3kb, 2.4kb, 2.5kb, 2.6kb, 2.7kb, 2.8kb, 2.9kb, 3kb, 3.1kb, 3.2kb, 3.3kb, 3.4kb, 3.5kb, 3.6kb, 3.7kb, 3.8kb, 3.9kb, 4kb, 4.1kb, 4.2kb, 4.3kb, 4.4kb, 4.5kb, 4.6kb, 4.7kb, 4.8kb, 4.9kb, 5kb, or greater).
  • 1000b e.g., at least about 1.1kb, 1.2kb, 1.3kb, 1.4
  • the genetic element has a length of about 2.5-4.6, 2.8-4.0, 3.0-3.8, or 3.2-3.7 kb. In some embodiments, the genetic element has a length of about 1.5-2.0, 1.5-2.5, 1.5-3.0, 1.5-3.5, 1.5-3.8, 1.5-3.9, 1.5-4.0, 1.5-4.5, or 1.5-5.0 kb. In some embodiments, the genetic element has a length of about 2.0-2.5, 2.0-3.0, 2.0-3.5, 2.0-3.8, 2.0-3.9, 2.0-4.0, 2.0-4.5, or 2.0-5.0 kb. In some embodiments, the genetic element has a length of about 2.5-3.0, 2.5-3.5, 2.5-3.8, 2.5-3.9, 2.5-4.0, 2.5-4.5, or 2.5-5.0 kb.
  • the genetic element has a length of about 3.0-5.0, 3.5-5.0, 4.0-5.0, or 4.5-5.0 kb. In some embodiments, the genetic element has a length of about 1.5-2.0, 2.0-2.5, 2.5-3.0, 3.0-3.5, 3.1-3.6, 3.2-3.7, 3.3-3.8, 3.4-3.9, 3.5-4.0, 4.0-4.5, or 4.5-5.0 kb. In some embodiments, the genetic element has a length between about 3.6-3.9 kb. In some embodiments, the genetic element has a length between about 2.8-2.9 kb. In some embodiments, the genetic element has a length between about 2.0-3.2 kb.
  • the genetic element comprises one or more of the features described herein, e.g., a sequence encoding a substantially non-pathogenic protein, a protein binding sequence, one or more sequences encoding a regulatory nucleic acid, one or more regulatory sequences, one or more sequences encoding a replication protein, and other sequences.
  • the genetic element was produced from a double-stranded circular DNA (e.g., produced by transcription).
  • the genetic element does not comprise one or more bacterial plasmid elements (e.g., a bacterial origin of replication or a selectable marker, e.g., a bacterial resistance gene).
  • the genetic element does not comprise a bacterial plasmid backbone.
  • the disclosure provides a genetic element comprising a nucleic acid sequence (e.g., an RNA sequence) encoding (i) a substantially non-pathogenic exterior protein, (ii) an exterior protein binding sequence that binds the genetic element to the substantially non-pathogenic exterior protein, and (iii) a regulatory nucleic acid.
  • the genetic element may comprise one or more sequences with at least about 60%, 70% 80%, 85%, 90% 95%, 96%, 97%, 98% and 99% nucleotide sequence identity to any one of the nucleotide sequences to a native viral sequence (e.g., a native Anellovirus sequence, e.g., as described herein).
  • the genetic element encodes a protein binding sequence that binds to the substantially non-pathogenic protein.
  • the protein binding sequence facilitates packaging the genetic element into the proteinaceous exterior.
  • the protein binding sequence specifically binds an arginine-rich region of the substantially non-pathogenic protein.
  • the genetic element comprises a protein binding sequence as described in Example 8 of PCT/US19/65995.
  • the genetic element comprises a protein binding sequence having at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a 5’ UTR conserved domain or GC-rich domain of an Anellovirus sequence, e.g., as described herein.
  • the protein binding sequence has at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus 5’ UTR conserved domain nucleotide sequence, e.g., as described herein.
  • a nucleic acid molecule as described herein comprises a 5’ UTR sequence, e.g., a 5’ UTR conserved domain sequence as described herein (e.g., in any of Tables A1, B1, or C1), or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the 5’ UTR sequence comprises the nucleic acid sequence AGGTGAGTGAAACCACCGAAGTCAAGGGGCAATTCGGGCTAGGGX1CAGTCT, or a nucleic acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the 5’ UTR sequence comprises the nucleic acid sequence AGGTGAGTGAAACCACCGAAGTCAAGGGGCAATTCGGGCTAGGGX1CAGTCT, or a nucleic acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotide differences (e.g., substitutions, deletions, or additions) relative thereto.
  • X1 is A.
  • the 5’ UTR sequence comprises the nucleic acid sequence of the 5’ UTR of an Alphatorquevirus (e.g., Ring1), or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the 5’ UTR sequence comprises the nucleic acid sequence of the 5’ UTR conserved domain listed in Table A1, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least 95% sequence identity to the 5’ UTR conserved domain listed in Table A1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 95.775% sequence identity to the 5’ UTR conserved domain listed in Table A1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 97% sequence identity to the 5’ UTR conserved domain listed in Table A1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 97.183% sequence identity to the 5’ UTR conserved domain listed in Table A1.
  • the 5’ UTR sequence comprises the nucleic acid sequence AGGTGAGTTTACACACCGCAGTCAAGGGGCAATTCGGGCTCGGGACTGGC, or a nucleic acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the 5’ UTR sequence comprises the nucleic acid sequence AGGTGAGTTTACACACCGCAGTCAAGGGGCAATTCGGGCTCGGGACTGGC, or a nucleic acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotide differences (e.g., substitutions, deletions, or additions) relative thereto.
  • the 5’ UTR sequence comprises the nucleic acid sequence of the 5’ UTR of an Betatorquevirus (e.g., Ring2), or a sequence having at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • Betatorquevirus e.g., Ring2
  • the 5’ UTR sequence comprises the nucleic acid sequence of the 5’ UTR conserved domain listed in Table B1, or a sequence having at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least 85% sequence identity to the 5’ UTR conserved domain listed in Table B1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least 87% sequence identity to the 5’ UTR conserved domain listed in Table B1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least 87.324% sequence identity to the 5’ UTR conserved domain listed in Table B1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 88% sequence identity to the 5’ UTR conserved domain listed in Table B1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 88.732% sequence identity to the 5’ UTR conserved domain listed in Table B1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 91% sequence identity to the 5’ UTR conserved domain listed in Table B1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least 91.549% sequence identity to the 5’ UTR conserved domain listed in Table B1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 92% sequence identity to the 5’ UTR conserved domain listed in Table B1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 92.958% sequence identity to the 5’ UTR conserved domain listed in Table B1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 94% sequence identity to the 5’ UTR conserved domain listed in Table B1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least 94.366% sequence identity to the 5’ UTR conserved domain listed in Table B1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 95% sequence identity to the 5’ UTR conserved domain listed in Table B1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 95.775% sequence identity to the 5’ UTR conserved domain listed in Table B1. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least 97% sequence identity to the 5’ UTR conserved domain listed in Table B1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least 97.183% sequence identity to the 5’ UTR conserved domain listed in Table B1.
  • the 5’ UTR sequence comprises the nucleic acid sequence AGGTGAGTGAAACCACCGAAGTCAAGGGGCAATTCGGGCTAGATCAGTCT, or a nucleic acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the 5’ UTR sequence comprises the nucleic acid sequence AGGTGAGTGAAACCACCGAAGTCAAGGGGCAATTCGGGCTAGATCAGTCT, or a nucleic acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotide differences (e.g., substitutions, deletions, or additions) relative thereto.
  • the 5’ UTR sequence comprises the nucleic acid sequence of the 5’ UTR of a Gammatorquevirus (e.g., Ring4), or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • a Gammatorquevirus e.g., Ring4
  • the 5’ UTR sequence comprises the nucleic acid sequence of the 5’ UTR conserved domain listed in Table C1, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least 97% sequence identity to the 5’ UTR conserved domain listed in Table C1.
  • the nucleic acid molecule comprises a nucleic acid sequence having at least 97.183% sequence identity to the 5’ UTR conserved domain listed in Table C1.
  • the 5’ UTR sequence comprises the nucleic acid sequence AGGTGAGTGAAACCACCGAGGTCTAGGGGCAATTCGGGCTAGGGCAGTCT, or a nucleic acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
  • the 5’ UTR sequence comprises the nucleic acid sequence AGGTGAGTGAAACCACCGAGGTCTAGGGGCAATTCGGGCTAGGGCAGTCT, or a nucleic acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotide differences (e.g., substitutions, deletions, or additions) relative thereto.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to an Anellovirus 5’ UTR sequence, e.g., a nucleic acid sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the Consensus 5’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein- binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the exemplary TTV 5’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the TTV-CT30F 5’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the TTV-HD23a 5’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the TTV-JA205’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the TTV-TJN025’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the TTV-tth85’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the Alphatorquevirus Consensus 5’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the Alphatorquevirus Clade 15’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the Alphatorquevirus Clade 25’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the Alphatorquevirus Clade 35’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the Alphatorquevirus Clade 45’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the Alphatorquevirus Clade 55’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the Alphatorquevirus Clade 65’ UTR sequence shown in Table 38.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the Alphatorquevirus Clade 75’ UTR sequence shown in Table 38. Table 38.
  • an Anellovirus 5’ UTR sequence can be identified within the genome of an Anellovirus (e.g., a putative Anellovirus genome identified, for example, by nucleic acid sequencing techniques, e.g., deep sequencing techniques).
  • an Anellovirus 5’ UTR sequence is identified by one or both of the following steps: (i) Identification of circularization junction point: In some embodiments, a 5’ UTR will be positioned near a circularization junction point of a full-length, circularized Anellovirus genome.
  • a circularization junction point can be identified, for example, by identifying overlapping regions of the sequence.
  • a overlapping region of the sequence can be trimmed from the sequence to produce a full-length Anellovirus genome sequence that has been circularized.
  • a genome sequence is circularized in this manner using software. Without wishing to be bound by theory, computationally circularizing a genome may result in the start position for the sequence being oriented in a non-biological. Landmarks within the sequence can be used to re-orient sequences in the proper direction.
  • landmark sequence may include sequences having substantial homology to one or more elements within an Anellovirus genome as described herein (e.g., one or more of a TATA box, cap site, initiator element, transcriptional start site, 5’ UTR conserved domain, ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, ORF2t/3, three open-reading frame region, poly(A) signal, or GC-rich region of an Anellovirus, e.g., as described herein).
  • elements within an Anellovirus genome as described herein (e.g., one or more of a TATA box, cap site, initiator element, transcriptional start site, 5’ UTR conserved domain, ORF1, ORF1/1, ORF1/2, ORF2, ORF2/2, ORF2/3, ORF2t/3, three open-reading frame region, poly(A) signal, or GC-rich region of an Anellovirus, e.g., as described herein).
  • (ii) Identification of 5’ UTR sequence Once a putative Anellovirus genome sequence has been obtained, the sequence (or portions thereof, e.g., having a length between about 40-50, 50-60, 60-70, 70-80, 80-90, or 90-100 nucleotides) can be compared to one or more Anellovirus 5’ UTR sequences (e.g., as described herein) to identify sequences having substantial homology thereto.
  • a putative Anellovirus 5’ UTR region has at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus 5’ UTR sequence as described herein.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to a nucleic acid sequence shown in Table 39.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to a GC-rich sequence shown in Table 39.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to a 36-nucleotide GC-rich sequence as shown in Table 39 (e.g., 36-nucleotide consensus GC-rich region sequence 1, 36-nucleotide consensus GC-rich region sequence 2, TTV Clade 136-nucleotide region, TTV Clade 336-nucleotide region, TTV Clade 3 isolate GH136- nucleotide region, TTV Clade 3 sle193236-nucleotide region, TTV Clade 4 ctdc00236-nucleotide region, TTV Clade 536-nucleotide region, TTV Clade 636-nucleotide region, or T
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence comprising at least 10, 15, 20, 25, 30, 31, 32, 33, 34, 35, or 36 consecutive nucleotides of a 36-nucleotide GC-rich sequence as shown in Table 39 (e.g., 36-nucleotide consensus GC-rich region sequence 1, 36-nucleotide consensus GC-rich region sequence 2, TTV Clade 1 36-nucleotide region, TTV Clade 336-nucleotide region, TTV Clade 3 isolate GH136-nucleotide region, TTV Clade 3 sle193236-nucleotide region, TTV Clade 4 ctdc00236-nucleotide region, TTV Clade 536- nucleotide region, TTV Clade 636-nucleotide region, or TTV Clade 736-nucleotide region).
  • Table 39 e.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to an Alphatorquevirus GC-rich region sequence, e.g., selected from TTV-CT30F, TTV-P13-1, TTV-tth8, TTV-HD20a, TTV-16, TTV-TJN02, or TTV-HD16d, e.g., as listed in Table 39.
  • an Alphatorquevirus GC-rich region sequence e.g., selected from TTV-CT30F, TTV-P13-1, TTV-tth8, TTV-HD20a, TTV-16, TTV-TJN02, or TTV-HD16d, e.g., as listed in Table 39.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence comprising at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 104, 105, 108, 110, 111, 115, 120, 122, 130, 140, 145, 150, 155, or 156 consecutive nucleotides of an Alphatorquevirus GC-rich region sequence, e.g., selected from TTV-CT30F, TTV-P13- 1, TTV-tth8, TTV-HD20a, TTV-16, TTV-TJN02, or TTV-HD16d, e.g., as listed in Table 39.
  • an Alphatorquevirus GC-rich region sequence e.g., selected from TTV-CT30F, TTV-P13- 1, TTV-tth8, TTV-HD20a, TTV-16, TTV-TJN02, or TTV-HD16d, e.g., as
  • the 36-nucleotide GC-rich sequence is selected from: (i) CGCGCTGCGCGCGCCGCCCAGTAGGGGGAGCCATGC (SEQ ID NO: 160), (ii) GCGCTX1CGCGCGCGCGCCGGGGGGCTGCGCCCCC (SEQ ID NO: 164), wherein X1 is selected from T, G, or A; (iii) GCGCTTCGCGCGCCGCCCACTAGGGGGCGTTGCGCG (SEQ ID NO: 165); (iv) GCGCTGCGCGCGCCGCCCAGTAGGGGGCGCAATGCG (SEQ ID NO: 166); (v) GCGCTGCGCGCGCGGCCCCCGGGGGAGGCATTGCCT (SEQ ID NO: 167); (vi) GCGCTGCGCGCGCGCGCCGGGGGGGCGCCAGCGCCC (SEQ ID NO: 168); (vii) GCGCTTCGCGCGCGCGCCGGGGGGCTCCGCCCCCCC (SEQ ID NO: 169
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises the nucleic acid sequence CGCGCTGCGCGCGCCGCCCAGTAGGGGGAGCCATGC (SEQ ID NO: 160).
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence of the Consensus GC-rich sequence shown in Table 39, wherein X 1 , X 4 , X 5 , X 6 , X 7 , X 12 , X 13 , X 14 , X 15 , X 20 , X 21 , X 22 , X 26 , X 29 , X 30 , and X 33 are each independently any nucleotide and wherein X2, X3, X8, X9, X10, X11, X16, X17, X18, X19, X23, X24, X25, X27, X28, X
  • one or more of (e.g., all of) X1 through X34 are each independently the nucleotide (or absent) specified in Table 39.
  • the genetic element e.g., protein-binding sequence of the genetic element
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to a TTV-CT30F GC-rich sequence shown in Table 39 (e.g., the full sequence, Fragment 1, Fragment 2, Fragment 3, Fragment 4, Fragment 5, Fragment 6, Fragment 7, Fragment 8, or any combination thereof, e.g., Fragments 1-7 in order).
  • Table 39 e.g., the full sequence, Fragment 1, Fragment 2, Fragment 3, Fragment 4, Fragment 5, Fragment 6, Fragment 7, Fragment 8, or any combination thereof, e.g., Fragments 1-7 in order.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to a TTV-HD23a GC-rich sequence shown in Table 39 (e.g., the full sequence, Fragment 1, Fragment 2, Fragment 3, Fragment 4, Fragment 5, Fragment 6, or any combination thereof, e.g., Fragments 1-6 in order).
  • Table 39 e.g., the full sequence, Fragment 1, Fragment 2, Fragment 3, Fragment 4, Fragment 5, Fragment 6, or any combination thereof, e.g., Fragments 1-6 in order.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to a TTV-JA20 GC-rich sequence shown in Table 39 (e.g., the full sequence, Fragment 1, Fragment 2, or any combination thereof, e.g., Fragments 1 and 2 in order).
  • Table 39 e.g., the full sequence, Fragment 1, Fragment 2, or any combination thereof, e.g., Fragments 1 and 2 in order.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to a TTV-TJN02 GC-rich sequence shown in Table 39 (e.g., the full sequence, Fragment 1, Fragment 2, Fragment 3, Fragment 4, Fragment 5, Fragment 6, Fragment 7, Fragment 8, or any combination thereof, e.g., Fragments 1-8 in order).
  • Table 39 e.g., the full sequence, Fragment 1, Fragment 2, Fragment 3, Fragment 4, Fragment 5, Fragment 6, Fragment 7, Fragment 8, or any combination thereof, e.g., Fragments 1-8 in order.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to a TTV-tth8 GC-rich sequence shown in Table 39 (e.g., the full sequence, Fragment 1, Fragment 2, Fragment 3, Fragment 4, Fragment 5, Fragment 6, Fragment 7, Fragment 8, Fragment 9, or any combination thereof, e.g., Fragments 1-6 in order).
  • Table 39 e.g., the full sequence, Fragment 1, Fragment 2, Fragment 3, Fragment 4, Fragment 5, Fragment 6, Fragment 7, Fragment 8, Fragment 9, or any combination thereof, e.g., Fragments 1-6 in order).
  • the genetic element (e.g., protein- binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to Fragment 7 shown in Table 39.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to Fragment 8 shown in Table 39.
  • the genetic element (e.g., protein-binding sequence of the genetic element) comprises a nucleic acid sequence having at least about 75% (e.g., at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to Fragment 9 shown in Table 39. Table 39.
  • the genetic element may include one or more sequences that are or encode an effector, e.g., a functional effector, e.g., an endogenous effector or an exogenous effector, e.g., a therapeutic polypeptide or nucleic acid, e.g., cytotoxic or cytolytic RNA or protein.
  • the functional nucleic acid is a non-coding RNA. In some embodiments, the functional nucleic acid is a coding RNA.
  • the effector may modulate a biological activity, for example increasing or decreasing enzymatic activity, gene expression, cell signaling, and cellular or organ function. Effector activities may also include binding regulatory proteins to modulate activity of the regulator, such as transcription or translation. Effector activities also may include activator or inhibitor functions. For example, the effector may induce enzymatic activity by triggering increased substrate affinity in an enzyme, e.g., fructose 2,6-bisphosphate activates phosphofructokinase 1 and increases the rate of glycolysis in response to the insulin.
  • an enzyme e.g., fructose 2,6-bisphosphate activates phosphofructokinase 1 and increases the rate of glycolysis in response to the insulin.
  • the effector may inhibit substrate binding to a receptor and inhibit its activation, e.g., naltrexone and naloxone bind opioid receptors without activating them and block the receptors’ ability to bind opioids.
  • Effector activities may also include modulating protein stability/degradation and/or transcript stability/degradation.
  • proteins may be targeted for degradation by the polypeptide co-factor, ubiquitin, onto proteins to mark them for degradation.
  • the effector inhibits enzymatic activity by blocking the enzyme’s active site, e.g., methotrexate is a structural analog of tetrahydrofolate, a coenzyme for the enzyme dihydrofolate reductase that binds to dihydrofolate reductase 1000-fold more tightly than the natural substrate and inhibits nucleotide base synthesis.
  • the sequence encoding an effector comprises 100-2000, 100-1000, 100- 500, 100-200, 200-2000, 200-1000, 200-500, 500-1000, 500-2000, or 1000-2000 nucleotides.
  • the effector is a nucleic acid or protein payload, e.g., as described herein. Regulatory Nucleic Acids
  • the effector is a regulatory nucleic acid. Regulatory nucleic acids modify expression of an endogenous gene and/or an exogenous gene. In one embodiment, the regulatory nucleic acid targets a host gene.
  • the regulatory nucleic acids may include, but are not limited to, a nucleic acid that hybridizes to an endogenous gene (e.g., miRNA, siRNA, mRNA, lncRNA, RNA, DNA, an antisense RNA, gRNA as described herein elsewhere), nucleic acid that hybridizes to an exogenous nucleic acid such as a viral DNA or RNA, nucleic acid that hybridizes to an RNA, nucleic acid that interferes with gene transcription, nucleic acid that interferes with RNA translation, nucleic acid that stabilizes RNA or destabilizes RNA such as through targeting for degradation, and nucleic acid that modulates a DNA or RNA binding factor.
  • an endogenous gene e.g., miRNA, siRNA, mRNA, lncRNA, RNA, DNA, an antisense RNA, gRNA as described herein elsewhere
  • nucleic acid that hybridizes to an exogenous nucleic acid such as a viral DNA or RNA
  • the regulatory nucleic acid encodes an miRNA. In some embodiments, the regulatory nucleic acid is endogenous to a wild-type Anellovirus. In some embodiments, the regulatory nucleic acid is exogenous to a wild-type Anellovirus. In some embodiments, the regulatory nucleic acid comprises RNA or RNA-like structures typically containing 5-500 base pairs (depending on the specific RNA structure, e.g., miRNA 5-30 bps, lncRNA 200-500 bps) and may have a nucleobase sequence identical (or complementary) or nearly identical (or substantially complementary) to a coding sequence in an expressed target gene within the cell, or a sequence encoding an expressed target gene within the cell.
  • the regulatory nucleic acid comprises a nucleic acid sequence, e.g., a guide RNA (gRNA).
  • the DNA targeting moiety comprises a guide RNA or nucleic acid encoding the guide RNA.
  • a gRNA short synthetic RNA can be composed of a “scaffold” sequence necessary for binding to the incomplete effector moiety and a user-defined ⁇ 20 nucleotide targeting sequence for a genomic target.
  • guide RNA sequences are generally designed to have a length of between 17 – 24 nucleotides (e.g., 19, 20, or 21 nucleotides) and complementary to the targeted nucleic acid sequence.
  • sgRNA single guide RNA
  • sgRNA single guide RNA
  • tracrRNA for binding the nuclease
  • crRNA to guide the nuclease to the sequence targeted for editing
  • Chemically modified sgRNAs have also been demonstrated to be effective in genome editing; see, for example, Hendel et al. (2015) Nature Biotechnol., 985 – 991.
  • the regulatory nucleic acid comprises a gRNA that recognizes specific DNA sequences (e.g., sequences adjacent to or within a promoter, enhancer, silencer, or repressor of a gene).
  • Certain regulatory nucleic acids can inhibit gene expression through the biological process of RNA interference (RNAi).
  • RNAi molecules comprise RNA or RNA-like structures typically containing 15-50 base pairs (such as about18-25 base pairs) and having a nucleobase sequence identical (complementary) or nearly identical (substantially complementary) to a coding sequence in an expressed target gene within the cell.
  • RNAi molecules include, but are not limited to: short interfering RNAs (siRNAs), double-strand RNAs (dsRNA), micro RNAs (miRNAs), short hairpin RNAs (shRNA), meroduplexes, and dicer substrates (U.S. Pat. Nos.8,084,5998,349,809 and 8,513,207).
  • Long non-coding RNAs lncRNA are defined as non-protein coding transcripts longer than 100 nucleotides. This somewhat arbitrary limit distinguishes lncRNAs from small regulatory RNAs such as microRNAs (miRNAs), short interfering RNAs (siRNAs), and other short RNAs.
  • lncRNAs are characterized as tissue-specific. Divergent lncRNAs that are transcribed in the opposite direction to nearby protein-coding genes (comprise a significant proportion ⁇ 20% of total lncRNAs in mammalian genomes) may possibly regulate the transcription of the nearby gene.
  • the genetic element may encode regulatory nucleic acids with a sequence substantially complementary, or fully complementary, to all or a fragment of an endogenous gene or gene product (e.g., mRNA).
  • the regulatory nucleic acids may complement sequences at the boundary between introns and exons to prevent the maturation of newly-generated nuclear RNA transcripts of specific genes into mRNA for transcription.
  • the regulatory nucleic acids that are complementary to specific genes can hybridize with the mRNA for that gene and prevent its translation.
  • the antisense regulatory nucleic acid can be DNA, RNA, or a derivative or hybrid thereof.
  • the length of the regulatory nucleic acid that hybridizes to the transcript of interest may be between 5 to 30 nucleotides, between about 10 to 30 nucleotides, or about 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more nucleotides.
  • the degree of identity of the regulatory nucleic acid to the targeted transcript should be at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%.
  • the genetic element may encode a regulatory nucleic acid, e.g., a micro RNA (miRNA) molecule identical to about 5 to about 25 contiguous nucleotides of a target gene.
  • the miRNA sequence targets a mRNA and commences with the dinucleotide AA, comprises a GC-content of about 30-70% (about 30-60%, about 40-60%, or about 45%-55%), and does not have a high percentage identity to any nucleotide sequence other than the target in the genome of the mammal in which it is to be introduced, for example as determined by standard BLAST search.
  • siRNAs and shRNAs resemble intermediates in the processing pathway of the endogenous microRNA (miRNA) genes (Bartel, Cell 116:281-297, 2004).
  • miRNAs can function as miRNAs and vice versa (Zeng et al., Mol Cell 9:1327-1333, 2002; Doench et al., Genes Dev 17:438-442, 2003).
  • MicroRNAs like siRNAs, use RISC to downregulate target genes, but unlike siRNAs, most animal miRNAs do not cleave the mRNA.
  • miRNAs reduce protein output through translational suppression or polyA removal and mRNA degradation (Wu et al., Proc Natl Acad Sci USA 103:4034-4039, 2006).
  • Known miRNA binding sites are within mRNA 3' UTRs; miRNAs seem to target sites with near-perfect complementarity to nucleotides 2-8 from the miRNA's 5' end (Rajewsky, Nat Genet 38 Suppl:S8-13, 2006; Lim et al., Nature 433:769-773, 2005). This region is known as the seed region.
  • siRNAs and miRNAs are interchangeable, exogenous siRNAs downregulate mRNAs with seed complementarity to the siRNA (Birmingham et al., Nat Methods 3:199-204, 2006. Multiple target sites within a 3' UTR give stronger downregulation (Doench et al., Genes Dev 17:438-442, 2003).
  • Lists of known miRNA sequences can be found in databases maintained by research organizations, such as Wellcome Trust Sanger Institute, Penn Center for Bioinformatics, Memorial Sloan Kettering Cancer Center, and European Molecule Biology Laboratory, among others.
  • Known effective siRNA sequences and cognate binding sites are also well represented in the relevant literature. RNAi molecules are readily designed and produced by technologies known in the art.
  • the regulatory nucleic acid may modulate expression of RNA encoded by a gene. Because multiple genes can share some degree of sequence homology with each other, in some embodiments, the regulatory nucleic acid can be designed to target a class of genes with sufficient sequence homology. In some embodiments, the regulatory nucleic acid can contain a sequence that has complementarity to sequences that are shared amongst different gene targets or are unique for a specific gene target.
  • the regulatory nucleic acid can be designed to target conserved regions of an RNA sequence having homology between several genes thereby targeting several genes in a gene family (e.g., different gene isoforms, splice variants, mutant genes, etc.). In some embodiments, the regulatory nucleic acid can be designed to target a sequence that is unique to a specific RNA sequence of a single gene. In some embodiments, the genetic element may include one or more sequences that encode regulatory nucleic acids that modulate expression of one or more genes. In one embodiment, the gRNA described elsewhere herein are used as part of a CRISPR system for gene editing.
  • the anellovector may be designed to include one or multiple guide RNA sequences corresponding to a desired target DNA sequence; see, for example, Cong et al. (2013) Science, 339:819–823; Ran et al. (2013) Nature Protocols, 8:2281 – 2308. At least about 16 or 17 nucleotides of gRNA sequence generally allow for Cas9-mediated DNA cleavage to occur; for Cpf1 at least about 16 nucleotides of gRNA sequence is needed to achieve detectable DNA cleavage.
  • the genetic element comprises a therapeutic expression sequence, e.g., a sequence that encodes a therapeutic peptide or polypeptide, e.g., an intracellular peptide or intracellular polypeptide, a secreted polypeptide, or a protein replacement therapeutic.
  • the genetic element includes a sequence encoding a protein e.g., a therapeutic protein.
  • therapeutic proteins may include, but are not limited to, a hormone, a cytokine, an enzyme, an antibody (e.g., one or a plurality of polypeptides encoding at least a heavy chain or a light chain), a transcription factor, a receptor (e.g., a membrane receptor), a ligand, a membrane transporter, a secreted protein, a peptide, a carrier protein, a structural protein, a nuclease, or a component thereof.
  • the genetic element includes a sequence encoding a peptide e.g., a therapeutic peptide.
  • the peptides may be linear or branched.
  • the peptide has a length from about 5 to about 500 amino acids, about 15 to about 400 amino acids, about 20 to about 325 amino acids, about 25 to about 250 amino acids, about 50 to about 200 amino acids, or any range there between.
  • the polypeptide encoded by the therapeutic expression sequence may be a functional variant or fragment thereof of any of the above, e.g., a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% identity to a protein sequence which disclosed in a table herein by reference to its UniProt ID.
  • the therapeutic expression sequence may encode an antibody or antibody fragment that binds any of the above, e.g., an antibody against a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% identity to a protein sequence which disclosed in a table herein by reference to its UniProt ID.
  • antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen- binding activity.
  • An “antibody fragment” refers to a molecule that includes at least one heavy chain or light chain and binds an antigen.
  • antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and multispecific antibodies formed from antibody fragments.
  • exemplary intracellular polypeptide effectors In some embodiments, the effector comprises a cytosolic polypeptide or cytosolic peptide. In some embodiments, the effector comprises cytosolic peptide is a DPP-4 inhibitor, an activator of GLP-1 signaling, or an inhibitor of neutrophil elastase.
  • the effector increases the level or activity of a growth factor or receptor thereof (e.g., an FGF receptor, e.g., FGFR3).
  • the effector comprises an inhibitor of n-myc interacting protein activity (e.g., an n-myc interacting protein inhibitor); an inhibitor of EGFR activity (e.g., an EGFR inhibitor); an inhibitor of IDH1 and/or IDH2 activity (e.g., an IDH1 inhibitor and/or an IDH2 inhibitor); an inhibitor of LRP5 and/or DKK2 activity (e.g., an LRP5 and/or DKK2 inhibitor); an inhibitor of KRAS activity; an activator of HTT activity; or inhibitor of DPP-4 activity (e.g., a DPP-4 inhibitor).
  • n-myc interacting protein activity e.g., an n-myc interacting protein inhibitor
  • an inhibitor of EGFR activity e.g., an EGFR inhibitor
  • an inhibitor of IDH1 and/or IDH2 activity
  • the effector comprises a regulatory intracellular polyeptpide.
  • the regulatory intracellular polypeptide binds one or more molecule (e.g., protein or nucleic acid) endogenous to the target cell.
  • the regulatory intracellular polypeptide increases the level or activity of one or more molecule (e.g., protein or nucleic acid) endogenous to the target cell.
  • the regulatory intracellular polypeptide decreases the level or activity of one or more molecule (e.g., protein or nucleic acid) endogenous to the target cell.
  • Exemplary secreted polypeptide effectors Exemplary secreted therapeutics are described herein, e.g., in the tables below. Table 50.
  • an effector described herein comprises a cytokine of Table 50, or a functional variant thereof, e.g., a homolog (e.g., ortholog or paralog) or fragment thereof.
  • an effector described herein comprises a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% sequence identity to an amino acid sequence listed in Table 50 by reference to its UniProt ID.
  • the functional variant binds to the corresponding cytokine receptor with a Kd of no more than 10%, 20%, 30%, 40%, or 50% higher or lower than the Kd of the corresponding wild-type cytokine for the same receptor under the same conditions.
  • the effector comprises a fusion protein comprising a first region (e.g., a cytokine polypeptide of Table 50 or a functional variant or fragment thereof) and a second, heterologous region.
  • the first region is a first cytokine polypeptide of Table 50.
  • the second region is a second cytokine polypeptide of Table 50, wherein the first and second cytokine polypeptides form a cytokine heterodimer with each other in a wild-type cell.
  • the polypeptide of Table 50 or functional variant thereof comprises a signal sequence, e.g., a signal sequence that is endogenous to the effector, or a heterologous signal sequence.
  • an anellovector encoding a cytokine of Table 50, or a functional variant thereof, is used for the treatment of a disease or disorder described herein.
  • an effector described herein comprises an antibody molecule (e.g., an scFv) that binds a cytokine of Table 50. In some embodiments, an effector described herein comprises an antibody molecule (e.g., an scFv) that binds a cytokine receptor of Table 50. In some embodiments, the antibody molecule comprises a signal sequence.
  • cytokines and cytokine receptors are described, e.g., in Akdis et al., “Interleukins (from IL-1 to IL-38), interferons, transforming growth factor ⁇ , and TNF- ⁇ : Receptors, functions, and roles in diseases” October 2016 Volume 138, Issue 4, Pages 984–1010, which is herein incorporated by reference in its entirety, including Table I therein. Table 51.
  • an effector described herein comprises a hormone of Table 51, or a functional variant thereof, e.g., a homolog (e.g., ortholog or paralog) or fragment thereof.
  • an effector described herein comprises a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% sequence identity to an amino acid sequence listed in Table 51 by reference to its UniProt ID.
  • the functional variant binds to the corresponding receptor with a Kd of no more than 10%, 20%, 30%, 40%, or 50% higher than the Kd of the corresponding wild-type hormone for the same receptor under the same conditions.
  • the polypeptide of Table 51 or functional variant thereof comprises a signal sequence, e.g., a signal sequence that is endogenous to the effector, or a heterologous signal sequence.
  • an anellovector encoding a hormone of Table 51, or a functional variant thereof is used for the treatment of a disease or disorder described herein.
  • an effector described herein comprises an antibody molecule (e.g., an scFv) that binds a hormone of Table 51.
  • an effector described herein comprises an antibody molecule (e.g., an scFv) that binds a hormone receptor of Table 51.
  • the antibody molecule comprises a signal sequence.
  • Table 52 Exemplary growth factors VEGF 189, and VEGF Angiopoietin family
  • an effector described herein comprises a growth factor of Table 52, or a functional variant thereof, e.g., a homolog (e.g., ortholog or paralog) or fragment thereof.
  • an effector described herein comprises a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% sequence identity to an amino acid sequence listed in Table 52 by reference to its UniProt ID.
  • the functional variant binds to the corresponding receptor with a Kd of no more than 10%, 20%, 30%, 40%, or 50% higher than the Kd of the corresponding wild-type growth factor for the same receptor under the same conditions.
  • the polypeptide of Table 52 or functional variant thereof comprises a signal sequence, e.g., a signal sequence that is endogenous to the effector, or a heterologous signal sequence.
  • an anellovector encoding a growth factor of Table 52, or a functional variant thereof is used for the treatment of a disease or disorder described herein.
  • an effector described herein comprises an antibody molecule (e.g., an scFv) that binds a growth factor of Table 52.
  • an effector described herein comprises an antibody molecule (e.g., an scFv) that binds a growth factor receptor of Table 52.
  • the antibody molecule comprises a signal sequence.
  • an effector described herein comprises a polypeptide of Table 53, or a functional variant thereof, e.g., a homolog (e.g., ortholog or paralog) or fragment thereof.
  • an effector described herein comprises a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% sequence identity to an amino acid sequence listed in Table 53 by reference to its UniProt ID.
  • the functional variant catalyzes the same reaction as the corresponding wild-type protein, e.g., at a rate no less than 10%, 20%, 30%, 40%, or 50% lower than the wild-type protein.
  • the polypeptide of Table 53 or functional variant thereof comprises a signal sequence, e.g., a signal sequence that is endogenous to the effector, or a heterologous signal sequence.
  • an anellovector encoding a polypeptide of Table 53, or a functional variant thereof is used for the treatment of a disease or disorder of Table 53.
  • Exemplary protein replacement therapeutics Exemplary protein replacement therapeutics are described herein, e.g., in the tables below. Table 54.
  • an effector described herein comprises an enzyme of Table 54, or a functional variant thereof, e.g., a homolog (e.g., ortholog or paralog) or fragment thereof.
  • an effector described herein comprises a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% sequence identity to an amino acid sequence listed in Table 54 by reference to its UniProt ID.
  • the functional variant catalyzes the same reaction as the corresponding wild-type protein, e.g., at a rate no less than 10%, 20%, 30%, 40%, or 50% lower than the wild-type protein.
  • an anellovector encoding an enzyme of Table 54, or a functional variant thereof is used for the treatment of a disease or disorder of Table 54.
  • an anellovector is used to deliver uridine diphosphate glucuronyl-transferase or a functional variant thereof to a target cell, e.g., a liver cell. In some embodiments, an anellovector is used to deliver OCA1 or a functional variant thereof to a target cell, e.g., a retinal cell. Table 55.
  • an effector described herein comprises an erythropoietin (EPO), e.g., a human erythropoietin (hEPO), or a functional variant thereof.
  • EPO erythropoietin
  • hEPO human erythropoietin
  • an anellovector encoding an erythropoietin, or a functional variant thereof is used for stimulating erythropoiesis.
  • an anellovector encoding an erythropoietin, or a functional variant thereof is used for the treatment of a disease or disorder, e.g., anemia.
  • an anellovector is used to deliver EPO or a functional variant thereof to a target cell, e.g., a red blood cell.
  • an effector described herein comprises a polypeptide of Table 55, or a functional variant thereof, e.g., a homolog (e.g., ortholog or paralog) or fragment thereof.
  • an effector described herein comprises a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% sequence identity to an amino acid sequence listed in Table 55 by reference to its UniProt ID.
  • an anellovector encoding a polypeptide of Table 55, or a functional variant thereof is used for the treatment of a disease or disorder of Table 55.
  • an anellovector is used to deliver SMN or a functional variant thereof to a target cell, e.g., a cell of the spinal cord and/or a motor neuron.
  • an anellovector is used to deliver a micro-dystrophin to a target cell, e.g., a myocyte.
  • an effector described herein comprises a clotting factor, e.g., a clotting factor listed in Table 54 or Table 55 herein.
  • an effector described herein comprises a protein that, when mutated, causes a lysosomal storage disorder, e.g., a protein listed in Table 54 or Table 55 herein.
  • an effector described herein comprises a transporter protein, e.g., a transporter protein listed in Table 55 herein.
  • a functional variant of a wild-type protein comprises a protein that has one or more activities of the wild-type protein, e.g., the functional variant catalyzes the same reaction as the corresponding wild-type protein, e.g., at a rate no less than 10%, 20%, 30%, 40%, or 50% lower than the wild-type protein.
  • the functional variant binds to the same binding partner that is bound by the wild-type protein, e.g., with a Kd of no more than 10%, 20%, 30%, 40%, or 50% higher than the Kd of the corresponding wild-type protein for the same binding partner under the same conditions.
  • the functional variant has at a polyeptpide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to that of the wild-type polypeptide.
  • the functional variant comprises a homolog (e.g., ortholog or paralog) of the corresponding wild-type protein.
  • the functional variant is a fusion protein.
  • the fusion comprises a first region with at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to the corresponding wild-type protein, and a second, heterologous region.
  • the functional variant comprises or consists of a fragment of the corresponding wild-type protein.
  • Therapeutic polypeptides described herein also include growth factors, e.g., as disclosed in Table 56, or functional variants thereof, e.g., a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% identity to a protein sequence disclosed in Table 56 by reference to its UniProt ID.
  • Therapeutic polypeptides described herein also include transformation factors, e.g., protein factors that transform fibroblasts into differentiated cell e.g., factors disclosed in Table 57 or functional variants thereof, .g., a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% identity to a protein sequence disclosed in Table 57 by reference to its UniProt ID. Table 57.
  • transformation factors e.g., protein factors that transform fibroblasts into differentiated cell e.g., factors disclosed in Table 57 or functional variants thereof, .g., a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% identity to a protein sequence disclosed in Table 57 by reference to its UniProt ID. Table 57.
  • Proteins that stimulate cellular regeneration also include proteins that stimulate cellular regeneration e.g., proteins disclosed in Table 58 or functional variants thereof, e.g., a protein having at least 80%, 85%, 90%, 95%, 967%, 98%, 99% identity to a protein sequence disclosed in Table 58 by reference to its UniProt ID. Table 58.
  • Exemplary proteins that stimulate cellular regeneration STING modulator effectors In some embodiments, a secreted effector described herein modulates STING/cGAS signaling.
  • the STING modulator is a polypeptide, e.g., a viral polypeptide or a functional variant thereof.
  • the effector may comprise a STING modulator (e.g., inhibitor) described in Maringer et al. “Message in a bottle: lessons learned from antagonism of STING signalling during RNA virus infection” Cytokine & Growth Factor Reviews Volume 25, Issue 6, December 2014, Pages 669- 679, which is incorporated herein by reference in its entirety. Additional STING modulators (e.g., activators) are described, e.g., in Wang et al.
  • peptides include, but are not limited to, fluorescent tag or marker, antigen, peptide therapeutic, synthetic or analog peptide from naturally-bioactive peptide, agonist or antagonist peptide, anti-microbial peptide, a targeting or cytotoxic peptide, a degradation or self-destruction peptide, and degradation or self-destruction peptides.
  • Peptides useful in the invention described herein also include antigen-binding peptides, e.g., antigen binding antibody or antibody-like fragments, such as single chain antibodies, nanobodies (see, e.g., Steeland et al.2016. Nanobodies as therapeutics: big opportunities for small antibodies. Drug Discov Today: 21(7):1076-113).
  • Such antigen binding peptides may bind a cytosolic antigen, a nuclear antigen, or an intra-organellar antigen.
  • the genetic element comprises a sequence that encodes small peptides, peptidomimetics (e.g., peptoids), amino acids, and amino acid analogs.
  • Such therapeutics generally have a molecular weight less than about 5,000 grams per mole, a molecular weight less than about 2,000 grams per mole, a molecular weight less than about 1,000 grams per mole, a molecular weight less than about 500 grams per mole, and salts, esters, and other pharmaceutically acceptable forms of such compounds.
  • Such therapeutics may include, but are not limited to, a neurotransmitter, a hormone, a drug, a toxin, a viral or microbial particle, a synthetic molecule, and agonists or antagonists thereof.
  • the composition or anellovector described herein includes a polypeptide linked to a ligand that is capable of targeting a specific location, tissue, or cell.
  • Gene Editing Components The genetic element of the anellovector may include one or more genes that encode a component of a gene editing system. Exemplary gene editing systems include the clustered regulatory interspaced short palindromic repeat (CRISPR) system, zinc finger nucleases (ZFNs), and Transcription Activator- Like Effector-based Nucleases (TALEN).
  • CRISPR clustered regulatory interspaced short palindromic repeat
  • ZFNs zinc finger nucleases
  • TALEN Transcription Activator- Like Effector-based Nucleases
  • ZFNs, TALENs, and CRISPR-based methods are described, e.g., in Gaj et al. Trends Biotechnol.31.7(2013):397-405; CRISPR methods of gene editing are described, e.g., in Guan et al., Application of CRISPR-Cas system in gene therapy: Pre-clinical progress in animal model. DNA Repair 2016 Oct;46:1-8. doi: 10.1016/j.dnarep.2016.07.004; Zheng et al., Precise gene deletion and replacement using the CRISPR/Cas9 system in human cells. BioTechniques, Vol.57, No.3, September 2014, pp.115–124.
  • CRISPR systems are adaptive defense systems originally discovered in bacteria and archaea.
  • CRISPR systems use RNA-guided nucleases termed CRISPR-associated or “Cas” endonucleases (e. g., Cas9 or Cpf1) to cleave foreign DNA.
  • CRISPR-associated or “Cas” endonucleases e. g., Cas9 or Cpf1
  • an endonuclease is directed to a target nucleotide sequence (e. g., a site in the genome that is to be sequence-edited) by sequence-specific, non-coding “guide RNAs” that target single- or double-stranded DNA sequences.
  • target nucleotide sequence e. g., a site in the genome that is to be sequence-edited
  • guide RNAs target single- or double-stranded DNA sequences.
  • Three classes (I-III) of CRISPR systems have been identified.
  • the class II CRISPR systems use a single Cas endonuclease (rather than multiple Cas proteins).
  • One class II CRISPR system includes a type II Cas endonuclease such as Cas9, a CRISPR RNA (“crRNA”), and a trans-activating crRNA (“tracrRNA”).
  • the crRNA contains a “guide RNA”, typically about 20-nucleotide RNA sequence that corresponds to a target DNA sequence.
  • the crRNA also contains a region that binds to the tracrRNA to form a partially double- stranded structure which is cleaved by RNase III, resulting in a crRNA/tracrRNA hybrid.
  • the crRNA/tracrRNA hybrid then directs the Cas9 endonuclease to recognize and cleave the target DNA sequence.
  • the target DNA sequence must generally be adjacent to a “protospacer adjacent motif” (“PAM”) that is specific for a given Cas endonuclease; however, PAM sequences appear throughout a given genome.
  • PAM protospacer adjacent motif
  • the anellovector includes a gene for a CRISPR endonuclease.
  • CRISPR endonucleases identified from various prokaryotic species have unique PAM sequence requirements; examples of PAM sequences include 5’-NGG (Streptococcus pyogenes), 5’- NNAGAA (Streptococcus thermophilus CRISPR1), 5’-NGGNG (Streptococcus thermophilus CRISPR3), and 5’-NNNGATT (Neisseria meningiditis).
  • Some endonucleases e. g., Cas9 endonucleases, are associated with G-rich PAM sites, e.
  • Cpf1 Another class II CRISPR system includes the type V endonuclease Cpf1, which is smaller than Cas9; examples include AsCpf1 (from Acidaminococcus sp.) and LbCpf1 (from Lachnospiraceae sp.). Cpf1 endonucleases, are associated with T-rich PAM sites, e. g., 5’-TTN. Cpf1 can also recognize a 5’-CTA PAM motif.
  • Cpf1 cleaves the target DNA by introducing an offset or staggered double-strand break with a 4- or 5-nucleotide 5’ overhang, for example, cleaving a target DNA with a 5-nucleotide offset or staggered cut located 18 nucleotides downstream from (3’ from) from the PAM site on the coding strand and 23 nucleotides downstream from the PAM site on the complimentary strand; the 5-nucleotide overhang that results from such offset cleavage allows more precise genome editing by DNA insertion by homologous recombination than by insertion at blunt-end cleaved DNA. See, e. g., Zetsche et al. (2015) Cell, 163:759 – 771.
  • CRISPR associated (Cas) genes may be included in the anellovector. Specific examples of genes are those that encode Cas proteins from class II systems including Cas1, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9, Cas10, Cpf1, C2C1, or C2C3.
  • the anellovector includes a gene encoding a Cas protein, e.g., a Cas9 protein, may be from any of a variety of prokaryotic species.
  • the anellovector includes a gene encoding a particular Cas protein, e.g., a particular Cas9 protein, is selected to recognize a particular protospacer-adjacent motif (PAM) sequence.
  • the anellovector includes nucleic acids encoding two or more different Cas proteins, or two or more Cas proteins, may be introduced into a cell, zygote, embryo, or animal, e.g., to allow for recognition and modification of sites comprising the same, similar or different PAM motifs.
  • the anellovector includes a gene encoding a modified Cas protein with a deactivated nuclease, e.g., nuclease-deficient Cas9.
  • a number of CRISPR endonucleases having modified functionalities are known, for example: a “nickase” version of Cas endonuclease (e.g., Cas9) generates only a single-strand break; a catalytically inactive Cas endonuclease, e.g., Cas9 (“dCas9”) does not cut the target DNA.
  • dCas9 a catalytically inactive Cas endonuclease
  • a gene encoding a dCas9 can be fused with a gene encoding an effector domain to repress (CRISPRi) or activate (CRISPRa) expression of a target gene.
  • the gene may encode a Cas9 fusion with a transcriptional silencer (e.g., a KRAB domain) or a transcriptional activator (e.g., a dCas9–VP64 fusion).
  • a transcriptional silencer e.g., a KRAB domain
  • a transcriptional activator e.g., a dCas9–VP64 fusion
  • a gene encoding a catalytically inactive Cas9 (dCas9) fused to FokI nuclease (“dCas9-FokI”) can be included to generate DSBs at target sequences homologous to two gRNAs. See, e.
  • CRISPR technology for editing the genes of eukaryotes is disclosed in US Patent Application Publications 2016/0138008A1 and US2015/0344912A1, and in US Patents 8,697,359, 8,771,945, 8,945,839, 8,999,641, 8,993,233, 8,895,308, 8,865,406, 8,889,418, 8,871,445, 8,889,356, 8,932,814, 8,795,965, and 8,906,616.
  • Cpf1 endonuclease and corresponding guide RNAs and PAM sites are disclosed in US Patent Application Publication 2016/0208243 A1.
  • the anellovector comprises a gene encoding a polypeptide described herein, e.g., a targeted nuclease, e.g., a Cas9, e.g., a wild type Cas9, a nickase Cas9 (e.g., Cas9 D10A), a dead Cas9 (dCas9), eSpCas9, Cpf1, C2C1, or C2C3, and a gRNA.
  • a targeted nuclease e.g., a Cas9, e.g., a wild type Cas9, a nickase Cas9 (e.g., Cas9 D10A), a dead Cas9 (dCas9), eSpCas9, Cpf1, C2C1, or C2C3, and a gRNA.
  • a targeted nuclease e.g., a Cas9, e.g
  • genes encoding the nuclease and gRNA(s) is determined by whether the targeted mutation is a deletion, substitution, or addition of nucleotides, e.g., a deletion, substitution, or addition of nucleotides to a targeted sequence.
  • Genes that encode a catalytically inactive endonuclease e.g., a dead Cas9 (dCas9, e.g., D10A; H840A) tethered with all or a portion of (e.g., biologically active portion of) an (one or more) effector domain (e.g., VP64) create chimeric proteins that can modulate activity and/or expression of one or more target nucleic acids sequences.
  • the anellovector includes a gene encoding a fusion of a dCas9 with all or a portion of one or more effector domains (e.g., a full-length wild-type effector domain, or a fragment or variant thereof, e.g., a biologically active portion thereof) to create a chimeric protein useful in the methods described herein. Accordingly, in some embodiments, the anellovector includes a gene encoding a dCas9-methylase fusion. In other some embodiments, the anellovector includes a gene encoding a dCas9-enzyme fusion with a site-specific gRNA to target an endogenous gene.
  • effector domains e.g., a full-length wild-type effector domain, or a fragment or variant thereof, e.g., a biologically active portion thereof
  • the anellovector includes a gene encoding 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more effector domains (all or a biologically active portion) fused with dCas9.
  • the genetic element comprises a regulatory sequence, e.g., a promoter or an enhancer, operably linked to the sequence encoding the effector.
  • a promoter may be absent from the genetic element.
  • a genetic element construct comprises a promoter that is used to drive production of the RNA genetic element.
  • a promoter includes a DNA sequence that is located adjacent to a DNA sequence that encodes an expression product.
  • a promoter may be linked operatively to the adjacent DNA sequence.
  • a promoter typically increases an amount of product expressed from the DNA sequence as compared to an amount of the expressed product when no promoter exists.
  • a promoter from one organism can be utilized to enhance product expression from the DNA sequence that originates from another organism.
  • a vertebrate promoter may be used for the expression of jellyfish GFP in vertebrates.
  • one promoter element can enhance the expression of one or more products. Multiple promoter elements are well-known to persons of ordinary skill in the art. In one embodiment, high-level constitutive expression is desired.
  • promoters examples include, without limitation, the retroviral Rous sarcoma virus (RSV) long terminal repeat (LTR) promoter/enhancer, the cytomegalovirus (CMV) immediate early promoter/enhancer (see, e.g., Boshart et al, Cell, 41:521-530 (1985)), the SV40 promoter, the dihydrofolate reductase promoter, the cytoplasmic .beta.-actin promoter and the phosphoglycerol kinase (PGK) promoter.
  • RSV Rous sarcoma virus
  • LTR long terminal repeat
  • CMV cytomegalovirus immediate early promoter/enhancer
  • SV40 promoter the SV40 promoter
  • dihydrofolate reductase promoter the cytoplasmic .beta.-actin promoter
  • PGK phosphoglycerol kinase
  • inducible promoters may be desired.
  • Inducible promoters are those which are regulated by exogenously supplied compounds, e.g., provided either in cis or in trans, including without limitation, the zinc-inducible sheep metallothionine (MT) promoter; the dexamethasone (Dex)-inducible mouse mammary tumor virus (MMTV) promoter; the T7 polymerase promoter system (WO 98/10088); the tetracycline-repressible system (Gossen et al, Proc. Natl. Acad. Sci.
  • MT zinc-inducible sheep metallothionine
  • Dex dexamethasone
  • MMTV mouse mammary tumor virus
  • T7 polymerase promoter system WO 98/10088
  • inducible promoters which may be useful in this context are those which are regulated by a specific physiological state, e.g., temperature, acute phase, or in replicating cells only.
  • a native promoter for a gene or nucleic acid sequence of interest is used.
  • the native promoter may be used when it is desired that expression of the gene or the nucleic acid sequence should mimic the native expression.
  • the native promoter may be used when expression of the gene or other nucleic acid sequence must be regulated temporally or developmentally, or in a tissue- specific manner, or in response to specific transcriptional stimuli.
  • other native expression control elements such as enhancer elements, polyadenylation sites or Kozak consensus sequences may also be used to mimic the native expression.
  • the genetic element comprises a gene operably linked to a tissue-specific promoter.
  • a promoter active in muscle may be used. These include the promoters from genes encoding skeletal ⁇ -actin, myosin light chain 2A, dystrophin, muscle creatine kinase, as well as synthetic muscle promoters with activities higher than naturally-occurring promoters. See Li et al., Nat. Biotech., 17:241-245 (1999). Examples of promoters that are tissue-specific are known for liver albumin, Miyatake et al. J.
  • the genetic element construct may include an enhancer, e.g., a DNA sequence that is located adjacent to the DNA sequence that encodes a gene.
  • Enhancer elements are typically located upstream of a promoter element or can be located downstream of or within a coding DNA sequence (e.g., a DNA sequence transcribed or translated into a product or products). Hence, an enhancer element can be located 100 base pairs, 200 base pairs, or 300 or more base pairs upstream or downstream of a DNA sequence that encodes the product. Enhancer elements can increase an amount of recombinant product expressed from a DNA sequence above increased expression afforded by a promoter element. Multiple enhancer elements are readily available to persons of ordinary skill in the art.
  • the genetic element comprises one or more inverted terminal repeats (ITR) flanking the sequences encoding the expression products described herein.
  • ITR inverted terminal repeats
  • the genetic element comprises one or more long terminal repeats (LTR) flanking the sequence encoding the expression products described herein.
  • LTR long terminal repeats
  • promoter sequences include, but are not limited to, the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, and a Rous sarcoma virus promoter.
  • the genetic element further includes a nucleic acid encoding a product (e.g., a ribozyme, a therapeutic mRNA encoding a protein, an exogenous gene).
  • a product e.g., a ribozyme, a therapeutic mRNA encoding a protein, an exogenous gene.
  • the genetic element includes one or more sequences that affect species and/or tissue and/or cell tropism (e.g. capsid protein sequences), infectivity (e.g. capsid protein sequences), immunosuppression/activation (e.g.
  • the genetic element may comprise other sequences that include DNA, RNA, or artificial nucleic acids.
  • the other sequences may include, but are not limited to, genomic DNA, cDNA, or sequences that encode tRNA, mRNA, rRNA, miRNA, gRNA, siRNA, or other RNAi molecules.
  • the genetic element includes a sequence encoding an siRNA to target a different loci of the same gene expression product as the regulatory nucleic acid. In one embodiment, the genetic element includes a sequence encoding an siRNA to target a different gene expression product as the regulatory nucleic acid.
  • the genetic element further comprises one or more of the following sequences: a sequence that encodes one or more miRNAs, a sequence that encodes one or more replication proteins, a sequence that encodes an exogenous gene, a sequence that encodes a therapeutic, a regulatory sequence (e.g., a promoter, enhancer), a sequence that encodes one or more regulatory sequences that targets endogenous genes (siRNA, lncRNAs, shRNA), and a sequence that encodes a therapeutic mRNA or protein.
  • the other sequences may have a length from about 2 to about 5000 nts, about 10 to about 100 nts, about 50 to about 150 nts, about 100 to about 200 nts, about 150 to about 250 nts, about 200 to about 300 nts, about 250 to about 350 nts, about 300 to about 500 nts, about 10 to about 1000 nts, about 50 to about 1000 nts, about 100 to about 1000 nts, about 1000 to about 2000 nts, about 2000 to about 3000 nts, about 3000 to about 4000 nts, about 4000 to about 5000 nts, or any range therebetween.
  • the genetic element may include a gene associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide.
  • a signaling biochemical pathway-associated gene or polynucleotide examples include a disease associated gene or polynucleotide.
  • a “disease-associated” gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cells of a non disease control. It may be a gene that becomes expressed at an abnormally high level; it may be a gene that becomes expressed at an abnormally low level, where the altered expression correlates with the occurrence and/or progression of the disease.
  • a disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease.
  • diseases-associated genes and polynucleotides are available from McKusick-Nathans Institute of Genetic Medicine, Johns Hopkins University (Baltimore, Md.) and National Center for Biotechnology Information, National Library of Medicine (Bethesda, Md.). Examples of disease- associated genes and polynucleotides are listed in Tables A and B of US Patent No.: 8,697,359, which are herein incorporated by reference in their entirety.
  • the genetic elements can encode targeting moieties, as described elsewhere herein. This can be achieved, e.g., by inserting a polynucleotide encoding a sugar, a glycolipid, or a protein, such as an antibody. Those skilled in the art know additional methods for generating targeting moieties.
  • the genetic element comprises at least one viral sequence.
  • the sequence has homology or identity to one or more sequence from a single stranded DNA virus, e.g., Anellovirus, Bidnavirus, Circovirus, Geminivirus, Genomovirus, Inovirus, Microvirus, Nanovirus, Parvovirus, and Spiravirus.
  • the sequence has homology or identity to one or more sequence from a double stranded DNA virus, e.g., Adenovirus, Ampullavirus, Ascovirus, Asfarvirus, Baculovirus, Fusellovirus, Globulovirus, Guttavirus, Hytrosavirus, Herpesvirus, Iridovirus, Lipothrixvirus, Nimavirus, and Poxvirus.
  • the sequence has homology or identity to one or more sequence from an RNA virus, e.g., Alphavirus, Furovirus, Hepatitis virus, Hordeivirus, Tobamovirus, Tobravirus, Tricornavirus, Rubivirus, Birnavirus, Cystovirus, Partitivirus, and Reovirus.
  • the genetic element may comprise one or more sequences from a non- pathogenic virus, e.g., a symbiotic virus, e.g., a commensal virus, e.g., a native virus, e.g., an Anellovirus.
  • a non- pathogenic virus e.g., a symbiotic virus, e.g., a commensal virus, e.g., a native virus, e.g., an Anellovirus.
  • TT Alphatorquevirus
  • Betatorquevirus TTM
  • TTMD Gammatorquevirus
  • the genetic element may comprise a sequence with homology or identity to a Torque Teno Virus (TT), a non-enveloped, single-stranded DNA virus with a circular, negative-sense genome.
  • TT Torque Teno Virus
  • the genetic element may comprise a sequence with homology or identity to a SEN virus, a Sentinel virus, a TTV-like mini virus, and a TT virus.
  • TT viruses Different types have been described including TT virus genotype 6, TT virus group, TTV-like virus DXL1, and TTV-like virus DXL2.
  • the genetic element may comprise a sequence with homology or identity to a smaller virus, Torque Teno-like Mini Virus (TTM), or a third virus with a genomic size in between that of TTV and TTMV, named Torque Teno-like Midi Virus (TTMD).
  • TTM Torque Teno-like Mini Virus
  • TTMD Torque Teno-like Midi Virus
  • the genetic element may comprise one or more sequences or a fragment of a sequence from a non-pathogenic virus having at least about 60%, 70% 80%, 85%, 90% 95%, 96%, 97%, 98% and 99% nucleotide sequence identity to any one of the nucleotide sequences described herein.
  • the genetic element may comprise one or more sequences or a fragment of a sequence from a substantially non-pathogenic virus having at least about 60%, 70% 80%, 85%, 90% 95%, 96%, 97%, 98% and 99% nucleotide sequence identity to any one of the nucleotide sequences described herein, e.g., Table 41.
  • Table 41 Examples of Anelloviruses and their sequences. Accessions numbers and related sequence information may be obtained at www.ncbi.nlm.nih.gov/genbank/, as referenced on December 11, 2018.
  • the genetic element comprises one or more sequences with homology or identity to one or more sequences from one or more non-Anelloviruses, e.g., adenovirus, herpes virus, pox virus, vaccinia virus, SV40, papilloma virus, an RNA virus such as a retrovirus, e.g., lentivirus, a single- stranded RNA virus, e.g., hepatitis virus, or a double-stranded RNA virus e.g., rotavirus.
  • non-Anelloviruses e.g., adenovirus, herpes virus, pox virus, vaccinia virus, SV40, papilloma virus
  • an RNA virus such as a retrovirus, e.g., lentivirus, a single- stranded RNA virus, e.g., hepatitis virus, or a double-stranded RNA virus e.g.
  • helper cell lines that contain plasmids encoding all of the structural genes of the retrovirus under the control of regulatory sequences within the LTR.
  • Suitable cell lines for replicating the anellovectors described herein include cell lines known in the art, e.g., A549 cells, which can be modified as described herein.
  • Said genetic element can additionally contain a gene encoding a selectable marker so that the desired genetic elements can be identified.
  • the genetic element includes non-silent mutations, e.g., base substitutions, deletions, or additions resulting in amino acid differences in the encoded polypeptide, so long as the sequence remains at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the polypeptide encoded by the first nucleotide sequence or otherwise is useful for practicing the present invention.
  • non-silent mutations e.g., base substitutions, deletions, or additions resulting in amino acid differences in the encoded polypeptide, so long as the sequence remains at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the polypeptide encoded by the first nucleotide sequence or otherwise is useful for practicing the present invention.
  • certain conservative amino acid substitutions may be made which are generally recognized not to inactivate overall protein function: such as in regard of positively charged amino acids (and vice versa), lysine, arginine and histidine; in regard of negatively charged amino acids (and vice versa), aspartic acid and glutamic acid; and in regard of certain groups of neutrally charged amino acids (and in all cases, also vice versa), (1) alanine and serine, (2) asparagine, glutamine, and histidine, (3) cysteine and serine, (4) glycine and proline, (5) isoleucine, leucine and valine, (6) methionine, leucine and isoleucine, (7) phenylalanine, methionine, leucine, and tyrosine, (8) serine and threonine, (9) tryptophan and tyrosine, (10) and for example tyrosine, tryptophan and phenylalanine.
  • Amino acids can be classified according to physical properties and contribution to secondary and tertiary protein structure.
  • a conservative substitution is recognized in the art as a substitution of one amino acid for another amino acid that has similar properties.
  • Identity of two or more nucleic acid or polypeptide sequences having the same or a specified percentage of nucleotides or amino acid residues that are the same e.g., about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region
  • Identity may also refer to, or may be applied to, the compliment of a test sequence. Identity also includes sequences that have deletions and/or additions, as well as those that have substitutions. As described herein, the algorithms account for gaps and the like. Identity may exist over a region that is at least about 10 amino acids or nucleotides in length, about 15 amino acids or nucleotides in length, about 20 amino acids or nucleotides in length, about 25 amino acids or nucleotides in length, about 30 amino acids or nucleotides in length, about 35 amino acids or nucleotides in length, about 40 amino acids or nucleotides in length, about 45 amino acids or nucleotides in length, about 50 amino acids or nucleotides in length, or more.
  • the anellovector e.g., synthetic anellovector
  • the anellovector comprises a proteinaceous exterior that encloses the genetic element.
  • the proteinaceous exterior can comprise a substantially non- pathogenic exterior protein that fails to elicit an unwanted immune response in a mammal.
  • the proteinaceous exterior of the anellovectors typically comprises a substantially non-pathogenic protein that may self-assemble into an icosahedral formation that makes up the proteinaceous exterior.
  • the proteinaceous exterior protein is encoded by a sequence of the genetic element of the anellovector (e.g., is in cis with the genetic element). In other embodiments, the proteinaceous exterior protein is encoded by a nucleic acid separate from the genetic element of the anellovector (e.g., is in trans with the genetic element). In some embodiments, the protein, e.g., substantially non-pathogenic protein and/or proteinaceous exterior protein, comprises one or more glycosylated amino acids, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, or more.
  • the protein e.g., substantially non-pathogenic protein and/or proteinaceous exterior protein comprises at least one hydrophilic DNA-binding region, an arginine-rich region, a threonine-rich region, a glutamine-rich region, a N-terminal polyarginine sequence, a variable region, a C-terminal polyglutamine/glutamate sequence, and one or more disulfide bridges.
  • the protein is a capsid protein, e.g., has a sequence having at least about 60%, 65%, 70%, 75%, 80%, 85%, 90% 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a protein encoded by any one of the nucleotide sequences encoding a capsid protein described herein, e.g., an Anellovirus ORF1 molecule and/or capsid protein sequence, e.g., as described herein.
  • the protein or a functional fragment of a capsid protein is encoded by a nucleotide sequence having at least about 60%, 70% 80%, 85%, 90% 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus ORF1 nucleic acid, e.g., as described herein.
  • the anellovector comprises a nucleotide sequence encoding a capsid protein or a functional fragment of a capsid protein or a sequence having at least about 60%, 70% 80%, 85%, 90% 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus ORF1 molecule as described herein.
  • the ranges of amino acids with less sequence identity may provide one or more of the properties described herein and differences in cell/tissue/species specificity (e.g. tropism).
  • the anellovector lacks lipids in the proteinaceous exterior.
  • the anellovector lacks a lipid bilayer, e.g., a viral envelope.
  • the interior of the anellovector is entirely covered (e.g., 100% coverage) by a proteinaceous exterior.
  • the interior of the anellovector is less than 100% covered by the proteinaceous exterior, e.g., 95%, 90%, 85%, 80%, 70%, 60%, 50% or less coverage.
  • the proteinaceous exterior comprises gaps or discontinuities, e.g., permitting permeability to water, ions, peptides, or small molecules, so long as the genetic element is retained in the anellovector.
  • the proteinaceous exterior comprises one or more proteins or polypeptides that specifically recognize and/or bind a host cell, e.g., a complementary protein or polypeptide, to mediate entry of the genetic element into the host cell.
  • the proteinaceous exterior comprises one or more of the following: an arginine-rich region, jelly-roll region, N22 domain, hypervariable region, and/or C-terminal domain, e.g., of an ORF1 molecule, e.g., as described herein.
  • the proteinaceous exterior comprises one or more of the following: one or more glycosylated proteins, a hydrophilic DNA-binding region, an arginine-rich region, a threonine-rich region, a glutamine-rich region, a N-terminal polyarginine sequence, a variable region, a C-terminal polyglutamine/glutamate sequence, and one or more disulfide bridges.
  • the proteinaceous exterior comprises a protein encoded by an Anellovirus ORF1 nucleic acid, e.g., as described herein.
  • the proteinaceous exterior comprises one or more of the following characteristics: an icosahedral symmetry, recognizes and/or binds a molecule that interacts with one or more host cell molecules to mediate entry into the host cell, lacks lipid molecules, lacks carbohydrates, is pH and temperature stable, is detergent resistant, and is substantially non-immunogenic or non-pathogenic in a host. III.
  • the anellovectors and compositions comprising anellovectors described herein may be used in methods of treating a disease, disorder, or condition, e.g., in a subject (e.g., a mammalian subject, e.g., a human subject) in need thereof.
  • Administration of a pharmaceutical composition described herein may be, for example, by way of parenteral (including intravenous, intratumoral, intraperitoneal, intramuscular, intracavity, and subcutaneous) administration.
  • the anellovectors may be administered alone or formulated as a pharmaceutical composition.
  • the anellovectors may be administered in the form of a unit-dose composition, such as a unit dose parenteral composition.
  • compositions are generally prepared by admixture and can be suitably adapted for parenteral administration.
  • Such compositions may be, for example, in the form of injectable and infusable solutions or suspensions or suppositories or aerosols.
  • administration of an anellovector or composition comprising same may result in delivery of a genetic element comprised by the anellovector to a target cell, e.g., in a subject.
  • An anellovector or composition thereof described herein, e.g., comprising an effector (e.g., an endogenous or exogenous effector), may be used to deliver the effector to a cell, tissue, or subject.
  • the anellovector or composition thereof is used to deliver the effector to bone marrow, blood, heart, GI or skin. Delivery of an effector by administration of an anellovector composition described herein may modulate (e.g., increase or decrease) expression levels of a noncoding RNA or polypeptide in the cell, tissue, or subject. Modulation of expression level in this fashion may result in alteration of a functional activity in the cell to which the effector is delivered. In some embodiments, the modulated functional activity may be enzymatic, structural, or regulatory in nature.
  • the anellovector, or copies thereof are detectable in a cell 24 hours (e.g., 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 30 days, or 1 month) after delivery into a cell.
  • a anellovector or composition thereof mediates an effect on a target cell, and the effect lasts for at least 1, 2, 3, 4, 5, 6, or 7 days, 2, 3, or 4 weeks, or 1, 2, 3, 6, or 12 months.
  • the effect lasts for less than 1, 2, 3, 4, 5, 6, or 7 days, 2, 3, or 4 weeks, or 1, 2, 3, 6, or 12 months.
  • diseases, disorders, and conditions that can be treated with the anellovector described herein, or a composition comprising the anellovector, include, without limitation: immune disorders, interferonopathies (e.g., Type I interferonopathies), infectious diseases, inflammatory disorders, autoimmune conditions, cancer (e.g., a solid tumor, e.g., lung cancer, non-small cell lung cancer, e.g., a tumor that expresses a gene responsive to mIR-625, e.g., caspase-3), and gastrointestinal disorders.
  • the anellovector modulates (e.g., increases or decreases) an activity or function in a cell with which the anellovector is contacted.
  • the anellovector modulates (e.g., increases or decreases) the level or activity of a molecule (e.g., a nucleic acid or a protein) in a cell with which the anellovector is contacted.
  • a molecule e.g., a nucleic acid or a protein
  • the anellovector decreases viability of a cell, e.g., a cancer cell, with which the anellovector is contacted, e.g., by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, or more.
  • the anellovector comprises an effector, e.g., an miRNA, e.g., miR-625, that decreases viability of a cell, e.g., a cancer cell, with which the anellovector is contacted, e.g., by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, or more.
  • an effector e.g., an miRNA, e.g., miR-625
  • the anellovector increases apoptosis of a cell, e.g., a cancer cell, e.g., by increasing caspase-3 activity, with which the anellovector is contacted, e.g., by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, or more.
  • the anellovector comprises an effector, e.g., an miRNA, e.g., miR-625, that increases apoptosis of a cell, e.g., a cancer cell, e.g., by increasing caspase-3 activity, with which the anellovector is contacted, e.g., by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, or more.
  • the composition e.g., a pharmaceutical composition comprising an anellovector as described herein
  • Pharmaceutical compositions may optionally comprise one or more additional active substances, e.g.
  • compositions of the present invention may be sterile and/or pyrogen-free. General considerations in the formulation and/or manufacture of pharmaceutical agents may be found, for example, in Remington: The Science and Practice of Pharmacy 21st ed., Lippincott Williams & Wilkins, 2005 (incorporated herein by reference). Although the descriptions of pharmaceutical compositions provided herein are principally directed to pharmaceutical compositions which are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to any other animal, e.g., to non-human animals, e.g. non-human mammals.
  • compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with merely ordinary, if any, experimentation.
  • Subjects to which administration of the pharmaceutical compositions is contemplated include, but are not limited to, humans and/or other primates; mammals, including commercially relevant mammals such as cattle, pigs, horses, sheep, cats, dogs, mice, and/or rats; and/or birds, including commercially relevant birds such as poultry, chickens, ducks, geese, and/or turkeys.
  • Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology.
  • such preparatory methods include the step of bringing the active ingredient into association with an excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, dividing, shaping and/or packaging the product.
  • the invention features a method of delivering an anellovector to a subject.
  • the method includes administering a pharmaceutical composition comprising an anellovector as described herein to the subject.
  • the administered anellovector replicates in the subject (e.g., becomes a part of the virome of the subject).
  • the pharmaceutical composition may include wild-type or native viral elements and/or modified viral elements.
  • the anellovector may include one or more Anellovirus sequences (e.g., nucleic acid sequences or nucleic acid sequences encoding amino acid sequences thereof) or a sequence with at least about 60%, 65%, 70%, 75%, 80%, 85%, 90% 95%, 96%, 97%, 98% and 99% nucleotide sequence identity thereto.
  • the anellovector may comprise a nucleic acid molecule comprising a nucleic acid sequence with at least about 60%, 65%, 70%, 75%, 80%, 85%, 90% 95%, 96%, 97%, 98% and 99% sequence identity to one or more Anellovirus sequences (e.g., an Anellovirus ORF1 nucleic acid sequence).
  • the anellovector may comprise a nucleic acid molecule encoding an amino acid sequence with at least about 60%, 65%, 70%, 75%, 80%, 85%, 90% 95%, 96%, 97%, 98% and 99% sequence identity to an Anellovirus amino acid sequence (e.g., the amino acid sequence of an Anellovirus ORF1 molecule).
  • the anellovector may comprise a polypeptide comprising an amino acid sequence with at least about 60%, 65%, 70%, 75%, 80%, 85%, 90% 95%, 96%, 97%, 98% and 99% sequence identity to an Anellovirus amino acid sequence (e.g., the amino acid sequence of an Anellovirus ORF1 molecule).
  • the anellovector is sufficient to increase (stimulate) endogenous gene and protein expression, e.g., at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, or more as compared to a reference, e.g., a healthy control. In certain embodiments, the anellovector is sufficient to decrease (inhibit) endogenous gene and protein expression, e.g., at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, or more as compared to a reference, e.g., a healthy control.
  • the anellovector inhibits/enhances one or more viral properties, e.g., tropism, infectivity, immunosuppression/activation, in a host or host cell, e.g., at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, or more as compared to a reference, e.g., a healthy control.
  • the subject is administered the pharmaceutical composition further comprising one or more viral strains that are not represented in the viral genetic information.
  • the pharmaceutical composition comprising an anellovector described herein is administered in a dose and time sufficient to modulate a viral infection.
  • viral infections include adeno-associated virus, Aichi virus, Australian bat lyssavirus, BK polyomavirus, Banna virus, Barmah forest virus, Bunyamwera virus, Bunyavirus La Crosse, Bunyavirus snowshoe hare, Cercopithecine herpesvirus, Chandipura virus, Chikungunya virus, Cosavirus A, Cowpox virus, Coxsackievirus, Crimean-Congo hemorrhagic fever virus, Dengue virus, Dhori virus, Dugbe virus, Duvenhage virus, Eastern equine encephalitis virus, Ebolavirus, Echovirus, Encephalomyocarditis virus, Epstein-Barr virus, European bat lyssavirus, GB virus C/Hepatitis G virus, Hantaan virus, Hendra virus, Hepatitis A virus, Hepatitis B virus, Hepatitis C virus, Hepatitis E virus, Hepatitis delta virus, Horse
  • louis encephalitis virus Tick- borne powassan virus, Torque teno virus, Toscana virus, Uukuniemi virus, Vaccinia virus, Varicella- zoster virus, Variola virus, Venezuelan equine encephalitis virus, Vesicular stomatitis virus, Western equine encephalitis virus, WU polyomavirus, West Nile virus, Yaba monkey tumor virus, Yaba-like disease virus, Yellow fever virus, and Zika Virus.
  • the anellovector is sufficient to outcompete and/or displace a virus already present in the subject, e.g., at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, or more as compared to a reference. In certain embodiments, the anellovector is sufficient to compete with chronic or acute viral infection. In certain embodiments, the anellovector may be administered prophylactically to protect from viral infections (e.g. a provirotic). In some embodiments, the anellovector is in an amount sufficient to modulate (e.g., phenotype, virus levels, gene expression, compete with other viruses, disease state, etc.
  • treatment, treating, and cognates thereof comprise medical management of a subject (e.g., by administering an anellovector, e.g., an anellovector made as described herein), e.g., with the intent to improve, ameliorate, stabilize, prevent or cure a disease, pathological condition, or disorder.
  • an anellovector e.g., an anellovector made as described herein
  • treatment comprises active treatment (treatment directed to improve the disease, pathological condition, or disorder), causal treatment (treatment directed to the cause of the associated disease, pathological condition, or disorder), palliative treatment (treatment designed for the relief of symptoms), preventative treatment (treatment directed to preventing, minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder), and/or supportive treatment (treatment employed to supplement another therapy).
  • active treatment treatment directed to improve the disease, pathological condition, or disorder
  • causal treatment treatment directed to the cause of the associated disease, pathological condition, or disorder
  • palliative treatment treatment designed for the relief of symptoms
  • preventative treatment treatment directed to preventing, minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder
  • supportive treatment treatment employed to supplement another therapy.
  • Example 1 In vitro assembly of anellovectors using ORF1 produced using baculovirus
  • Example 2 In vitro assembly of Ring2 ORF1-based anellovectors encapsidating mRNA
  • Example 3 In vitro assembly of an mRNA-encapsidating anellovector using a modified ORF1 protein
  • Example 4 In vitro assembly of an mRNA-encapsidating anellovector using a modified mRNA
  • Example 5 Structural analysis of anellovirus ORF1 capsid proteins
  • Example 1 In vitro assembly of anellovectors using ORF1 produced using baculovirus
  • baculovirus constructs suitable for expression of Anellovirus proteins (e.g., ORF1) were generated by in vitro assembly.
  • DNA encoding Ring2 ORF1 fused to an N-terminal HIS 6 -tag was codon optimized for insect expression and cloned into the baculovirus expression vector pFASTbac system according to manufacturer instructions (ThermoFisher Scientific).10 liters of insect cell culture (Sf9) was infected with Ring2 HIS-ORF1 baculovirus and the cells were harvested 3-days post-infection by centrifugation. The cells were lysed and the lysis was purified using a chelating resin column using standard methods in the field. The elution fraction containing HIS-ORF1 was dialyzed and treated with DNAse to digest host cell DNA.
  • CAV chicken anemia virus
  • Vp1 capsid protein fused to an N-terminal HIS6-Flag-tag (HIS-Flag-Vp1) and helper protein (Vp2) were codon optimized for mammalian expression and cloned into a mammalian expression vector using a CMV promoter.
  • Mammalian cells (293expi) were transfected with CAV Vp1 and Vp2 expression vectors. The cells were harvested 3-days post-infection by centrifugation. The cells were lysed and the lysis was purified using a the chelation and heparin purification process. The elution fraction containing Chicken Anemia Virus (CAV) Vp1 were analyzed by negative staining electron microscopy. As shown in FIG. 1, both Ring 2 ORF1 and Ring 10 ORF1 showed a propensity to form ⁇ 35 nm virus-like particles.
  • CAV Chicken Anemia Virus
  • Nucleic acid encapsidation and viral vector purification Ring ORF1 (wildtype protein, chimeric protein, or fragments thereof) will be treated with conditions sufficient to dissociate VLPs or viral capsids to enable reassembly with nucleic acid cargo.
  • Nucleic acid cargo can be defined, for example, RNA which encodes a gene of interest that one wants to deliver as a therapeutic agent.
  • Nucleic acid cargo of defined concentration will be combined with Ring ORF1 of defined concentration and treated with conditions sufficient to permit nucleic acid encapsidation and the resulting particle, defined as viral vector, will be subsequently purified using standard viral purification procedures.
  • Example 2 In vitro assembly of Ring2 ORF1-based anellovectors encapsidating mRNA Ring2 ORF1 is purified by size exclusion chromatography (SEC) with mobile phases including Tris pH 8.0 with 500 mM NaCl, Tris pH 8.0 with 500 mM NaCl with 0.1% SDS, CAPS buffer pH 10.5 with 150 mM NaCl, CAPS buffer pH 10.5 with 500 mM NaCl or CAPS buffer pH 10.5 with 500 mM NaCl with 0.1% SDS to dissociate viral particles or VLPs into dispersed protein or capsomers.
  • SEC size exclusion chromatography
  • the ORF1 is mixed with mRNA, a fluorescently labeled mRNA or an mRNA transgene chemically conjugated to a segment of ssDNA shown in Example 1 to be competent for inducing vector formation.
  • Viral vectors are formed through dialysis and SEC purification using Tris pH 8.0 buffer to isolate the anellovector encapsidating RNA (e.g., as measured by retained fluorescent absorption).
  • Anellovector assembly is further evaluated by biophysical assessment such as DLS or electron microscopy.
  • purified ORF1 is treated with 1 M NaCl with 0.1% SDS dissociate oligomers or VLPs into dispersed protein or capsomers.
  • ORF1 is then mixed with mRNA, such as an mRNA that translate a gene of interest (e.g., a reporter gene, e.g., GFP, mCherry; or an effector of interest, e.g., EPO), and dialyzed against Tris pH 8.0 with 150 mM NaCl to permit VLP formation.
  • mRNA such as an mRNA that translate a gene of interest (e.g., a reporter gene, e.g., GFP, mCherry; or an effector of interest, e.g., EPO)
  • mRNA such as an mRNA that translate a gene of interest (e.g., a reporter gene, e.g., GFP, mCherry; or an effector of interest, e.g., EPO)
  • Tris pH 8.0 buffer to isolate the AV vector encapsidating mRNA.
  • Anellovector vector assembly may be further evaluated by in vitro or in vivo readout, for example, by transducing cells and observing the expression of the reporter gene (e.g., mCherry or GFP) or through expression of an effector of interest (e.g., using an ELISA to detect the expression of a gene, such as EPO).
  • the reporter gene e.g., mCherry or GFP
  • an effector of interest e.g., using an ELISA to detect the expression of a gene, such as EPO.
  • Ring2 ORF1-based Anellovectors encapsidating GFP mRNA
  • Ring2 ORF1 protein was expressed as a full-length protein in insect cells and assembled VLPs were purified by a heparin affinity column followed by size exclusion chromatography (SEC) using a Tris buffer mobile phase.
  • VLPs formed from the isolated Ring2 ORF1 proteins were observed with negative staining electron microscopy (EM) and had an estimated particle titer of 10 10 particles/ml (pts/ml; FIG.4A).
  • the VLPs were treated with 2 molar (2M) urea to disassemble the VLPs. Reimaging by EM showed no VLPs observed (FIG.4B).
  • Urea-treated VLPs were then dialyzed to remove urea either in the absence of mRNA (FIG.4C) or in the presence of ⁇ 10x excess mRNA encoding GFP (FIGS.4D and 4E).
  • Example 3 In vitro assembly of an mRNA-encapsidating anellovector using a modified ORF1 protein
  • packaging of an mRNA genetic element is improved by modifying the ORF1 protein to harbor contact residues that bind mRNA.
  • ssDNA contact residues and/or jellyroll beta strands that contact ssDNA and/or the N-terminal arginine-rich motif (ARM) can be replaced with components of an mRNA binding viral protein or other mRNA-binding protein to permit efficient binding and packaging of mRNA.
  • This mRNA-binding chimeric ORF1 is then treated with 1 M NaCl with 0.1% SDS to dissociate oligomers or VLPs into dispersed protein or capsomers.
  • the chimeric ORF1 is then mixed with mRNA, such as an mRNA that encodes a gene of interest (e.g., a reporter gene, e.g., GFP, mCherry; or an effector of interest, e.g., EPO), and dialyzed against Tris pH 8.0 with 150 mM NaCl to permit VLP formation.
  • mRNA such as an mRNA that encodes a gene of interest (e.g., a reporter gene, e.g., GFP, mCherry; or an effector of interest, e.g., EPO)
  • a gene of interest e.g., a reporter gene, e.g., GFP, mCherry
  • EPO effector of interest
  • Anellovector assembly can be further evaluated by in vitro or in vivo readout, for example, by transducing cells and observing the expression of the reporter gene (e.g., mCherry or GFP) or through expression of an effector of interest (such as using an ELISA to detect the expression of a gene such as EPO).
  • the reporter gene e.g., mCherry or GFP
  • an effector of interest such as using an ELISA to detect the expression of a gene such as EPO.
  • Ring ORF1 molecules that may be used in the methods described herein include, for example, several wildtype Anellovirus ORF1 proteins; CAV capsid protein (VP1) variants; Anellovirus ORF1 proteins harboring mutations to improve assembly efficiency, yield or stability; and chimeric ORF1 strains or functional fragments thereof.
  • affinity tags are attached to the ORF1 molecule, e.g., at the N-terminus (SEQ ID NOs: 561-562).
  • the ORF1 molecules are untagged proteins.
  • Ring ORF1 molecules may be expressed alone or in combination with any number of helper proteins including, but not limited to, Anellovirus ORF2 and/or ORF3 proteins.
  • Ring ORF1 proteins harboring mutations to improve assembly efficiency may include, but are not limited to, ORF1 proteins that harbor mutations introduced into the N-terminal arginine-rich motif (ARM), for example, to alter the pI of the ARG arm, which may permit pH sensitive nucleic acid binding to trigger particle assembly (SEQ ID NOs: 563-565).
  • ARM N-terminal arginine-rich motif
  • ORF1 mutations that improve stability may include, for example, mutations to the interprotomer contacting beta strands F and G of the canonical jellyroll beta-barrel (F and G beta strands), e.g., to alter the hydrophobic state of the protomer surface and/or to make capsid formation more thermodynamically favored.
  • Chimeric ORF1 proteins may include, but are not limited to, ORF1 proteins which have a portion or portions of their sequence replaced with comparable portions from another capsid protein, such as BFDV capsid protein, Hepatitis E capsid protein (e.g., the ARG arm and/or F and G beta strands, or comparable components thereof).
  • Chimeric ORF1 proteins may also include ORF1 proteins which have a portion or portions of their sequence replaced with comparable portions of another Anellovirus ORF1 protein (such as jelly roll fragments or the C-terminal portion of Ring 2 ORF1 replaced with comparable portions of Ring 9 ORF1; see, e.g., SEQ ID NOs: 568-575).
  • ORF1 molecules can be purified using purification techniques including, but not limited to, chelating purification, heparin purification, gradient sedimentation purification and/or SEC purification.
  • Example 4 In vitro assembly of an mRNA-encapsidating anellovector using a modified mRNA
  • encapsidation of an mRNA-based genetic element is optimized by binding the mRNA molecule to ssDNA or by modifying the mRNA transgene in such a way that that a section of the backbone would permit binding to the ssDNA contact residues of wildtype ORF1.
  • the mRNA generally encodes a gene of interest, such as a reporter gene (e.g., GFP or mCherry), and/or an effector gene (e.g., EPO).
  • modified ssDNA that can bind ORF1 by virtue of its sugar-chain backbone, but which can also pair with mRNA non-covalently, is mixed with an mRNA of interest to produce an mRNA/DNA complex.
  • This mRNA/DNA complex can then be encapsidated using a Ring ORF1 to form an anellovector, for example, as described below.
  • an mRNA molecule is synthesized with a section or sections of the mRNA molecule harboring a DNA backbone permitting binding and encapsidation with ORF1, while retaining the portion of the mRNA that encodes a gene (e.g., a reporter gene or an effector gene) to be delivered.
  • a gene e.g., a reporter gene or an effector gene
  • This mRNA/DNA hybrid molecule can then be encapsidated using a Ring ORF1 to form an anellovector, for example, as described below.
  • Encapsidation by in vitro assembly The mRNA/DNA genetic elements described above are then encapsidated by in vitro assembly. Briefly, anellovector ORF1 is then treated with 1 M NaCl with 0.1% SDS to dissociate oligomers or VLPs into dispersed protein or capsomers. The ORF1 is then mixed with the synthetic mRNA complexes or hybrid molecules and dialyzed against Tris pH 8.0 with 150 mM NaCl to permit VLP formation.
  • the subsequent particle is purified by SEC using Tris pH 8.0 buffer to isolate the anellovector encapsidating mRNA.
  • Anellovector assembly could be further evaluated by in vitro or in vivo readout by transducing cells and observing the expression of the reporter gene or effector gene, e.g., as described herein.
  • Example 5 Structural analysis of anellovirus ORF1 capsid proteins Anelloviruses share predicted structural features to other well-characterized viruses such as the avian pathogens Beak and Feather Disease Virus (BFDV) or Chicken Anemia Virus (CAV).
  • Anellovirus ORF1 capsid proteins contain an N-terminal ARM sequence similar to that of BFDV.
  • Bolded and underlined text indicates a sequence comprising a His6 tag (HHHHHH) used for chelating purification and a Flag tag (DYKDDDDK), a strong epitope used, e.g., for Western blot detection of low-expressing proteins.
  • Bolded and italicized sequences indicate Ring9 ORF1 sequence or portions thereof.
  • Unbolded, non- underlined sequences are Ring2 sequences or portions thereof.
  • Unbolded, underlined sequences are from Beak and Feather Disease Virus (BFDV).
  • Gray highlighting indicates the positions of lysine-to-histidine mutations, e.g., in the arginine-rich region and the first beta strand of Ring 9 ORF1.
  • SEQ ID NO: 561 Ring 2 N-terminal HIS-FLAG-3CProtease-ORF1: MGSSHHHHHHGSDYKDDDDKSGSLEVLFQGPSGMPYYYRRRRYNYRRPRWYGRGWIRRPFRRRFRRKRRVRPTYT TIPLKQWQPPYKRTCYIKGQDCLIYYSNLRLGMNSTMYEKSIVPVHWPGGGSFSVSMLTLDALYDIHKLCRNWWTSTN QDLPLVRYKGCKITFYQSTFTDYIVRIHTELPANSNKLTYPNTHPLMMMMSKYKHIIPSRQTRRKKKPYTKIFVKPPPQFE NKWYFATDLYKIPLLQIHCTACNLQNPFVKPDKLSNNVTLWSLNTISIQNRNMSVDQGQSWPFKILGTQSFYFYFYTGA NLPGDTTQIPVADLLPLTNPRINRPGQSLNEAKITDHITFTEYKNKFTNYWGNPFNK

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Virology (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2021/064887 2020-12-23 2021-12-22 In vitro assembly of anellovirus capsids enclosing rna Ceased WO2022140560A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
JP2023538735A JP2024501287A (ja) 2020-12-23 2021-12-22 RNAを閉じ込めたアネロウイルス(Anellovirus)キャプシドのインビトロアセンブリ
AU2021409952A AU2021409952A1 (en) 2020-12-23 2021-12-22 In vitro assembly of anellovirus capsids enclosing rna
BR112023012460A BR112023012460A2 (pt) 2020-12-23 2021-12-22 Conjunto in vitro de capsídeos de anellovirus que envolvem rna
MX2023007643A MX2023007643A (es) 2020-12-23 2021-12-22 Ensamblaje in vitro de cápsides de anellovirus que encierran arn.
EP21912150.6A EP4267157A4 (en) 2020-12-23 2021-12-22 IN VITRO ASSEMBLY OF ANELLOVIRUS CAPSIDS WITH RNA
IL303892A IL303892A (en) 2020-12-23 2021-12-22 In vitro assembly of RNA-encapsulating enalavirus capsids
KR1020237025029A KR20230124682A (ko) 2020-12-23 2021-12-22 Rna를 봉입하는 아넬로바이러스 캡시드의 시험관 내어셈블리
CN202180093903.7A CN116887865A (zh) 2020-12-23 2021-12-22 包封rna的指环病毒衣壳的体外组装
CA3206361A CA3206361A1 (en) 2020-12-23 2021-12-22 In vitro assembly of anellovirus capsids enclosing rna
US17/846,503 US20220372519A1 (en) 2020-12-23 2022-06-22 In vitro assembly of anellovirus capsids enclosing rna
US19/056,060 US20250257368A1 (en) 2020-12-23 2025-02-18 In vitro assembly of anellovirus capsids enclosing rna

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202063130360P 2020-12-23 2020-12-23
US63/130,360 2020-12-23
US202163147064P 2021-02-08 2021-02-08
US63/147,064 2021-02-08

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/846,503 Continuation US20220372519A1 (en) 2020-12-23 2022-06-22 In vitro assembly of anellovirus capsids enclosing rna

Publications (1)

Publication Number Publication Date
WO2022140560A1 true WO2022140560A1 (en) 2022-06-30

Family

ID=82160089

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/064887 Ceased WO2022140560A1 (en) 2020-12-23 2021-12-22 In vitro assembly of anellovirus capsids enclosing rna

Country Status (11)

Country Link
US (2) US20220372519A1 (https=)
EP (1) EP4267157A4 (https=)
JP (1) JP2024501287A (https=)
KR (1) KR20230124682A (https=)
AU (1) AU2021409952A1 (https=)
BR (1) BR112023012460A2 (https=)
CA (1) CA3206361A1 (https=)
IL (1) IL303892A (https=)
MX (1) MX2023007643A (https=)
TW (1) TW202235622A (https=)
WO (1) WO2022140560A1 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023114857A3 (en) * 2021-12-15 2023-07-27 Flagship Pioneering Innovations V, Inc. Surface-modified viral particles and modular viral particles
WO2025007075A1 (en) * 2023-06-29 2025-01-02 Life Technologies Corporation Molecules resistant to nuclease digestion

Citations (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998010088A1 (en) 1996-09-06 1998-03-12 Trustees Of The University Of Pennsylvania An inducible method for production of recombinant adeno-associated viruses utilizing t7 polymerase
US8084599B2 (en) 2004-03-15 2011-12-27 City Of Hope Methods and compositions for the specific inhibition of gene expression by double-stranded RNA
US8349809B2 (en) 2008-12-18 2013-01-08 Dicerna Pharmaceuticals, Inc. Single stranded extended dicer substrate agents and methods for the specific inhibition of gene expression
US8513207B2 (en) 2008-12-18 2013-08-20 Dicerna Pharmaceuticals, Inc. Extended dicer substrate agents and methods for the specific inhibition of gene expression
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8795965B2 (en) 2012-12-12 2014-08-05 The Broad Institute, Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
US8865406B2 (en) 2012-12-12 2014-10-21 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US8889356B2 (en) 2012-12-12 2014-11-18 The Broad Institute Inc. CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes
US8906616B2 (en) 2012-12-12 2014-12-09 The Broad Institute Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US8993233B2 (en) 2012-12-12 2015-03-31 The Broad Institute Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
US20150344912A1 (en) 2012-10-23 2015-12-03 Toolgen Incorporated Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof
US20160138008A1 (en) 2012-05-25 2016-05-19 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US20160208243A1 (en) 2015-06-18 2016-07-21 The Broad Institute, Inc. Novel crispr enzymes and systems
US20160216263A1 (en) * 2009-08-21 2016-07-28 Virginia Tech Intellectual Properties, Inc. Porcine torque teno virus vaccines and diagnosis
US20190085418A1 (en) * 2012-04-20 2019-03-21 Institut Pasteur Anellovirus genome quantification as a biomarker of immune suppression
US20200123203A1 (en) * 2017-06-13 2020-04-23 Flagship Pioneering Innovations V, Inc. Compositions comprising curons and uses thereof
US20200188456A1 (en) * 2018-12-12 2020-06-18 Flagship Pioneering Innovations V, Inc. Anellovirus compositions and methods of use
US20200306286A1 (en) 2017-12-15 2020-10-01 Flagship Pioneering Innovations Vi, Llc Compositions comprising circular polyribonucleotides and uses thereof

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX2021006977A (es) * 2018-12-12 2021-10-13 Flagship Pioneering Innovations V Inc Anellosomas y metodos de uso.
CA3119814A1 (en) * 2018-12-12 2020-06-18 Flagship Pioneering Innovations V, Inc. Anellosomes for delivering protein replacement therapeutic modalities
KR20230036109A (ko) * 2020-06-12 2023-03-14 플래그쉽 파이어니어링 이노베이션스 브이, 인크. 바큘로바이러스 발현 시스템
MX2022016475A (es) * 2020-06-17 2023-04-11 Flagship Pioneering Innovations V Inc Metodos de identificacion y caracterizacion de anellovirus y usos de los mismos.

Patent Citations (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998010088A1 (en) 1996-09-06 1998-03-12 Trustees Of The University Of Pennsylvania An inducible method for production of recombinant adeno-associated viruses utilizing t7 polymerase
US8084599B2 (en) 2004-03-15 2011-12-27 City Of Hope Methods and compositions for the specific inhibition of gene expression by double-stranded RNA
US8349809B2 (en) 2008-12-18 2013-01-08 Dicerna Pharmaceuticals, Inc. Single stranded extended dicer substrate agents and methods for the specific inhibition of gene expression
US8513207B2 (en) 2008-12-18 2013-08-20 Dicerna Pharmaceuticals, Inc. Extended dicer substrate agents and methods for the specific inhibition of gene expression
US20160216263A1 (en) * 2009-08-21 2016-07-28 Virginia Tech Intellectual Properties, Inc. Porcine torque teno virus vaccines and diagnosis
US20190085418A1 (en) * 2012-04-20 2019-03-21 Institut Pasteur Anellovirus genome quantification as a biomarker of immune suppression
US20160138008A1 (en) 2012-05-25 2016-05-19 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US20150344912A1 (en) 2012-10-23 2015-12-03 Toolgen Incorporated Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof
US8795965B2 (en) 2012-12-12 2014-08-05 The Broad Institute, Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
US8871445B2 (en) 2012-12-12 2014-10-28 The Broad Institute Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
US8889418B2 (en) 2012-12-12 2014-11-18 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US8895308B1 (en) 2012-12-12 2014-11-25 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US8906616B2 (en) 2012-12-12 2014-12-09 The Broad Institute Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US8932814B2 (en) 2012-12-12 2015-01-13 The Broad Institute Inc. CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes
US8945839B2 (en) 2012-12-12 2015-02-03 The Broad Institute Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8993233B2 (en) 2012-12-12 2015-03-31 The Broad Institute Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
US8999641B2 (en) 2012-12-12 2015-04-07 The Broad Institute Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
US8889356B2 (en) 2012-12-12 2014-11-18 The Broad Institute Inc. CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes
US8865406B2 (en) 2012-12-12 2014-10-21 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8771945B1 (en) 2012-12-12 2014-07-08 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US20160208243A1 (en) 2015-06-18 2016-07-21 The Broad Institute, Inc. Novel crispr enzymes and systems
US20200123203A1 (en) * 2017-06-13 2020-04-23 Flagship Pioneering Innovations V, Inc. Compositions comprising curons and uses thereof
US20200306286A1 (en) 2017-12-15 2020-10-01 Flagship Pioneering Innovations Vi, Llc Compositions comprising circular polyribonucleotides and uses thereof
US20200188456A1 (en) * 2018-12-12 2020-06-18 Flagship Pioneering Innovations V, Inc. Anellovirus compositions and methods of use

Non-Patent Citations (51)

* Cited by examiner, † Cited by third party
Title
"Remington: The Science and Practice of Pharmacy", 2005, LIPPINCOTT WILLIAMS & WILKINS
AKDIS ET AL.: "Interleukins (from IL-1 to IL-38), interferons, transforming growth factor β, and TNF-a", RECEPTORS, FUNCTIONS, AND ROLES IN DISEASES, vol. 138, October 2016 (2016-10-01), pages 984 - 1010
ANDERSEN ET AL., CELL. MOL. NEUROBIOL., vol. 13, 1993, pages 503 - 15
ARBUTHNOT ET AL., HUM. GENE THER., vol. 7, 1996, pages 1503 - 14
BAFICO ET AL.: "Classification of Growth Factors and Their Receptors", HOLLAND-FREI CANCER MEDICINE
BARTEL, CELL, vol. 116, 2004, pages 281 - 297
BEAUCAGEIYER, TETRAHEDRON, vol. 49, 1993, pages 1925
BIRMINGHAM ET AL., NAT METHODS, vol. 3, 2006, pages 199 - 204
BOSE: "cGAS/STING Pathway in Cancer: Jekyll and Hyde Story of Cancer Immune Response", INT J MOL SCI., vol. 18, no. 11, November 2017 (2017-11-01), pages 2456
BOSHART ET AL., CELL, vol. 41, 1985, pages 521 - 530
CALCEDO ET AL., FRONT. IMMUNOL., vol. 4, no. 341, 2013, pages 1 - 7
CHEN ET AL., J. BONE MINER. RES., vol. 11, 1996, pages 654 - 64
CONG ET AL., SCIENCE, vol. 339, 2013, pages 819 - 823
DOENCH ET AL., GENES DEV, vol. 17, 2003, pages 438 - 442
DRUGMAND ET AL.: "Insect cells as factories for biomanufacturing", BIOTECHNOLOGY ADVANCES, vol. 30, 2012, pages 1140 - 1157, XP055302952, DOI: 10.1016/j.biotechadv.2011.09.014
DUAN: "Systemic AAV Micro-dystrophin Gene Therapy for Duchenne Muscular Dystrophy", MOL THER., vol. 26, no. 10, 17 July 2018 (2018-07-17), pages 2337 - 2356, XP055925242, DOI: 10.1016/j.ymthe.2018.07.011
FU ET AL.: "STING agonist formulated cancer vaccines can cure established tumors resistant to PD-1 blockade", SCI TRANSL MED., vol. 7, no. 283, 15 April 2015 (2015-04-15), pages 283 - 52, XP055299884, DOI: 10.1126/scitranslmed.aaa4306
GAJ ET AL., TRENDS BIOTECHNOL., vol. 7, 2013, pages 397 - 405
GOSSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 5547 - 5551
GOSSEN ET AL., SCIENCE, vol. 268, 1995, pages 1766 - 1769
GUAN ET AL.: "Application of CRISPR-Cas system in gene therapy: Pre-clinical progress in animal model", DNA REPAIR, vol. 46, October 2016 (2016-10-01), pages 1 - 8, XP029750367, DOI: 10.1016/j.dnarep.2016.07.004
HANSAL ET AL., J. IMMUNOL., vol. 161, 1998, pages 1063 - 8
HARVEY ET AL., CURR. OPIN. CHEM. BIOL., vol. 2, 1998, pages 512 - 518
HENDEL ET AL., NATURE BIOTECHNOL., 2015, pages 985 - 991
KAKKOLA ET AL., VIROLOGY, vol. 382, 2008, pages 182 - 189
LAGANA ET AL., METHODS MOL. BIO., vol. 1269, 2015, pages 393 - 412
LI ET AL., NAT. BIOTECH., vol. 17, 1999, pages 241 - 245
LICARI ET AL.: "Insect cell hosts for baculovirus expression vectors contain endogenous exoglycosidase activity", BIOTECHNOLOGY PROGRESS, vol. 9, 1993, pages 146 - 152
LIM ET AL., NATURE, vol. 433, 2005, pages 769 - 773
MAGARI ET AL., J. CLIN. INVEST., vol. 100, 1997, pages 2865 - 2872
MARINGER ET AL.: "Message in a bottle: lessons learned from antagonism of STING signalling during RNA virus infection", CYTOKINE & GROWTH FACTOR REVIEWS, vol. 25, December 2014 (2014-12-01), pages 669 - 679
MIYATAKE ET AL., J. VIROL., vol. 71, 1997, pages 5124 - 32
PICCIOLI ET AL., NEURON, vol. 15, 1995, pages 373 - 84
PICCIOLI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 5611 - 5
RAJEWSKY, NAT GENET, vol. 38, 2006, pages 8 - 13
RAN ET AL., CELL, vol. 154, 2013, pages 1380 - 1389
RAN ET AL., NATURE PROTOCOLS, vol. 8, 2013, pages 2281 - 2308
RIVERA ET AL., NAT. MEDICINE., vol. 2, 1996, pages 1028 - 1032
SANDIG ET AL., GENE THER., vol. 3, 1996, pages 1002 - 9
See also references of EP4267157A4
STEELAND ET AL.: "Nanobodies as therapeutics: big opportunities for small antibodies", DRUG DISCOV TODAY, vol. 21, no. 7, 2016, pages 1076 - 113, XP029598209, DOI: 10.1016/j.drudis.2016.04.003
STEIN ET AL., MOL. BIOL. REP., vol. 24, 1997, pages 185 - 96
TSUDA ET AL., J. VIROL. METHODS, vol. 77, 1999, pages 199 - 206
WANG ET AL., GENE THER., vol. 4, 1997, pages 432 - 441
WANG ET AL., GENE THERAPY, vol. 11, 2004, pages 711 - 721
WANG ET AL., NAT. BIOTECH., vol. 15, 1997, pages 239 - 243
WANG ET AL.: "STING activator c-di-GMP enhances the anti-tumor effects of peptide vaccines in melanoma-bearing mice", CANCER IMMUNOL IMMUNOTHER, vol. 64, no. 8, 19 May 2015 (2015-05-19), pages 1057 - 66, XP035515560, DOI: 10.1007/s00262-015-1713-5
WU ET AL., PROC NATL ACAD SCI USA, vol. 103, 2006, pages 4034 - 4039
ZENG ET AL., MOL CELL, vol. 9, 2002, pages 1327 - 1333
ZETSCHE ET AL., CELL, vol. 163, 2015, pages 759 - 771
ZHENG ET AL.: "Precise gene deletion and replacement using the CRISPR/Cas9 system in human cells", BIOTECHNIQUES, vol. 57, no. 3, September 2014 (2014-09-01), pages 115 - 124

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023114857A3 (en) * 2021-12-15 2023-07-27 Flagship Pioneering Innovations V, Inc. Surface-modified viral particles and modular viral particles
US12540337B2 (en) 2021-12-15 2026-02-03 Flagship Pioneering Innovations V, Inc. Surface-modified viral particles and modular viral particles
WO2025007075A1 (en) * 2023-06-29 2025-01-02 Life Technologies Corporation Molecules resistant to nuclease digestion

Also Published As

Publication number Publication date
AU2021409952A1 (en) 2023-07-06
KR20230124682A (ko) 2023-08-25
US20220372519A1 (en) 2022-11-24
IL303892A (en) 2023-08-01
EP4267157A4 (en) 2025-05-07
CA3206361A1 (en) 2022-06-30
TW202235622A (zh) 2022-09-16
BR112023012460A2 (pt) 2023-11-07
MX2023007643A (es) 2023-09-04
EP4267157A1 (en) 2023-11-01
US20250257368A1 (en) 2025-08-14
JP2024501287A (ja) 2024-01-11

Similar Documents

Publication Publication Date Title
US20230340527A1 (en) Baculovirus expression systems
US20250257368A1 (en) In vitro assembly of anellovirus capsids enclosing rna
US20260098280A1 (en) Surface-modified viral particles and modular viral particles
KR20230041686A (ko) 아넬로바이러스를 확인 및 특징화하는 방법 및 이의 용도
EP4165198A1 (en) Tandem anellovirus constructs
US20240123083A1 (en) Hybrid aav-anellovectors
EP4526326A2 (en) Compositions comprising modified anellovirus capsid proteins and uses thereof
CN116887865A (zh) 包封rna的指环病毒衣壳的体外组装

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21912150

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3206361

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2023538735

Country of ref document: JP

Ref document number: MX/A/2023/007643

Country of ref document: MX

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023012460

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2021409952

Country of ref document: AU

Date of ref document: 20211222

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202317046557

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 20237025029

Country of ref document: KR

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021912150

Country of ref document: EP

Effective date: 20230724

WWE Wipo information: entry into national phase

Ref document number: 202180093903.7

Country of ref document: CN

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112023012460

Country of ref document: BR

Free format text: EFETUAR, EM ATE 60 (SESSENTA) DIAS, O PAGAMENTO DE GRU CODIGO DE SERVICO 260 PARA A REGULARIZACAO DO PEDIDO, CONFORME ART. 2O 1O DA RESOLUCAO/INPI/NO 189/2017 E NOTA DE ESCLARECIMENTO PUBLICADA NA RPI 2421 DE 30/05/2017, UMA VEZ QUE A PETICAO NO 870230064108 DE 21/07/2023 APRESENTA DOCUMENTOS REFERENTES A 2 SERVICOS DIVERSOS (TRADUCAO DOS DOCUMENTOS APRESENTADOS E MODIFICACOES NO QUADRO REIVINDICATORIO) TENDO SIDO PAGA SOMENTE 1 RETRIBUICAO. DEVERA SER PAGA MAIS 1(UMA) GRU CODIGO DE SERVICO 260 E A GRU CODIGO DE SERVICO 207 REFERENTE A RESPOSTA DESTA EXIGENCIA.

ENP Entry into the national phase

Ref document number: 112023012460

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230621