WO2022115451A1 - Mcl-1 inhibitor antibody-drug conjugates and methods of use - Google Patents

Mcl-1 inhibitor antibody-drug conjugates and methods of use Download PDF

Info

Publication number
WO2022115451A1
WO2022115451A1 PCT/US2021/060560 US2021060560W WO2022115451A1 WO 2022115451 A1 WO2022115451 A1 WO 2022115451A1 US 2021060560 W US2021060560 W US 2021060560W WO 2022115451 A1 WO2022115451 A1 WO 2022115451A1
Authority
WO
WIPO (PCT)
Prior art keywords
group
alkyl
antibody
cancer
branched
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/060560
Other languages
English (en)
French (fr)
Inventor
Matthew T. Burger
Francesca ROCCHETTI
Zhuoliang Chen
Joseph Anthony D'ALESSIO
Claudia Judith KLINTER
Eric MCNEILL
Cornelia Anne MUNDT
Katsumasa Nakajima
Richard Vaughan NEWCOMBE
Mark G. Palermo
Tamas Schweighoffer
Bing Yu
Katharina Winkelbach
Qiang Zhang
Laura BRESSON
Frédéric COLLAND
Ana Leticia MARAGNO
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis AG
Les Laboratoires Servier SAS
Original Assignee
Novartis AG
Les Laboratoires Servier SAS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novartis AG, Les Laboratoires Servier SAS filed Critical Novartis AG
Priority to CA3202759A priority Critical patent/CA3202759A1/en
Priority to AU2021385349A priority patent/AU2021385349A1/en
Priority to EP21827762.2A priority patent/EP4251208A1/en
Priority to CN202180091558.3A priority patent/CN117136076A/zh
Priority to KR1020237021028A priority patent/KR20230138444A/ko
Priority to US18/038,437 priority patent/US20240042051A1/en
Priority to IL303079A priority patent/IL303079A/en
Priority to JP2023530996A priority patent/JP2023553808A/ja
Publication of WO2022115451A1 publication Critical patent/WO2022115451A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6867Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of a blood cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6889Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily

Definitions

  • the present disclosure relates to antibody-drug conjugates (ADCs) comprising an Mcl-1 inhibitor and an anti-CD48 antibody or antigen-binding fragment thereof that binds an antigen target, e.g., an antigen expressed on a tumor or other cancer cell.
  • ADCs antibody-drug conjugates
  • the disclosure further relates to methods and compositions useful in the treatment and/or diagnosis of cancers that express the target antigen CD48 and/or are amenable to treatment by modulating Mcl-1 expression and/or activity, as well as methods of making those compositions.
  • Linker-drug conjugates comprising an Mcl-1 inhibitor drug moiety and methods of making same are also disclosed.
  • Apoptosis or programmed cell death, is a physiological process that is crucial for embryonic development and maintenance of tissue homeostasis.
  • Apoptotic-type cell death generally involves morphological changes such as condensation of the nucleus and DNA fragmentation, as well as biochemical changes such as the activation of caspases that can cause damage to key structural components of the cell.
  • Regulation of apoptosis is complex and typically involves the activation or repression of several intracellular signaling pathways (Cory et al. (2002) Nature Review Cancer 2:647-656).
  • Deregulation of apoptosis is associated with certain pathologies. For instance, increased apoptosis is associated with neurodegenerative diseases such as Parkinson's disease, Alzheimer's disease, and ischemia. Conversely, deficits in apoptosis can play a role in the development of cancers and chemoresistance, autoimmune diseases, inflammatory diseases, and viral infections. The absence of apoptosis is one of the phenotypic signatures of cancer (Hanahan et al. (2000) Cell 100:57-70).
  • Anti-apoptotic proteins of the Bcl-2 family are associated with numerous types of cancer, such as colon cancer, breast cancer, small cell lung cancer, non-small cell lung cancer, bladder cancer, ovarian cancer, prostate cancer, chronic lymphoid leukemia, lymphoma, myeloma, and pancreatic cancer.
  • Mcl-1 Myeloid cell leukemia 1
  • Mcl-1 an anti-apoptotic Bcl-2 family member
  • Amplification of the Mcl-1 gene and/or overexpression of the Mcl-1 protein has been observed in multiple cancer types and is commonly implicated in tumor development (Beroukhim et al. (2010) Nature 463(7283):899-905).
  • Mcl-1 is one of the most frequently amplified genes in human cancer and is also a critical survival factor that has been shown to mediate drug resistance to a variety of anti-cancer agents.
  • Mcl-1 is believed to promote cell survival by binding to and neutralizing the death- inducing activities of pro-apoptotic proteins such as Bim, Noxa, Bak, and Bax. Inhibition of Mcl-1 releases these pro-apoptotic proteins, often leading to the induction of apoptosis in tumor cells dependent on Mcl-1 for survival.
  • Therapeutically targeting Mcl-1 or proteins upstream and/or downstream of it in an apoptotic signaling pathway therefore, may represent promising strategies to treat various malignancies and to overcome drug resistance in certain human cancers.
  • CD48 (also known as BLAST-1 and SLAMF2) is an attractive target for antibody drug conjugates due to its absence in normal non-hematopoietic tissues, expression restricted to mature lymphocytes and monocytes, and significant upregulation in a range of hematological malignancies.
  • CD48 is an adhesion and costimulatory molecule and involved in a wide variety of innate and adaptive immune responses, ranging from granulocyte activity and allergy to T cell activation and autoimmunity (McArdel et al. (2016) Clin Immunol 164:10-20). In oncology, it has been well established that CD48 is significantly upregulated in lymphoid leukemia, multiple myeloma, and lymphoma.
  • Antibodies and antibody-drug conjugates targeting CD48 have been shown previously to be internalized and trafficked to lysosomal vesicles upon binding to CD48 on myeloma cell surface and demonstrate anti-tumor activity in preclinical models of cancer (see, for e.g. Lewis et al. (2016) Blood 128(22):4470).
  • the present disclosure provides, in part, novel antibody-drug conjugate (ADC) compounds with biological activity against cancer cells.
  • the compounds may slow, inhibit, and/or reverse tumor growth in mammals, and/or may be useful for treating human cancer patients.
  • the present disclosure more specifically relates, in some embodiments, to ADC compounds that are capable of binding and killing cancer cells.
  • the ADC compounds disclosed herein comprise a linker that attaches an Mcl-1 inhibitor to a full-length anti-CD48 antibody or an antigen-binding fragment.
  • the ADC compounds are also capable of internalizing into a target cell after binding.
  • ADC compounds may be represented by Formula (1): wherein Ab is an anti-CD48 antibody or an antigen-binding fragment thereof that targets a cancer cell; D is an Mcl-1 inhibitor; L is a linker that covalently attaches Ab to D; and p is an integer from 1 to 16. [11] In some embodiments, p is an integer from 1 to 8. In some embodiments, p is an integer from 1 to 5. In some embodiments, p is an integer from 2 to 4. In some embodiments, p is 2. In some embodiments, p is 4. In some embodiments, p is determined by liquid chromatography-mass spectrometry (LC-MS).
  • LC-MS liquid chromatography-mass spectrometry
  • the linker (L) comprises an attachment group, at least one spacer group, and at least one cleavable group.
  • the cleavable group comprises a pyrophosphate group and/or a self-immolative group.
  • L comprises an attachment group; at least one bridging spacer group; and at least one cleavable group comprising a pyrophosphate group and/or a self-immolative group.
  • the antibody-drug conjugate comprises a linker-drug (or “linker-payload”) moiety -(L-D) is of the formula (A): wherein R 1 is an attachment group, L 1 is a bridging spacer group, and E is a cleavable group.
  • the cleavable group comprises a pyrophosphate group.
  • the cleavable group comprises: [15]
  • the bridging spacer group comprises a polyoxyethylene (PEG) group.
  • the PEG group may be selected from PEG1, PEG2, PEG3, PEG4, PEG5, PEG6, PEG7, PEG8, PEG9, PEG10, PEG11, PEG12, PEG13, PEG14, and PEG15.
  • the bridging spacer group may comprise: -CO-CH 2 -CH 2 - PEG12-.
  • the bridging spacer group comprises a butanoyl, pentanoyl, hexanoyl, heptanoyl, or octanoyl group.
  • the bridging spacer group comprises a hexanoyl group.
  • the attachment group is formed from at least one reactive group selected from a maleimide group, thiol group, cyclooctyne group, and an azido group.
  • maleimide group may have the structure: .
  • the cyclooctyne group may have the structure: wherein is a bond to the antibody.
  • the cyclooctyne group has the structure: , and wherein is a bond to the antibody.
  • the attachment group has a formula comprising , and wherein is a bond to the antibody.
  • the antibody is joined to the linker (L) by an attachment group selected from: , wherein is a bond to the antibody, and wherein is a bond to the bridging spacer group.
  • the bridging spacer group is joined to a cleavable group.
  • the bridging spacer group is -CO-CH 2 -CH 2 -PEG12-.
  • the cleavable group is -pyrophosphate-CH 2 -CH 2 -NH 2 -.
  • the cleavable group is joined to the Mcl-1 inhibitor (D).
  • the cleavable group is joined to the Mcl-1 inhibitor (D) group through a phenyl-pyrimidinyl group.
  • the linker comprises: an attachment group, at least one bridging spacer group, a peptide group, and at least one cleavable group.
  • the antibody-drug conjugate comprises a linker-drug moiety, -(L-D), is of the formula (B): wherein R 1 is an attachment group, L 1 is a bridging spacer, Lp is a peptide group comprising 1 to 6 amino acid residues, E is a cleavable group, L 2 is a bridging spacer, m is 0 or 1; and D is an Mcl-1 inhibitor. In some cases, m is 1 and the bridging spacer comprises: . [29] In some embodiments, the at least one bridging spacer comprises a PEG group.
  • the PEG group is selected from, PEG1, PEG2, PEG3, PEG4, PEG5, PEG6, PEG7, PEG8, PEG9, PEG10, PEG11, PEG12, PEG13, PEG14, and PEG15.
  • the at least one bridging spacer is selected from *-C(O)-CH 2 -CH 2 -PEG1-**, *-C(O)-CH 2 - PEG3-**, *-C(O)-CH 2 -CH 2 -PEG12**, *-NH-CH2-CH2-PEG1-**, a polyhydroxyalkyl group, *- C(O)-N(CH 3 )-CH 2 -CH 2 -N(CH 3 )-C(O)-**, and *-C(O)-CH 2 -CH 2 -PEG12-NH-C(O)CH 2 -CH 2 -**, wherein ** indicates the point of direct or indirect attachment of the at least one bridging spacer to the attachment group and * indicates the point of direct or indirect attachment of the at least one bridging spacer to the peptide group.
  • L 1 is selected from *-C(O)-CH 2 -CH 2 -PEG1-**, *-C(O)-CH 2 - PEG3-**, *-C(O)-CH 2 -CH 2 -PEG12**, *-NH-CH2-CH2-PEG1-**, and a polyhydroxyalkyl group, wherein ** indicates the point of direct or indirect attachment of L 1 to R 1 and * indicates the point of direct or indirect attachment of L 1 to Lp.
  • m is 1 and L 2 is -C(O)-N(CH 3 )-CH 2 -CH 2 -N(CH 3 )-C(O)-.
  • the peptide group comprises 1 to 12 amino acid residues. In some embodiments, the peptide group (Lp) comprises 1 to 10 amino acid residues. In some embodiments, the peptide group (Lp) comprises 1 to 8 amino acid residues. In some embodiments, the peptide group (Lp) comprises 1 to 6 amino acid residues. In some embodiments, the peptide group comprises 1 to 4 amino acid residues. In some embodiments, the peptide group comprises 1 to 3 amino acid residues. In some embodiments the peptide group comprises 1 to 2 amino acid residues.
  • the amino acid residues are selected from L-glycine (Gly), L-valine (Val), L-citrulline (Cit), L- cysteic acid (sulfo-Ala), L-lysine (Lys), L-isoleucine (Ile), L-phenylalanine (Phe), L- methionine (Met), L-asparagine (Asn), L-proline (Pro), L-alanine (Ala), L-leucine (Leu), L- tryptophan (Trp), and L-tyrosine (Tyr).
  • the peptide group may comprise Val- Cit, Val-Ala, Val-Lys, and/or sulfo-Ala-Val-Ala.
  • the peptide group (Lp) comprises 1 amino acid residue linked to a group.
  • the peptide group (Lp) comprises a group selected from: .
  • the peptide group comprises a group selected from: [34]
  • the self-immolative group comprises para-aminobenzyl- carbamate, para-aminobenzyl-ammonium, para-amino-(sulfo)benzyl-ammonium, para- amino-(sulfo)benzyl-carbamate, para-amino-(alkoxy-PEG-alkyl)benzyl-carbamate, para- amino-(polyhydroxycarboxytetrahydropyranyl)alkyl-benzyl-carbamate, or para-amino- (polyhydroxycarboxytetrahydropyranyl)alkyl-benzyl-ammonium.
  • m is 1 and the bridging spacer comprises
  • the linker-drug moiety, -(L-D) is formed from a compound selected from:
  • the antibody-drug conjugate comprises the linker-drug group, -(L-D), which comprises a formula selected from:
  • R 1 is an attachment group
  • L 1 is a bridging spacer
  • Lp is
  • L 1 comprises: or *-CH(OH)CH(OH)CH(OH)-**,wherein each n is an integer from 1 to 12, wherein the * of L 1 indicates the point of direct or indirect attachment to Lp, and the ** of L 1 indicates the point of direct or indirect attachment to R 1 .
  • L 1 is and n is an integer from 1 to 12 wherein the * of L 1 indicates the point of direct or indirect attachment to Lp, and the ** of L 1 indicates the point of direct or indirect attachment to R 1 .
  • L 1 is , and n is 1, wherein the * of L 1 indicates the point of direct or indirect attachment to Lp, and the ** of L 1 indicates the point of direct or indirect attachment to R 1 .
  • L 1 is , and n is 12, wherein the * of L 1 indicates the point of direct or indirect attachment to Lp, and the ** of L 1 indicates the point of direct or indirect attachment to R 1 .
  • L 1 is and n is an integer from 1 to 12, wherein the * of L 1 indicates the point of direct or indirect attachment to Lp, and the ** of L 1 indicates the point of direct or indirect attachment to R 1 .
  • L 1 comprises wherein the * of L 1 indicates the point of direct or indirect attachment to Lp, and the ** of L 1 indicates the point of direct or indirect attachment to R 1 .
  • R 2 is , wherein n is an integer between 1 and 6, [48]
  • the hydrophilic moiety comprises .
  • the attachment group is formed by a reaction comprising at least one reactive group. In some cases, the attachment group is formed by reacting: a first reactive group that is attached to the linker, and a second reactive group that is attached to the antibody or is an amino acid residue of the antibody.
  • R 32 is H, C 1-4 alkyl, phenyl, pyrimidine or pyridine
  • R 35 is H, C 1-6 alkyl, phenyl or C 1-4 alkyl substituted with 1 to 3 –OH groups
  • R 37 is independently selected from H, phenyl and pyridine
  • q is 0, 1, 2 or 3
  • R 8 is H or methyl
  • R 9 is H, -CH 3 or phenyl.
  • the peptide group (Lp) comprises 1 to 6 amino acid residues. In some embodiments, the peptide group (Lp) comprises 1 to 4 amino acid residues. In some embodiments, the peptide group comprises 1 to 3 amino acid residues. In some embodiments, the peptide group comprises 1 to 2 amino acid residues.
  • the amino acid residues are selected from L-glycine (Gly), L-valine (Val), L- citrulline (Cit), L-cysteic acid (sulfo-Ala), L-lysine (Lys), L-isoleucine (Ile), L-phenylalanine (Phe), L-methionine (Met), L-asparagine (Asn), L-proline (Pro), L-alanine (Ala), L-leucine (Leu), L-tryptophan (Trp), and L-tyrosine (Tyr).
  • the peptide group comprises Val-Cit, Phe-Lys, Val-Ala, Val-Lys, Leu-Cit, sulfo-Ala-Val, and/or sulfo-Ala-Val- Ala.
  • Lp is selected from: [59]
  • the linker-drug group -(L-D) comprises the following formula: , wherein: is a bond to the antibody; and A, D and R are as defined above.
  • the linker-drug group -(L-D) comprises the following formula: , wherein: is a bond to the antibody; and A, D and R are as defined above.
  • the linker-drug group -(L-D) comprises the following formula: , wherein: is a bond to the antibody; and A, D and R are as defined above.
  • the linker-drug group -(L-D) comprises the following formula: , wherein: is a bond to the antibody; and A, D and R are as defined above.
  • the linker-drug group -(L-D) comprises the following formula: , wherein: is a bond to the antibody; and Xa, A, D and R are as defined above.
  • the linker-drug group -(L-D) comprises the following formula: , wherein: is a bond to the antibody; and A, D and R are as defined above.
  • the linker-drug group -(L-D) comprises the following formula: wherein: is a bond to the antibody; and Xb, A, D and R are as defined above.
  • the linker-drug group -(L-D) comprises the following formula:
  • the linker-drug group -(L-D) comprises the following formula:
  • the linker-drug group -(L-D) comprises the following formula:
  • each R a is independently selected from H, C 1 -C 6 alkyl, and C 3 -C 8 cycloalkyl and the * of A indicates the point of attachment to D; and D is an Mc
  • the linker-drug group -(L-D) comprises the following formula:
  • the linker-drug group -(L-D) comprises the following formula:
  • the antibody-drug conjugate comprises the linker-drug group, -(L-D), which is formed from a compound selected from: ,
  • the Mcl-1 inhibitor (D) comprises a compound of Formula (I): wherein: Ring D 0 is a cycloalkyl group, a heterocycloalkyl group, an aryl group or a heteroaryl group, Ring E 0 is a furyl, thienyl or pyrrolyl ring, X 01 , X 03 , X 04 and X 05 independently of one another is a carbon atom or a nitrogen atom, X 02 is a C-R 026 group or a nitrogen atom, means that the ring is aromatic, Y 0 is a nitrogen atom or a C-R 03 group, Z 0 is a nitrogen atom or a C-R 04 group, R 01 is a halogen atom, a linear or branched (C 1 -C 6 )alkyl group, a linear or branched (C 2 -C 6 )alkenyl group, a linear or branched (C
  • Cy 01 , Cy 02 , Cy 03 , Cy 04 , Cy 05 , Cy 06 , Cy 07 , Cy 08 and Cy 010 is a cycloalkyl group, a heterocycloalkyl group, an aryl group or a heteroaryl group, each of which is optionally substituted by one or more groups selected from halo; -(C 1 -C 6 )alkoxy; -(C 1 -C 6 )haloalkyl; -(C 1 -C 6 )haloalkoxy; -(CH 2 ) p0 -O-SO 2 -OR 030 ; -(CH 2 ) p0 -SO 2 -OR 030 ; -O-P(O)(OR 020 ) 2 ; -O-P(O)(O-M + ) 2 ; -CH 2 -P(O)(OR 020 ) 2 ; -((O)(OR 020 ) 2 ; -
  • Z 0 is a nitrogen atom or a C-R 04 group
  • R 01 is a halogen atom, a linear or branched (C 1 -C 6 )alkyl group, a linear or branched (C 2 -C 6 )alkenyl group, a linear or branched (C 2 -C 6 )alkynyl group, a linear or branched (C 1 -C 6 )haloalkyl group, a hydroxy group, a linear or branched (C 1 - C 6 )alkoxy group, a -S-(C 1 -C 6 )alkyl group, a cyano group, -Cy 08, -NR 011 R 011 ’, R 02 , R 03 and R 04 independently of one another are a hydrogen atom, a halogen atom, a linear or branched (C 1 -C 6 )alkyl group, a linear or branched (C 2 - C 6
  • D comprises a compound of Formula (III): wherein: R01 is a linear or branched (C 1 -C 6 )alkyl group, R 03 is -O-(C 1 -C 6 )alkyl-NR 011 R 011 ’, , wherein R 011 and R 011 ’ independently of one another are a hydrogen atom, an optionally substituted linear or branched (C 1 -C 6 )alkyl group, or -(C 0 -C 6 )alkyl-Cy 01 ; or the pair (R 011 , R 011 ’) together with the nitrogen atom to which they are attached form an aromatic or non-aromatic ring containing 5 to 7 ring members, which optionally contains, in addition to the nitrogen atom, 1 to 3 heteroatoms selected from O, S and N, wherein the N atom may be substituted by 1 or 2 groups selected from a hydrogen atom or a linear or branched (C 1 -C 6 )
  • Cy 01 , Cy 02 , Cy 05 , Cy 06 independently of one another, is a cycloalkyl group, a heterocycloalkyl group, an aryl group or a heteroaryl group, each of which is optionally substituted by one or more groups selected from halo; -(C 1 -C 6 )alkoxy; -(C 1 -C 6 )haloalkyl; -(C 1 -C 6 )haloalkoxy; -(CH 2 ) p0 -O-SO 2 -OR 030 ; -(CH 2 ) p0 -SO 2 -OR 030 ; -O-P(O)(OR 020 ) 2 ; -O-P(O)(O-M + ) 2 ; -CH 2 -P(O)(OR 020 ) 2 ; -(CH 2 ) p0 -O-(CHR 018 -CHR
  • R 01 is methyl or ethyl.
  • R 03 is -O-CH 2 -CH 2 -NR 011 R 011 ’ in which R 011 and R 011 ’ form, together with the nitrogen atom carrying them, a piperazinyl group which may be substituted by a substituted by a hydrogen atom or a linear or branched (C 1 -C 6 )alkyl group.
  • R 03 comprises the formula: , wherein R 027 is a hydrogen atom and R 028 is a -(CH 2 ) p0 -O-SO 2 -OR 030 group, p0 is an integer equal to 0, 1, 2, or 3; and wherein R 030 represents a hydrogen atom, a linear or branched (C 1 -C 6 )alkyl group or an aryl(C 1 -C 6 )alkyl group. [90] In some embodiments, R 03 comprises the formula: , wherein is a bond to the linker.
  • Cy 01 , Cy 02 , Cy 03 , Cy 04 , Cy 05 , Cy 06 , Cy 07 , Cy 08 and Cy 010 independently of one another, are an optionally substituted cycloalkyl group, an optionally substituted heterocycloalkyl group, an optionally substituted aryl group or an optionally substituted heteroaryl group, wherein the optional substituents are selected from optionally substituted linear or branched (C 1 -C 6 )alkyl, optionally substituted linear or branched (C 2 -C 6 )alkenyl group, optionally substituted linear or branched (C 2 -C 6 )alkynyl group, optionally substituted linear or branched (C 1 -C 6 )alkoxy, optionally substituted (C 1 -C 6 )alkyl-S-, hydroxy, oxo (or N-oxide where appropriate), nitro, cyano, -C(O)-OR 0 ’,
  • R 09 is a Cy 02 group, preferably an aryl group, more preferably a phenyl group. In some embodiments, Cy 02 is an optionally substituted aryl group.
  • Cy 05 comprises a heteroaryl group selected from a pyrazolyl group and a pyrimidinyl group.
  • Cy 05 is a pyrimidinyl group.
  • Cy 05 is a pyrimidinyl group and Cy 06 is phenyl group.
  • the linker (L) is attached to D by a covalent bond from L to R 03 of formulas (I), (II), or (III). In some embodiments, the linker (L) is attached to D by a covalent bond from L to R 09 of formulas (I), (II), or (III). [97] In some embodiments, D comprises:
  • -(L-D) is formed from a compound selected from Table A or an enantiomer, diastereoisomer, atropisomer, deuterated derivative, and/or pharmaceutically acceptable salt thereof.
  • compounds in Table A depending on their electronic charge, these compounds can contain one pharmaceutically acceptable monovalent anionic counterion M1-.
  • the monovalent anionic counterion M1- can be selected from bromide, chloride, iodide, acetate, trifluoroacetate, benzoate, mesylate, tosylate, triflate, formate, or the like. In some embodiments, the monovalent anionic counterion M1- is trifluoroacetate or formate. Table A. Exemplary Linker Drug Groups
  • the antibody-drug conjugate has a formula according to any one of the structures shown in Table B.
  • L/P refers to the linker-payloads, linker-drugs, or linker-compounds disclosed herein and the terms “L#-P#” and “L#-C#” are used interchangeably to refer to a specific linker-drug disclosed herein, while the codes “P#” and “C#” are used interchangeably to refer to a specific compound unless otherwise specified.
  • both “L1-C1” and “L1-P1” refer to the same linker-payload structure disclosed herein, while both “C1” and “P1” indicate the same compound disclosed herein, including an enantiomer, diastereoisomer, atropisomer, deuterated derivative, and/or pharmaceutically acceptable salt of any of the foregoing.
  • the antibody or antigen-binding fragment binds to the target antigen CD48 on a cancer cell.
  • CD48 is a human CD48 isoform.
  • the human CD48 isoform isoform 1 (NP_001769.2) having an amino acid sequence of: [102] MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLT WFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNE QEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSV LETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLL T (SEQ ID NO:53).
  • the human CD48 isoform isoform 2 (NP_001242959.1) having an amno acid sequence of: [104] MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLT WFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNE QEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSV LETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLGKKDPWELRGAQGNWSCFEQRK AGGPIQPPCTVWW (SEQ ID NO:54).
  • compositions comprising multiple copies of an antibody-drug conjugate (e.g., any of the exemplary antibody-drug conjugates described herein). In some embodiments, the average p of the antibody-drug conjugates in the composition is from about 2 to about 4.
  • pharmaceutical compositions comprising an antibody-drug conjugate (e.g., any of the exemplary antibody-drug conjugates described herein) or a composition (e.g., any of the exemplary compositions described herein), and a pharmaceutically acceptable carrier.
  • therapeutic uses for the described ADC compounds and compositions e.g., in treating a cancer.
  • the present disclosure provides methods of treating a cancer (e.g., a cancer that expresses the CD48 antigen targeted by the antibody or antigen-binding fragment of the ADC). In some embodiments, the present disclosure provides methods of reducing or slowing the expansion of a cancer cell population in a subject. In some embodiments, the present disclosure provides methods of determining whether a subject having or suspected of having a cancer will be responsive to treatment with an ADC compound or composition disclosed herein.
  • a cancer e.g., a cancer that expresses the CD48 antigen targeted by the antibody or antigen-binding fragment of the ADC.
  • the present disclosure provides methods of reducing or slowing the expansion of a cancer cell population in a subject.
  • the present disclosure provides methods of determining whether a subject having or suspected of having a cancer will be responsive to treatment with an ADC compound or composition disclosed herein.
  • An exemplary embodiment is a method of treating a subject having or suspected of having a cancer, comprising administering to the subject a therapeutically effective amount of an antibody-drug conjugate, composition, or pharmaceutical composition (e.g., any of the exemplary antibody-drug conjugates, compositions, or pharmaceutical compositions disclosed herein).
  • the cancer expresses the target antigen CD48.
  • the cancer is a tumor or a hematological cancer.
  • the cancer is a breast cancer, multiple myeloma, plasma cell myeloma, leukemia, lymphoma, gastric cancer, acute myeloid leukemia, bladder cancer, brain cancer, bone marrow cancer, cervical cancer, chronic lymphocytic leukemia, colorectal cancer, esophageal cancer, hepatocellular cancer, lymphoblastic leukemia, follicular lymphoma, lymphoid malignancies of T-cell or B-cell origin, melanoma, myelogenous leukemia, myeloma, oral cancer, ovarian cancer, non-small cell lung cancer, chronic lymphocytic leukemia, prostate cancer, small cell lung cancer, or spleen cancer.
  • the cancer is a lymphoma or gastric cancer.
  • Another exemplary embodiment is a method of reducing or inhibiting the growth of a tumor in a subject, comprising administering to the subject a therapeutically effective amount of an antibody-drug conjugate, composition, or pharmaceutical composition (e.g., any of the exemplary antibody-drug conjugates, compositions, or pharmaceutical compositions disclosed herein).
  • the tumor expresses the target antigen CD48. .
  • the tumor is a breast cancer, gastric cancer, bladder cancer, brain cancer, cervical cancer, colorectal cancer, esophageal cancer, hepatocellular cancer, melanoma, oral cancer, ovarian cancer, non-small cell lung cancer, prostate cancer, small cell lung cancer, or spleen cancer.
  • the tumor is a gastric cancer.
  • administration of the antibody-drug conjugate, composition, or pharmaceutical composition reduces or inhibits the growth of the tumor by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 99%.
  • Another exemplary embodiment is a method of reducing or slowing the expansion of a cancer cell population in a subject, comprising administering to the subject a therapeutically effective amount of an antibody-drug conjugate, composition, or pharmaceutical composition (e.g., any of the exemplary antibody-drug conjugates, compositions, or pharmaceutical compositions disclosed herein).
  • the cancer cell population expresses the target antigen CD48.
  • the cancer cell population is from a tumor or a hematological cancer.
  • the cancer cell population is from a breast cancer, multiple myeloma, plasma cell myeloma, leukemia, lymphoma, gastric cancer, acute myeloid leukemia, bladder cancer, brain cancer, bone marrow cancer, cervical cancer, chronic lymphocytic leukemia, colorectal cancer, esophageal cancer, hepatocellular cancer, lymphoblastic leukemia, follicular lymphoma, lymphoid malignancies of T-cell or B-cell origin, melanoma, myelogenous leukemia, myeloma, oral cancer, ovarian cancer, non-small cell lung cancer, chronic lymphocytic leukemia, prostate cancer, small cell lung cancer, or spleen cancer.
  • the cancer cell population is from a lymphoma or gastric cancer.
  • administration of the antibody-drug conjugate, composition, or pharmaceutical composition reduces the cancer cell population by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 99%.
  • administration of the antibody-drug conjugate, composition, or pharmaceutical composition slows the expansion of the cancer cell population by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 99%.
  • Another exemplary embodiment is an antibody-drug conjugate, composition, or pharmaceutical composition (e.g., any of the exemplary antibody-drug conjugates, compositions, or pharmaceutical compositions disclosed herein) for use in treating a subject having or suspected of having a cancer.
  • the cancer expresses the target antigen CD48. .
  • the cancer is a tumor or a hematological cancer.
  • the cancer is a breast cancer, multiple myeloma, plasma cell myeloma, leukemia, lymphoma, gastric cancer, acute myeloid leukemia, bladder cancer, brain cancer, bone marrow cancer, cervical cancer, chronic lymphocytic leukemia, colorectal cancer, esophageal cancer, hepatocellular cancer, lymphoblastic leukemia, follicular lymphoma, lymphoid malignancies of T-cell or B-cell origin, melanoma, myelogenous leukemia, myeloma, oral cancer, ovarian cancer, non-small cell lung cancer, chronic lymphocytic leukemia, prostate cancer, small cell lung cancer, or spleen cancer.
  • the cancer is a lymphoma or gastric cancer.
  • Another exemplary embodiment is a use of an antibody-drug conjugate, composition, or pharmaceutical composition (e.g., any of the exemplary antibody-drug conjugates, compositions, or pharmaceutical compositions disclosed herein) in treating a subject having or suspected of having a cancer.
  • the cancer expresses the target antigen CD48.
  • the cancer is a tumor or a hematological cancer.
  • the cancer is a breast cancer, multiple myeloma, plasma cell myeloma, leukemia, lymphoma, gastric cancer, acute myeloid leukemia, bladder cancer, brain cancer, bone marrow cancer, cervical cancer, chronic lymphocytic leukemia, colorectal cancer, esophageal cancer, hepatocellular cancer, lymphoblastic leukemia, follicular lymphoma, lymphoid malignancies of T-cell or B-cell origin, melanoma, myelogenous leukemia, myeloma, oral cancer, ovarian cancer, non-small cell lung cancer, chronic lymphocytic leukemia, prostate cancer, small cell lung cancer, or spleen cancer.
  • the cancer is a lymphoma or gastric cancer.
  • Another exemplary embodiment is a use of an antibody-drug conjugate, composition, or pharmaceutical composition (e.g., any of the exemplary antibody-drug conjugates, compositions, or pharmaceutical compositions disclosed herein) in a method of manufacturing a medicament for treating a subject having or suspected of having a cancer.
  • the cancer expresses the target antigen CD48.
  • the cancer is a tumor or a hematological cancer.
  • the cancer is a breast cancer, multiple myeloma, plasma cell myeloma, leukemia, lymphoma, gastric cancer, acute myeloid leukemia, bladder cancer, brain cancer, bone marrow cancer, cervical cancer, chronic lymphocytic leukemia, colorectal cancer, esophageal cancer, hepatocellular cancer, lymphoblastic leukemia, follicular lymphoma, lymphoid malignancies of T-cell or B-cell origin, melanoma, myelogenous leukemia, myeloma, oral cancer, ovarian cancer, non-small cell lung cancer, chronic lymphocytic leukemia, prostate cancer, small cell lung cancer, or spleen cancer.
  • the cancer is a lymphoma or gastric cancer.
  • Another exemplary embodiment is a method of determining whether a subject having or suspected of having a cancer will be responsive to treatment with an antibody-drug conjugate, composition, or pharmaceutical composition (e.g., any of the exemplary antibody- drug conjugates, compositions, or pharmaceutical compositions disclosed herein) by providing a biological sample from the subject; contacting the sample with the antibody-drug conjugate; and detecting binding of the antibody-drug conjugate to cancer cells in the sample.
  • the cancer cells in the sample express the target antigen CD48.
  • the cancer expresses the target antigen CD48.
  • the cancer is a tumor or a hematological cancer.
  • the cancer is a breast cancer, multiple myeloma, plasma cell myeloma, leukemia, lymphoma, gastric cancer, acute myeloid leukemia, bladder cancer, brain cancer, bone marrow cancer, cervical cancer, chronic lymphocytic leukemia, colorectal cancer, esophageal cancer, hepatocellular cancer, lymphoblastic leukemia, follicular lymphoma, lymphoid malignancies of T-cell or B-cell origin, melanoma, myelogenous leukemia, myeloma, oral cancer, ovarian cancer, non-small cell lung cancer, chronic lymphocytic leukemia, prostate cancer, small cell lung cancer, or spleen cancer.
  • the cancer is a lymphoma or gastric cancer.
  • the sample is a tissue biopsy sample, a blood sample, or a bone marrow sample.
  • An exemplary embodiment is a method of producing an antibody-drug conjugate by reacting an antibody or antigen-binding fragment with a cleavable linker joined to an Mcl- 1 inhibitor under conditions that allow conjugation.
  • FIG. 1 are graphs showing the binding of candidate antibodies NOV3731 and NY258 and control antibody CD48A to wild type and mutated human CD48 proteins.
  • FIG. 2 are graphs showing the cytotoxic effects of CD48 MCL-1 antibody-drug conjugates to three endogeneous cancer cell lines, NCI-H929, KMS-21 BM and KMS-27.
  • FIG.3 are graphs showing the in vitro activity of the CD48 MCL-1 antibody-drug conjugate, NY920-L42-P1, alone or in combination with venetoclax or BCL2 Inhibitor Compound A1 in KMS-21-BM, NCI-H929, or KMS-27 cells. IgG-L42-P1 was used as a non- targeting control.
  • FIG.4 are graphs showing the in vitro activity of the CD48 MCL-1 antibody-drug conjugate, NY938-L42-P1, alone or in combination with venetoclax or BCL2 Inhibitor Compound A1 in KMS-21-BM, NCI-H929, or KMS-27 cells.
  • IgG-L42-P1 was used as a non- targeting control.
  • compositions and methods may be understood more readily by reference to the following detailed description taken in connection with the accompanying figures, which form a part of this disclosure.
  • the descriptions refer to compositions and methods of using the compositions. Where the disclosure describes or claims a feature or embodiment associated with a composition, such a feature or embodiment is equally applicable to the methods of using the composition. Likewise, where the disclosure describes or claims a feature or embodiment associated with a method of using a composition, such a feature or embodiment is equally applicable to the composition. [125] When a range of values is expressed, it includes embodiments using any particular value within the range.
  • an antibody drug conjugate is referred to as “Target X-L0-P0”, such a conjugate would comprise an antibody that binds Target X, a linker designated as L0, and a payload designated as P0.
  • an antibody drug conjugate is referred to as “anti- Target X-L0-P0”, such a conjugate would comprise an antibody that binds Target X, a linker designated as L0, and a payload designated as P0.
  • an antibody drug conjugate is referred to as “AbX-L0-P0”, such a conjugate would comprise the antibody designated as AbX, a linker designated as L0, and a payload designated as P0.
  • control antibody drug conjugate comprising a non-specific, isotype control antibody may be referenced as “isotype control IgG1-L0-P0” or “IgG1-L0-P0”.
  • Any formula given herein is also intended to represent unlabeled forms as well as isotopically labeled forms of the compounds. lsotopically labeled compounds have structures depicted by the formulae given herein except that one or more atoms are replaced by an atom having a selected atomic mass or mass number.
  • Isotopes that can be incorporated into compounds of the invention include, for example, isotopes of hydrogen, carbon, nitrogen, oxygen, fluorine, and chlorine, such as 3 H, 11 C, 13 C, 14 C, 15 N, 18 F, and 36 Cl. Accordingly, it should be understood that the present disclosure includes compounds that incorporate one or more of any of the aforementioned isotopes, including for example, radioactive isotopes, such as 3 H and 14 C, or those into which non-radioactive isotopes, such as 2 H and 13 C are present.
  • Such isotopically labelled compounds are useful in metabolic studies (with 14 C), reaction kinetic studies (with, for example 2 H or 3 H), detection or imaging techniques, such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT) including drug or substrate tissue distribution assays, or in radioactive treatment of patients.
  • PET positron emission tomography
  • SPECT single-photon emission computed tomography
  • an 18 F or labeled compound may be particularly desirable for PET or SPECT studies.
  • Isotopically-labeled compounds can generally be prepared by conventional techniques known to those skilled in the art, e.g., using an appropriate isotopically-labeled reagents in place of the non-labeled reagent previously employed.
  • the term “about” refers to a range of values which are 10% more or less than the specified value. In another embodiment, the term “about” refers to a range of values which are 5% more or less than the specified value. In another embodiment, the term “about” refers to a range of values which are 1% more or less than the specified value.
  • the terms “antibody-drug conjugate,” “antibody conjugate,” “conjugate,” “immunoconjugate,” and “ADC” are used interchangeably, and refer to one or more therapeutic compounds (e.g., an Mcl-1 inhibitor) that is linked to one or more antibodies or antigen-binding fragments.
  • Ab an antibody or antigen-binding fragment
  • L a linker moiety
  • D a drug moiety (e.g., an Mcl-1 inhibitor drug moiety)
  • p the number of drug moieties per antibody or antigen-binding fragment.
  • p refers to the number of Mcl-1 inhibitor compounds linked to the antibody or antigen-binding fragment.
  • antibody is used in the broadest sense to refer to an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the variable region of the immunoglobulin molecule.
  • An antibody can be polyclonal or monoclonal, multiple or single chain, or an intact immunoglobulin, and may be derived from natural sources or from recombinant sources.
  • An “intact” antibody is a glycoprotein that typically comprises at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
  • the heavy chain constant region comprises three domains, CH1, CH2 and CH3.
  • Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
  • the light chain constant region is comprised of one domain, CL.
  • the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • Each VH and VL is composed of three CDRs and four FRs arranged from amino-terminus to carboxyl-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1q) of the classical complement system.
  • An antibody can be a monoclonal antibody, human antibody, humanized antibody, camelised antibody, or chimeric antibody.
  • the antibodies can be of any isotype (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2), or subclass.
  • An antibody can be an intact antibody or an antigen-binding fragment thereof.
  • antibody fragment or “antigen-binding fragment” or “functional antibody fragment,” as used herein, refers to at least one portion of an antibody that retains the ability to specifically interact with (e.g., by binding, steric hinderance, stabilizing/destabilizing, spatial distribution) an epitope of an antigen (e.g., CD48).
  • Antigen-binding fragments may also retain the ability to internalize into an antigen-expressing cell. In some embodiments, antigen-binding fragments also retain immune effector activity.
  • the terms antibody, antibody fragment, antigen-binding fragment, and the like, are intended to embrace the use of binding domains from antibodies in the context of larger macromolecules such as ADCs. It has been shown that fragments of a full-length antibody can perform the antigen binding function of a full-length antibody.
  • antibody fragments include, but are not limited to, Fab, Fab’, F(ab’)2, Fv fragments, scFv antibody fragments, disulfide-linked Fvs (sdFv), a Fd fragment consisting of the VH and CH1 domains, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, multi-specific antibodies formed from antibody fragments such as a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region, and an isolated CDR or other epitope binding fragments of an antibody.
  • An antigen-binding fragment can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, bispecific or multi-specific antibody constructs, ADCs, v-NAR and bis-scFv (see, e.g., Holliger and Hudson (2005) Nat Biotechnol.23(9):1126-36).
  • Antigen-binding fragments can also be grafted into scaffolds based on polypeptides such as a fibronectin type III (Fn3) (see US Patent No.6,703,199, which describes fibronectin polypeptide minibodies).
  • scFv refers to a fusion protein comprising at least one antigen-binding fragment comprising a variable region of a light chain and at least one antigen-binding fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked, e.g., via a synthetic linker, e.g., a short flexible polypeptide linker, and capable of being expressed as a single chain polypeptide, and wherein the scFv retains the specificity of the intact antibody from which it is derived.
  • a synthetic linker e.g., a short flexible polypeptide linker
  • an scFv may have the VL and VH variable regions in either order, e.g., with respect to the N- terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.
  • Antigen-binding fragments are obtained using conventional techniques known to those of skill in the art, and the binding fragments are screened for utility (e.g., binding affinity, internalization) in the same manner as are intact antibodies.
  • Antigen-binding fragments for example, may be prepared by cleavage of the intact protein, e.g., by protease or chemical cleavage.
  • CDR complementarity determining region
  • HCDR1, HCDR2, and HCDR3 three CDRs in each heavy chain variable region
  • LCDR1, LCDR2, and LCDR3 three CDRs in each light chain variable region
  • the precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al. (1991) “Sequences of Proteins of Immunological Interest,” 5th Ed.
  • the CDRs correspond to the amino acid residues that are defined as part of the Kabat CDR, together with the amino acid residues that are defined as part of the Chothia CDR.
  • the CDRs defined according to the “Chothia” number scheme are also sometimes referred to as “hypervariable loops.”
  • the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1) (e.g., insertion(s) after position 35), 50- 65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1) (e.g., insertion(s) after position 27), 50- 56 (LCDR2), and 89-97 (LCDR3).
  • the CDR amino acids in the VH are numbered 26-32 (HCDR1) (e.g., insertion(s) after position 31), 52-56 (HCDR2), and 95-102 (HCDR3); and the amino acid residues in VL are numbered 26-32 (LCDR1) (e.g., insertion(s) after position 30), 50-52 (LCDR2), and 91-96 (LCDR3).
  • the CDRs comprise or consist of, e.g., amino acid residues 26-35 (HCDR1), 50-65 (HCDR2), and 95- 102 (HCDR3) in human VH and amino acid residues 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3) in human VL.
  • the CDR amino acid residues in the VH are numbered approximately 26-35 (CDR1), 51-57 (CDR2) and 93-102 (CDR3), and the CDR amino acid residues in the VL are numbered approximately 27-32 (CDR1), 50-52 (CDR2), and 89-97 (CDR3).
  • the CDR regions of an antibody may be determined using the program IMGT/DomainGap Align.
  • the term "monoclonal antibody,” as used herein, refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic epitope. In contrast, conventional (polyclonal) antibody preparations typically include a multitude of antibodies directed against (or specific for) different epitopes. The modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present disclosure may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256:495, or may be made by recombinant DNA methods (see, e.g., US Patent No. 4,816,567).
  • Monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991) Nature 352:624-8, and Marks et al. (1991) J Mol Biol. 222:581-97, for example.
  • the term also includes preparations of antibody molecules of single molecular composition.
  • a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • the monoclonal antibodies described herein can be non-human, human, or humanized.
  • the term specifically includes "chimeric" antibodies, in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they specifically bind the target antigen and/or exhibit the desired biological activity.
  • human antibody refers an antibody produced by a human or an antibody having an amino acid sequence of an antibody produced by a human.
  • the term includes antibodies having variable regions in which both the framework and CDR regions are derived from sequences of human origin.
  • the constant region is also derived from such human sequences, e.g., human germline sequences, or mutated versions of human germline sequences or antibody containing consensus framework sequences derived from human framework sequences analysis, for example, as described in Knappik et al. ((2000) J Mol Biol. 296(1 ):57-86).
  • immunoglobulin variable domains e.g., CDRs
  • CDRs may be defined using well known numbering schemes, e.g., the Kabat numbering scheme, the Chothia numbering scheme, or a combination of Kabat and Chothia, and/or ImMunoGenTics (IMGT) numbering.
  • the human antibodies of the invention may include amino acid residues not encoded by human sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo, or a conservative substitution to promote stability or manufacturing).
  • the term “human antibody,” as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • recombinant human antibody refers to a human antibody that is prepared, expressed, created, or isolated by recombinant means, such as antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, antibodies isolated from a host cell transformed to express the human antibody, e.g., from a transfectoma, antibodies isolated from a recombinant, combinatorial human antibody library, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of all or a portion of a human immunoglobulin gene, sequences to other DNA sequences.
  • recombinant means such as antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, antibodies isolated from a host cell transformed to express the human antibody, e.g., from a transfectoma, antibodies isolated from a
  • Such recombinant human antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences.
  • such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
  • chimeric antibody refers to antibodies wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
  • the variable regions of both heavy and light chains correspond to the variable regions of antibodies derived from one species with the desired specificity, affinity, and activity while the constant regions are homologous to antibodies derived from another species (e.g., human) to minimize an immune response in the latter species.
  • humanized antibody refers to forms of antibodies that contain sequences from non-human (e.g., murine) antibodies as well as human antibodies. Such antibodies are a type of chimeric antibody which contain minimal sequence derived from non-human immunoglobulin.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the framework (FR) regions are those of a human immunoglobulin sequence.
  • the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • the humanized antibody can be further modified by the substitution of residues, either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or activity.
  • an Fc region refers to a polypeptide comprising the CH3, CH2 and at least a portion of the hinge region of a constant domain of an antibody.
  • an Fc region may include a CH4 domain, present in some antibody classes.
  • An Fc region may comprise the entire hinge region of a constant domain of an antibody.
  • an antibody or antigen-binding fragment comprises an Fc region and a CH1 region of an antibody.
  • an antibody or antigen-binding fragment comprises an Fc region CH3 region of an antibody.
  • an antibody or antigen-binding fragment comprises an Fc region, a CH1 region, and a kappa/lambda region from the constant domain of an antibody.
  • an antibody or antigen binding fragment comprises a constant region, e.g., a heavy chain constant region and/or a light chain constant region.
  • a constant region is modified compared to a wild-type constant region. That is, the polypeptide may comprise alterations or modifications to one or more of the three heavy chain constant domains (CH1, CH2, or CH3) and/or to the light chain constant region domain (CL).
  • Example modifications include additions, deletions, or substitutions of one or more amino acids in one or more domains. Such changes may be included to optimize effector function, half-life, etc.
  • Internalizing refers to an antibody or antigen-binding fragment that is capable of being taken through the cell’s lipid bilayer membrane to an internal compartment (i.e., “internalized”) upon binding to the cell, preferably into a degradative compartment in the cell.
  • an internalizing anti-HER2 antibody is one that is capable of being taken into the cell after binding to HER2 on the cell membrane.
  • the antibody or antigen- binding fragment used in the ADCs disclosed herein targets a cell surface antigen (e.g., CD48) and is an internalizing antibody or internalizing antigen-binding fragment (i.e., the ADC transfers through the cellular membrane after antigen binding).
  • the internalizing antibody or antigen-binding fragment binds a receptor on the cell surface.
  • An internalizing antibody or internalizing antigen-binding fragment that targets a receptor on the cell membrane may induce receptor-mediated endocytosis.
  • the internalizing antibody or internalizing antigen-binding fragment is taken into the cell via receptor-mediated endocytosis.
  • Non-internalizing as used herein in reference to an antibody or antigen-binding fragment refers to an antibody or antigen-binding fragment that remains at the cell surface upon binding to the cell.
  • the antibody or antigen-binding fragment used in the ADCs disclosed herein targets a cell surface antigen and is a non-internalizing antibody or non-internalizing antigen-binding fragment (i.e., the ADC remains at the cell surface and does not transfer through the cellular membrane after antigen binding).
  • the non-internalizing antibody or antigen-binding fragment binds a non- internalizing receptor or other cell surface antigen.
  • non-internalizing cell surface antigens include but are not limited to CA125 and CEA, and antibodies that bind to non- internalizing antigen targets are also known in the art (see, e.g., Bast et al. (1981) J Clin Invest.68(5):1331-7; Scholler and Urban (2007) Biomark Med.1(4):513-23; and Boudousq et al. (2013) PLoS One 8(7):e69613).
  • binding specificity refers to the ability of an individual antibody or antigen binding fragment to preferentially react with one antigenic determinant over a different antigenic determinant.
  • the degree of specificity indicates the extent to which an antibody or fragment preferentially binds to one antigenic determinant over a different antigenic determinant.
  • the term “specific,” “specifically binds,” and “binds specifically” refers to a binding reaction between an antibody or antigen-binding fragment (e.g., an anti-CD48 antibody) and a target antigen (e.g., CD48) in a heterogeneous population of proteins and other biologics.
  • Antibodies can be tested for specificity of binding by comparing binding to an appropriate antigen to binding to an irrelevant antigen or antigen mixture under a given set of conditions.
  • a “specific antibody” or a “target-specific antibody” is one that only binds the target antigen (e.g., CD48), but does not bind (or exhibits minimal binding) to other antigens.
  • an antibody or antigen-binding fragment that specifically binds a target antigen has a KD of less than 1x10 -6 M, less than 1x10 -7 M, less than 1x10 -8 M, less than 1x10 -9 M, less than 1x10 -10 M, less than 1x10 -11 M, less than 1x10 -12 M, or less than 1x10 -13 M.
  • the KD is 1 pM to 500 pM. In some embodiments, the KD is between 500 pM to 1 ⁇ M, 1 ⁇ M to 100 nM, or 100 mM to 10 nM.
  • the term “affinity,” as used herein, refers to the strength of interaction between antibody and antigen at single antigenic sites. Without being bound by theory, within each antigen binding site, the variable region of the antibody “arm” interacts through weak non- covalent forces with the antigen at numerous sites; the more interactions, typically the stronger the affinity.
  • the binding affinity of an antibody is the sum of the attractive and repulsive forces operating between the antigenic determinant and the binding site of the antibody.
  • the term “k on " or "k a " refers to the on-rate constant for association of an antibody to the antigen to form the antibody/antigen complex. The rate can be determined using standard assays, such as a surface plasmon resonance, biolayer inferometry, or ELISA assay.
  • k off or "k d ” refers to the off-rate constant for dissociation of an antibody from the antibody/antigen complex. The rate can be determined using standard assays, such as a surface plasmon resonance, biolayer inferometry, or ELISA assay.
  • K D refers to the equilibrium dissociation constant of a particular antibody- antigen interaction. K D is calculated by k a /k d . The rate can be determined using standard assays, such as a surface plasmon resonance, biolayer inferometry, or ELISA assay.
  • epitopope refers to the portion of an antigen capable of being recognized and specifically bound by an antibody (or antigen-binding fragment).
  • Epitope determinants generally consist of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and can have specific three-dimensional structural characteristics, as well as specific charge characteristics.
  • epitopes can be formed from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of the polypeptide.
  • An epitope may be “linear” or “conformational.” Conformational and linear epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
  • the epitope bound by an antibody may be identified using any epitope mapping technique known in the art, including X-ray crystallography for epitope identification by direct visualization of the antigen-antibody complex, as well as monitoring the binding of the antibody to fragments or mutated variations of the antigen, or monitoring solvent accessibility of different parts of the antibody and the antigen.
  • Exemplary strategies used to map antibody epitopes include, but are not limited to, array-based oligo-peptide scanning, limited proteolysis, site-directed mutagenesis, high-throughput mutagenesis mapping, hydrogen-deuterium exchange, and mass spectrometry (see, e.g., Gershoni et al.
  • competitive binding is identified when a test antibody or binding protein reduces binding of a reference antibody or binding protein to a target antigen such as CD48 (e.g., a binding protein comprising CDRs and/or variable domains selected from those identified in Tables 3-5), by at least about 50% in the cross-blocking assay (e.g., 50%, 60%, 70%, 80%, 90%, 95%, 99%, 99.5%, or more, or any percentage in between), and/or vice versa.
  • a test antibody or binding protein reduces binding of a reference antibody or binding protein to a target antigen such as CD48 (e.g., a binding protein comprising CDRs and/or variable domains selected from those identified in Tables 3-5), by at least about 50% in the cross-blocking assay (e.g., 50%, 60%, 70%, 80%, 90%, 95%, 99%, 99.5%, or more, or any percentage in between), and/or vice versa.
  • CD48 e.g., a binding protein comprising C
  • competitive binding can be due to shared or similar (e.g., partially overlapping) epitopes, or due to steric hindrance where antibodies or binding proteins bind at nearby epitopes (see, e.g., Tzartos, Methods in Molecular Biology (Morris, ed. (1998) vol.66, pp.55-66)).
  • competitive binding can be used to sort groups of binding proteins that share similar epitopes. For example, binding proteins that compete for binding can be “binned” as a group of binding proteins that have overlapping or nearby epitopes, while those that do not compete are placed in a separate group of binding proteins that do not have overlapping or nearby epitopes.
  • peptide As used herein, the terms “peptide,” “polypeptide,” and “protein” are used interchangeably to refer to a polymer of amino acid residues.
  • the terms encompass amino acid polymers comprising two or more amino acids joined to each other by peptide bonds, amino acid polymers in which one or more amino acid residues is an artificial chemical mimetic of a corresponding naturally-occurring amino acid, as well as naturally-occurring amino acid polymers and non-naturally-occurring amino acid polymers.
  • the terms include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.
  • the terms also include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof. Unless otherwise indicated, a particular polypeptide sequence also implicitly encompasses conservatively modified variants thereof.
  • a "recombinant” protein refers to a protein (e.g., an antibody) made using recombinant techniques, e.g., through the expression of a recombinant nucleic acid.
  • An "isolated" protein refers to a protein unaccompanied by at least some of the material with which it is normally associated in its natural state.
  • a naturally- occurring polynucleotide or polypeptide present in a living organism is not isolated, but the same polynucleotide or polypeptide separated from some or all of the coexisting materials in the living organism, is isolated.
  • the definition includes the production of an antibody in a wide variety of organisms and/or host cells that are known in the art.
  • an "isolated antibody,” as used herein, is an antibody that has been identified and separated from one or more (e.g., the majority) of the components (by weight) of its source environment, e.g., from the components of a hybridoma cell culture or a different cell culture that was used for its production. In some embodiments, the separation is performed such that it sufficiently removes components that may otherwise interfere with the suitability of the antibody for the desired applications (e.g., for therapeutic use).
  • Methods for preparing isolated antibodies are known in the art and include, without limitation, protein A chromatography, anion exchange chromatography, cation exchange chromatography, virus retentive filtration, and ultrafiltration.
  • variant refers to a nucleic acid sequence or an amino acid sequence that differs from a reference nucleic acid sequence or amino acid sequence respectively, but retains one or more biological properties of the reference sequence.
  • a variant may contain one or more amino acid substitutions, deletions, and/or insertions (or corresponding substitution, deletion, and/or insertion of codons) with respect to a reference sequence. Changes in a nucleic acid variant may not alter the amino acid sequence of a peptide encoded by the reference nucleic acid sequence, or may result in amino acid substitutions, additions, deletions, fusions, and/or truncations.
  • a nucleic acid variant disclosed herein encodes an identical amino acid sequence to that encoded by the unmodified nucleic acid or encodes a modified amino acid sequence that retains one or more functional properties of the unmodified amino acid sequence. Changes in the sequence of peptide variants are typically limited or conservative, so that the sequences of the unmodified peptide and the variant are closely similar overall and, in many regions, identical. In some embodiments, a peptide variant retains one or more functional properties of the unmodified peptide sequence. A variant and unmodified peptide can differ in amino acid sequence by one or more substitutions, additions, deletions in any combination.
  • a variant of a nucleic acid or peptide can be a naturally-occurring variant or a variant that is not known to occur naturally. Variants of nucleic acids and peptides may be made by mutagenesis techniques, by direct synthesis, or by other techniques known in the art. A variant does not necessarily require physical manipulation of the reference sequence. As long as a sequence contains a different nucleic acid or amino acid as compared to a reference sequence, it is considered a “variant” regardless of how it was synthesized. In some embodiments, a variant has high sequence identity (i.e., 60% nucleic acid or amino acid sequence identity or higher) as compared to a reference sequence.
  • a peptide variant encompasses polypeptides having amino acid substitutions, deletions, and/or insertions as long as the polypeptide has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% amino acid sequence identity with a reference sequence, or with a corresponding segment (e.g., a functional fragment) of a reference sequence, e.g., those variants that also retain one or more functions of the reference sequence.
  • a corresponding segment e.g., a functional fragment
  • a nucleic acid variant encompasses polynucleotides having amino acid substitutions, deletions, and/or insertions as long as the polynucleotide has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% nucleic acid sequence identity with a reference sequence, or with a corresponding segment (e.g., a functional fragment) of a reference sequence.
  • a corresponding segment e.g., a functional fragment
  • conservatively modified variants refer to those nucleic acids which encode identical or essentially identical amino acid sequences.
  • nucleic acid variations are “silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid.
  • each codon in a nucleic acid can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid that encodes a polypeptide is implicit in each described sequence.
  • conservatively modified variants include individual substitutions, deletions, or additions to a polypeptide sequence which result in the substitution of an amino acid with a chemically similar amino acid. Conservative substitutions providing functionally similar amino acids are well known in the art.
  • conservative sequence modifications refers to amino acid modifications that do not significantly affect or alter the binding characteristics of, e.g., an antibody or antigen-binding fragment containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions, and deletions. Modifications can be introduced into an antibody or antigen-binding fragment by standard techniques known in the art, such as, e.g., site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
  • beta- branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • one or more amino acid residues within an antibody can be replaced with other amino acid residues from the same side chain family and the altered antibody can be tested using the functional assays described herein.
  • homologous refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules.
  • a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous or identical at that position.
  • the homology between two sequences is a direct function of the number of matching or homologous positions. For example, if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are matched or homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous.
  • Percentage of “sequence identity” can be determined by comparing two optimally aligned sequences over a comparison window, where the fragment of the amino acid sequence in the comparison window may comprise additions or deletions (e.g., gaps or overhangs) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
  • the percentage can be calculated by determining the number of positions at which the identical amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison, and multiplying the result by 100 to yield the percentage of sequence identity.
  • the output is the percent identity of the subject sequence with respect to the query sequence.
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
  • amino acid identity or homology between proteins disclosed herein and variants thereof, including variants of target antigens (such as CD48) and variants of antibody variable domains (including individual variant CDRs) is at least 80% to the sequences depicted herein, e.g., identities or homologies of at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, almost 100%, or 100%.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J Mol Biol. 48:444-53) algorithm which has been incorporated into the GAP program in the GCG software package, using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1 , 2, 3, 4, 5, or 6.
  • the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package, using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1 , 2, 3, 4, 5, or 6.
  • An exemplary set of parameters is a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
  • the percent identity between two amino acid or nucleotide sequences can also be determined using the algorithm of Meyers and Miller ((1989) CABIOS 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • agent is used herein to refer to a chemical compound, a mixture of chemical compounds, a biological macromolecule, an extract made from biological materials, or a combination of two or more thereof.
  • therapeutic agent or “drug” refers to an agent that is capable of modulating a biological process and/or has biological activity.
  • Mcl-1 inhibitors and the ADCs comprising them, as described herein, are exemplary therapeutic agents.
  • chemotherapeutic agent or “anti-cancer agent” is used herein to refer to all agents that are effective in treating cancer (regardless of mechanism of action). Inhibition of metastasis or angiogenesis is frequently a property of a chemotherapeutic agent.
  • Chemotherapeutic agents include antibodies, biological molecules, and small molecules, and encompass the Mcl-1 inhibitors and ADCs comprising them, as described herein.
  • a chemotherapeutic agent may be a cytotoxic or cytostatic agent.
  • cytostatic agent refers to an agent that inhibits or suppresses cell growth and/or multiplication of cells.
  • cytotoxic agent refers to a substance that causes cell death primarily by interfering with a cell’s expression activity and/or functioning.
  • Mcl-1 myeloid cell leukemia 1
  • Mcl-1 refers to any native form of human Mcl-1 , an anti-apoptotic member of the Bcl-2 protein family.
  • the term encompasses full-length human Mcl-1 (e.g., UniProt Reference Sequence: Q07820; SEQ ID NO:79), as well as any form of human Mcl-1 that may result from cellular processing.
  • Mcl-1 also encompasses functional variants or fragments of human Mcl-1 , including but not limited to splice variants, allelic variants, and isoforms that retain one or more biologic functions of human Mcl-1 (i.e., variants and fragments are encompassed unless the context indicates that the term is used to refer to the wild-type protein only).
  • Mcl-1 can be isolated from human, or may be produced recombinantly or by synthetic methods.
  • inhibitor means to reduce a biological activity or process by a measurable amount, and can include but does not require complete prevention or inhibition. In some embodiments, “inhibition” means to reduce the expression and/or activity of Mcl-1 and/or one or more upstream modulators or downstream targets thereof.
  • Mcl-1 inhibitor refers to an agent capable of reducing the expression and/or activity of Mcl-1 and/or one or more upstream modulators or downstream targets thereof.
  • Exemplary Mcl-1 modulators (including exemplary inhibitors of Mcl-1) are described in WO 2015/097123; WO 2016/207216; WO 2016/207217; WO 2016/207225; WO 2016/207226; WO 2017/125224; WO 2019/035899, WO 2019/035911 , WO 2019/035914, WO 2019/035927, US 2019/0055264, WO 2016/033486, WO 2017/147410, WO 2018/183418, and WO 2017/182625, each of which are incorporated herein by reference as exemplary Mcl-1 modulators, including exemplary Mcl-1 inhibitors, that can be included as drug moieties in the disclosed ADCs.
  • exemplary Mcl-1 inhibitors that can be included as drug moieties in the disclosed ADCs.
  • exemplary Mcl-1 inhibitors that can
  • each variable is defined as in WO 2 019/035911; WO 2019/035899; WO 2019/035914; or WO 2019/035927.
  • Specific examples include, e.g., wherein each compound as a drug payload can be conjugated to an antibody or a linker via the nitrogen atom of the N-methyl in piperazinyl functional group of the compound.
  • the terms "derivative” and “analog” when referring to an Mcl-1 inhibitor, or the like means any such compound that retains essentially the same, similar, or enhanced biological function or activity as compared to the original compound but has an altered chemical or biological structure.
  • Mcl-1 inhibitor drug moiety refers to the component of an ADC or composition that provides the structure of an Mcl-1 inhibitor compound or a compound modified for attachment to an ADC that retains essentially the same, similar, or enhanced biological function or activity as compared to the original compound.
  • Mcl-1 inhibitor drug moiety is component (D) in an ADC of Formula (1).
  • cancer refers to the presence of cells possessing characteristics typical of cancer-causing cells, such as uncontrolled proliferation, immortality, metastatic potential, rapid growth and proliferation rate, and/or certain morphological features. Often, cancer cells can be in the form of a tumor or mass, but such cells may exist alone within a subject, or may circulate in the blood stream as independent cells, such as leukemic or lymphoma cells.
  • cancer includes all types of cancers and cancer metastases, including hematological cancers, solid tumors, sarcomas, carcinomas and other solid and non-solid tumor cancers.
  • Hematological cancers may include B-cell malignancies, cancers of the blood (leukemias), cancers of plasma cells (myelomas, e.g., multiple myeloma), or cancers of the lymph nodes (lymphomas).
  • B-cell malignancies include chronic lymphocytic leukemia (CLL), follicular lymphoma, mantle cell lymphoma, and diffuse large B-cell lymphoma.
  • Leukemias may include acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), chronic myelomonocytic leukemia (CMML), acute monocytic leukemia (AMoL), etc.
  • Lymphomas may include Hodgkin's lymphoma, non-Hodgkin's lymphoma, etc.
  • Other hematologic cancers may include myelodysplasia syndrome (MDS).
  • Solid tumors may include carcinomas such as adenocarcinoma, e.g., breast cancer, pancreatic cancer, prostate cancer, colon or colorectal cancer, lung cancer, gastric cancer, cervical cancer, endometrial cancer, ovarian cancer, cholangiocarcinoma, glioma, melanoma, etc.
  • carcinomas such as adenocarcinoma, e.g., breast cancer, pancreatic cancer, prostate cancer, colon or colorectal cancer, lung cancer, gastric cancer, cervical cancer, endometrial cancer, ovarian cancer, cholangiocarcinoma, glioma, melanoma, etc.
  • the cancer is a breast cancer, multiple myeloma, plasma cell myeloma, leukemia, lymphoma, gastric cancer, acute myeloid leukemia, bladder cancer, brain cancer, bone marrow cancer, cervical cancer, chronic lymphocytic leukemia, colorectal cancer, esophageal cancer, hepatocellular cancer, lymphoblastic leukemia, follicular lymphoma, lymphoid malignancies of T-cell or B-cell origin, melanoma, myelogenous leukemia, myeloma, oral cancer, ovarian cancer, non-small cell lung cancer, chronic lymphocytic leukemia, prostate cancer, small cell lung cancer, or spleen cancer.
  • the cancer is a lymphoma or gastric cancer.
  • the cancer is a hematological cancer, e.g., a leukemia, a lymphoma, or a myeloma.
  • a hematological cancer e.g., a leukemia, a lymphoma, or a myeloma.
  • an combination described herein can be used to treat cancers malignancies, and related disorders, including, but not limited to, e.g., an acute leukemia, e.g., B-cell acute lymphoid leukemia (BALL), T-cell acute lymphoid leukemia (TALL), acute myeloid leukemia (AML), acute lymphoid leukemia (ALL); a chronic leukemia, e.g., chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL); an additional hematologic cancer or hematologic condition, e.g., B cell prolymphocytic leukemia, blastic plasmacytoi
  • the term “tumor” refers to any mass of tissue that results from excessive cell growth or proliferation, either benign or malignant, including precancerous lesions.
  • the tumor is a breast cancer, gastric cancer, bladder cancer, brain cancer, cervical cancer, colorectal cancer, esophageal cancer, hepatocellular cancer, melanoma, oral cancer, ovarian cancer, non-small cell lung cancer, prostate cancer, small cell lung cancer, or spleen cancer.
  • the tumor is a gastric cancer.
  • tumor cell and “cancer cell” may be used interchangeably herein and refer to individual cells or the total population of cells derived from a tumor or cancer, including both non-tumorigenic cells and cancer stem cells.
  • tumor cell and “cancer cell” will be modified by the term “non-tumorigenic” when referring solely to those cells lacking the capacity to renew and differentiate to distinguish those cells from cancer stem cells.
  • target-negative refers to the absence of target antigen expression by a cell or tissue.
  • target-positive target antigen-positive
  • antigen-positive refers to the presence of target antigen expression.
  • a cell or a cell line that does not express a target antigen may be described as target-negative, whereas a cell or cell line that expresses a target antigen may be described as target-positive.
  • the terms “subject” and “patient” are used interchangeably herein to refer to any human or non-human animal in need of treatment.
  • Non-human animals include all vertebrates (e.g., mammals and non-mammals) such as any mammal.
  • mammals include humans, chimpanzees, apes, monkeys, cattle, horses, sheep, goats, swine, rabbits, dogs, cats, rats, mice, and guinea pigs.
  • Non-limiting examples of non-mammals include birds and fish.
  • the subject is a human.
  • a subject in need of treatment refers to a subject that would benefit biologically, medically, or in quality of life from a treatment (e.g., a treatment with any one or more of the exemplary ADC compounds described herein).
  • treatment refers to any improvement of any consequence of disease, disorder, or condition, such as prolonged survival, less morbidity, and/or a lessening of side effects which result from an alternative therapeutic modality.
  • treatment comprises delaying or ameliorating a disease, disorder, or condition (i.e., slowing or arresting or reducing the development of a disease or at least one of the clinical symptoms thereof).
  • treatment comprises delaying, alleviating, or ameliorating at least one physical parameter of a disease, disorder, or condition, including those which may not be discernible by the patient.
  • treatment comprises modulating a disease, disorder, or condition, either physically (e.g., stabilization of a discernible symptom), physiologically (e.g., stabilization of a physical parameter), or both.
  • treatment comprises administration of a described ADC compound or composition to a subject, e.g., a patient, to obtain a treatment benefit enumerated herein.
  • the treatment can be to cure, heal, alleviate, delay, relieve, alter, remedy, ameliorate, palliate, improve, or affect a disease, disorder, or condition (e.g., a cancer), the symptoms of a disease, disorder, or condition (e.g., a cancer), or a predisposition toward a disease, disorder, or condition (e.g., a cancer).
  • a disease, disorder, or condition e.g., a cancer
  • the symptoms of a disease, disorder, or condition e.g., a cancer
  • a predisposition toward a disease, disorder, or condition e.g., a cancer
  • the term “prevent”, “preventing,” or “prevention” of a disease, disorder, or condition refers to the prophylactic treatment of the disease, disorder, or condition; or delaying the onset or progression of the disease, disorder, or condition.
  • a "pharmaceutical composition” refers to a preparation of a composition, e.g., an ADC compound or composition, in addition to at least one other (and optionally more than one other) component suitable for administration to a subject, such as a pharmaceutically acceptable carrier, stabilizer, diluent, dispersing agent, suspending agent, thickening agent, and/or excipient.
  • a pharmaceutically acceptable carrier such as a pharmaceutically acceptable carrier, stabilizer, diluent, dispersing agent, suspending agent, thickening agent, and/or excipient.
  • the pharmaceutical compositions provided herein are in such form as to permit administration and subsequently provide the intended biological activity of the active ingredient(s) and/or to achieve a therapeutic effect.
  • the pharmaceutical compositions provided herein preferably contain no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • Pharmaceutically acceptable carriers may enhance or stabilize the composition or can be used to facilitate preparation of the composition.
  • Pharmaceutically acceptable carriers can include solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drug stabilizers, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, and the like and combinations thereof, as would be known to those skilled in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp.1289- 1329). Except insofar as any conventional carrier is incompatible with the active ingredient, its use in the therapeutic or pharmaceutical compositions is contemplated.
  • preservatives e.g., antibacterial agents, antifungal agents
  • isotonic agents e.g., absorption delaying agents, salts, preservatives, drug stabilizers, binders, excipients, disintegration agents, lubricants, sweetening
  • the carrier may be selected to minimize adverse side effects in the subject, and/or to minimize degradation of the active ingredient(s).
  • An adjuvant may also be included in any of these formulations.
  • excipient refers to an inert substance added to a pharmaceutical composition to further facilitate administration of an active ingredient.
  • Formulations for parenteral administration can, for example, contain excipients such as sterile water or saline, polyalkylene glycols such as polyethylene glycol, vegetable oils, or hydrogenated napthalenes.
  • excipients include, but are not limited to, calcium bicarbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, ethylene-vinyl acetate co-polymer particles, and surfactants, including, for example, polysorbate 20.
  • pharmaceutically acceptable salt refers to a salt which does not abrogate the biological activity and properties of the compounds of the invention, and does not cause significant irritation to a subject to which it is administered.
  • salts include, but are not limited to: (a) acid addition salts formed with inorganic acids, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid, nitric acid and the like; and salts formed with organic acids, for example, acetic acid, oxalic acid, tartaric acid, succinic acid, maleic acid, fumaric acid, gluconic acid, citric acid, malic acid, ascorbic acid, benzoic acid, tannic acid, palmitic acid, alginic acid, polyglutamic acid, naphthalenesulfonic acid, methanesulfonic acid, p-toluenesulfonic acid, naphthalenedisulfonic acid, polygalacturonic acid, and the like; and (b) salts formed from elemental anions such as chlorine, bromine, and iodine.
  • inorganic acids for example, hydrochloric acid, hydrobromic acid, sulfuric acid, phospho
  • the antibody-drug conjugates (ADCs), linkers, payloads and linker-payloads described herein can contain a monovalent anionic counterion M1-. Any suitable anionic counterion can be used.
  • the monovalent anionic counterion is a pharmaceutically acceptable monovalent anionic counterion.
  • the monovalent anionic counterion M1- can be selected from bromide, chloride, iodide, acetate, trifluoroacetate, benzoate, mesylate, tosylate, triflate, formate, or the like. In some embodiments, the monovalent anionic counterion M1- is trifluoroacetate or formate.
  • the term “therapeutically effective amount” or “therapeutically effective dose,” refers to an amount of a compound described herein, e.g., an ADC compound or composition described herein, to effect the desired therapeutic result (i.e., reduction or inhibition of an enzyme or a protein activity, amelioration of symptoms, alleviation of symptoms or conditions, delay of disease progression, a reduction in tumor size, inhibition of tumor growth, prevention of metastasis).
  • a therapeutically effective amount does not induce or cause undesirable side effects.
  • a therapeutically effective amount induces or causes side effects but only those that are acceptable by a treating clinician in view of a patient’s condition.
  • a therapeutically effective amount is effective for detectable killing, reduction, and/or inhibition of the growth or spread of cancer cells, the size or number of tumors, and/or other measure of the level, stage, progression and/or severity of a cancer.
  • the term also applies to a dose that will induce a particular response in target cells, e.g., a reduction, slowing, or inhibition of cell growth.
  • a therapeutically effective amount can be determined by first administering a low dose, and then incrementally increasing that dose until the desired effect is achieved.
  • a therapeutically effective amount can also vary depending upon the intended application (in vitro or in vivo), or the subject and disease condition being treated, e.g., the weight and age of the subject, the severity of the disease condition, the manner of administration and the like, which can readily be determined by one of ordinary skill in the art.
  • the specific amount may vary depending on, for example, the particular pharmaceutical composition, the subject and their age and existing health conditions or risk for health conditions, the dosing regimen to be followed, the severity of the disease, whether it is administered in combination with other agents, timing of administration, the tissue to which it is administered, and the physical delivery system in which it is carried.
  • a therapeutically effective amount of an ADC may reduce the number of cancer cells, reduce tumor size, inhibit (e.g., slow or stop) tumor metastasis, inhibit (e.g., slow or stop) tumor growth, and/or relieve one or more symptoms.
  • the term “prophylactically effective amount” or “prophylactically effective dose,” refers to an amount of a compound disclosed herein, e.g., an ADC compound or composition described herein, that is effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
  • a prophylactically effective amount can prevent the onset of disease symptoms, including symptoms associated with a cancer.
  • the term “p” or “drug loading” or “drug:antibody ratio” or “drug-to-antibody ratio” or “DAR” refers to the number of drug moieties per antibody or antigen-binding fragment, i.e., drug loading, or the number of -L-D moieties per antibody or antigen-binding fragment (Ab) in ADCs of Formula (1).
  • p refers to the number of Mcl-1 inhibitor compounds linked to the antibody or antigen-binding fragment.
  • ADC antibody-drug conjugate
  • the ADC compounds include an antibody or antigen-binding fragment conjugated (i.e., covalently attached by a linker) to a drug moiety (e.g., an Mcl-1 inhibitor), wherein the drug moiety when not conjugated to an antibody or antigen-binding fragment has a cytotoxic or cytostatic effect.
  • the drug moiety when not conjugated to an antibody or antigen-binding fragment is capable of reducing the expression and/or activity of Mcl-1 and/or one or more upstream modulators or downstream targets thereof.
  • the ADCs disclosed herein may provide potent anti- cancer agents.
  • the ADC may provide improved activity, better cytotoxic specificity, and/or reduced off-target killing as compared to the drug moiety when administered alone.
  • the components of the ADC are selected to (i) retain one or more therapeutic properties exhibited by the antibody and drug moieties in isolation, (ii) maintain the specific binding properties of the antibody or antigen-binding fragment; (iii) optimize drug loading and drug-to-antibody ratios; (iv) allow delivery, e.g., intracellular delivery, of the drug moiety via stable attachment to the antibody or antigen- binding fragment; (v) retain ADC stability as an intact conjugate until transport or delivery to a target site; (vi) minimize aggregation of the ADC prior to or after administration; (vii) allow for the therapeutic effect, e.g., cytotoxic effect, of the drug moiety after cleavage or other release mechanism in the cellular environment; (viii) exhibit in vivo anti-cancer treatment efficacy comparable to or superior to that of the antibody and drug moieties in isolation; (ix) minimize off-target killing by the drug moiety; and/or (x) exhibit desirable pharmacokinetic and
  • the ADC compounds of the present disclosure may selectively deliver an effective dose of a cytotoxic or cytostatic agent to cancer cells or to tumor tissue.
  • the cytotoxic and/or cytostatic activity of the ADC is dependent on target antigen expression in a cell.
  • the disclosed ADCs are particularly effective at killing cancer cells expressing a target antigen while minimizing off-target killing.
  • the disclosed ADCs do not exhibit a cytotoxic and/or cytostatic effect on cancer cells that do not express a target antigen.
  • ADC compounds comprising an antibody or antigen-binding fragment thereof (Ab) which targets a cancer cell, an Mcl-1 inhibitor drug moiety (D), and a linker moiety (L) that covalently attaches Ab to D.
  • the antibody or antigen-binding fragment is able to bind to a tumor-associated antigen (e.g., BCMA, CD33, PCAD, or HER2), e.g., with high specificity and high affinity.
  • the antibody or antigen-binding fragment is internalized into a target cell upon binding, e.g., into a degradative compartment in the cell.
  • the ADCs internalize upon binding to a target cell, undergo degradation, and release the Mcl-1 inhibitor drug moiety to kill cancer cells.
  • the Mcl-1 inhibitor drug moiety may be released from the antibody and/or the linker moiety of the ADC by enzymatic action, hydrolysis, oxidation, or any other mechanism.
  • the antibody or antigen-binding fragment (Ab) of Formula (1) includes within its scope any antibody or antigen-binding fragment that specifically binds to a target antigen on a cancer cell.
  • the antibody or antigen-binding fragment may bind to a target antigen with a dissociation constant (KD) of ⁇ 1 mM, ⁇ 100 nM or ⁇ 10 nM, or any amount in between, as measured by, e.g., BIAcore ® analysis.
  • the KD is 1 pM to 500 pM.
  • the KD is between 500 pM to 1 ⁇ M, 1 ⁇ M to 100 nM, or 100 mM to 10 nM.
  • the antibody or antigen-binding fragment is a four-chain antibody (also referred to as an immunoglobulin or a full-length or intact antibody), comprising two heavy chains and two light chains.
  • the antibody or antigen-binding fragment is an antigen-binding fragment of an immunoglobulin.
  • the antibody or antigen-binding fragment is an antigen-binding fragment of an immunoglobulin that retains the ability to bind a target cancer antigen and/or provide at least one function of the immunoglobulin.
  • the antibody or antigen-binding fragment is an internalizing antibody or internalizing antigen-binding fragment thereof.
  • the internalizing antibody or internalizing antigen-binding fragment thereof binds to a target cancer antigen expressed on the surface of a cell and enters the cell upon binding.
  • the Mcl-1 inhibitor drug moiety of the ADC is released from the antibody or antigen-binding fragment of the ADC after the ADC enters and is present in a cell expressing the target cancer antigen (i.e., after the ADC has been internalized), e.g., by cleavage, by degradation of the antibody or antigen-binding fragment, or by any other suitable release mechanism.
  • antibodies are named by their designation, e.g. NY920. If modifications are made to the antibodies, they are further designated with that modification. For example if select amino acids in the antibody have been changed to cysteines (e.g. E152C, S375C according to EU numbering of the antibody heavy chain to facilitate conjugation to linker-drug moieties) they are designated as “CysMab”; or if the antibody has been modified with Fc silending mutations D265A and P329A of the lgG1 constant region according to EU numbering, “DAPA” is added to the antibody name. If the antibody is used in an antibody drug conjugate, they are named using the following format: Antibody designation-linker-payload.
  • the antibody or antigen-binding fragment of an ADC disclosed herein may comprise any set of heavy and light chain variable domains listed in the tables above or a set of six CDRs from any set of heavy and light chain variable domains listed in the tables above.
  • the antibody or antigen-binding fragment of an ADC disclosed herein may comprise amino acid sequences that are conservatively modified and/or homologous to the sequences listed in the tables above, so long as the ADC retains the ability to bind to its target cancer antigen (e.g., with a KD of less than 1x10 -8 M) and retains one or more functional properties of the ADCs disclosed herein (e.g., ability to internalize, bind to an antigen target, e.g., an antigen expressed on a tumor or other cancer cell, etc.).
  • the antibody or antigen-binding fragment of an ADC disclosed herein further comprises human heavy and light chain constant domains or fragments thereof.
  • the antibody or antigen-binding fragment of the described ADCs may comprise a human IgG heavy chain constant domain (such as an IgG1) and a human kappa or lambda light chain constant domain.
  • the antibody or antigen- binding fragment of the described ADCs comprises a human immunoglobulin G subtype 1 (IgG1) heavy chain constant domain with a human Ig kappa light chain constant domain.
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises three heavy chain CDRs and three light chain CDRs as follows: heavy chain CDR1 (HCDR1) consisting of SEQ ID NO:1, heavy chain CDR2 (HCDR2) consisting of SEQ ID NO:2, heavy chain CDR3 (HCDR3) consisting of SEQ ID NO:3; light chain CDR1 (LCDR1) consisting of SEQ ID NO:16, light chain CDR2 (LCDR2) consisting of SEQ ID NO:17, and light chain CDR3 (LCDR3) consisting of SEQ ID NO:18.
  • heavy chain CDR1 consisting of SEQ ID NO:1
  • HCDR2 heavy chain CDR2
  • HCDR3 heavy chain CDR3
  • LCDR1 light chain CDR1
  • LCDR1 light chain CDR1
  • LCDR2 light chain CDR2
  • LCDR3 light chain CDR3
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises three heavy chain CDRs and three light chain CDRs as follows: heavy chain CDR1 (HCDR1) consisting of SEQ ID NO:4, heavy chain CDR2 (HCDR2) consisting of SEQ ID NO:2, heavy chain CDR3 (HCDR3) consisting of SEQ ID NO:3; light chain CDR1 (LCDR1) consisting of SEQ ID NO:16, light chain CDR2 (LCDR2) consisting of SEQ ID NO:17, and light chain CDR3 (LCDR3) consisting of SEQ ID NO:18.
  • heavy chain CDR1 consisting of SEQ ID NO:4
  • heavy chain CDR2 HCDR2
  • HCDR3 heavy chain CDR3
  • LCDR1 light chain CDR1
  • LCDR1 light chain CDR1
  • LCDR2 light chain CDR2
  • LCDR3 light chain CDR3
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises three heavy chain CDRs and three light chain CDRs as follows: heavy chain CDR1 (HCDR1) consisting of SEQ ID NO:5, heavy chain CDR2 (HCDR2) consisting of SEQ ID NO:6, heavy chain CDR3 (HCDR3) consisting of SEQ ID NO:3; light chain CDR1 (LCDR1) consisting of SEQ ID NO:19, light chain CDR2 (LCDR2) consisting of SEQ ID NO:20, and light chain CDR3 (LCDR3) consisting of SEQ ID NO:21.
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises three heavy chain CDRs and three light chain CDRs as follows: heavy chain CDR1 (HCDR1) consisting of SEQ ID NO:7, heavy chain CDR2 (HCDR2) consisting of SEQ ID NO:8, heavy chain CDR3 (HCDR3) consisting of SEQ ID NO:9; light chain CDR1 (LCDR1) consisting of SEQ ID NO:22, light chain CDR2 (LCDR2) consisting of SEQ ID NO:20, and light chain CDR3 (LCDR3) consisting of SEQ ID NO:18.
  • heavy chain CDR1 consisting of SEQ ID NO:7
  • heavy chain CDR2 HCDR2
  • HCDR3 heavy chain CDR3
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises three heavy chain CDRs and three light chain CDRs as follows: heavy chain CDR1 (HCDR1) consisting of SEQ ID NO:27, heavy chain CDR2 (HCDR2) consisting of SEQ ID NO:28, heavy chain CDR3 (HCDR3) consisting of SEQ ID NO:29; light chain CDR1 (LCDR1) consisting of SEQ ID NO:42, light chain CDR2 (LCDR2) consisting of SEQ ID NO:43, and light chain CDR3 (LCDR3) consisting of SEQ ID NO:44.
  • heavy chain CDR1 consisting of SEQ ID NO:27
  • heavy chain CDR2 (HCDR2) consisting of SEQ ID NO:28
  • heavy chain CDR3 (HCDR3) consisting of SEQ ID NO:29 heavy chain CDR3 (HCDR3) consisting of SEQ ID NO:29
  • light chain CDR1 (LCDR1) consisting of SEQ ID NO:42
  • light chain CDR2 (LCDR2) consisting of
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises three heavy chain CDRs and three light chain CDRs as follows: heavy chain CDR1 (HCDR1) consisting of SEQ ID NO:30, heavy chain CDR2 (HCDR2) consisting of SEQ ID NO:28, heavy chain CDR3 (HCDR3) consisting of SEQ ID NO:29; light chain CDR1 (LCDR1) consisting of SEQ ID NO:42, light chain CDR2 (LCDR2) consisting of SEQ ID NO:43, and light chain CDR3 (LCDR3) consisting of SEQ ID NO:44.
  • heavy chain CDR1 consisting of SEQ ID NO:30
  • heavy chain CDR2 (HCDR2) consisting of SEQ ID NO:28
  • heavy chain CDR3 (HCDR3) consisting of SEQ ID NO:29 heavy chain CDR3 (HCDR3) consisting of SEQ ID NO:29
  • light chain CDR1 (LCDR1) consisting of SEQ ID NO:42
  • light chain CDR2 (LCDR2) consisting of
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises three heavy chain CDRs and three light chain CDRs as follows: heavy chain CDR1 (HCDR1 ) consisting of SEQ ID NO:31 , heavy chain CDR2 (HCDR2) consisting of SEQ ID NO:32, heavy chain CDR3 (HCDR3) consisting of SEQ ID NO:29; light chain CDR1 (LCDR1) consisting of SEQ ID NO:45, light chain CDR2 (LCDR2) consisting of SEQ ID NO:46, and light chain CDR3 (LCDR3) consisting of SEQ ID NO:47.
  • heavy chain CDR1 HCDR1
  • HCDR2 consisting of SEQ ID NO:32
  • heavy chain CDR3 HCDR3
  • LCDR1 light chain CDR1
  • LCDR2 light chain CDR2
  • LCDR3 light chain CDR3
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises three heavy chain CDRs and three light chain CDRs as follows: heavy chain
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:10, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:23.
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises the heavy chain variable region amino acid sequence of SEQ ID NO:10 and the light chain variable region amino acid sequence of SEQ ID NO:23, or sequences that are at least 95% identical to the disclosed sequences.
  • the anti-CD48 antibody or antigen-binding fragment thereof has a heavy chain variable region amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:10 and/or a light chain variable region amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:23.
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:36, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:49.
  • the anti-CD48 antibody or antigen-binding fragment thereof comprises the heavy chain variable region amino acid sequence of SEQ ID NO:36 and the light chain variable region amino acid sequence of SEQ ID NO:49, or sequences that are at least 95% identical to the disclosed sequences.
  • the anti-CD48 antibody or antigen-binding fragment thereof has a heavy chain variable region amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:36 and/or a light chain variable region amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:49.
  • the anti-CD48 antibody comprises the heavy chain amino acid sequence of SEQ ID NO:12 or a sequence that is at least 95% identical to SEQ ID NO:12, and the light chain amino acid sequence of SEQ ID NO:25 or a sequence that is at least 95% identical to SEQ ID NO:25.
  • the anti-CD48 antibody comprises the heavy chain amino acid sequence of SEQ ID NO:12 and the light chain amino acid sequence of SEQ ID NO:25, or sequences that are at least 95% identical to the disclosed sequences. In some embodiments, the anti-CD48 antibody has a heavy chain amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:12 and a light chain amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:25.
  • the anti-CD48 antibody comprises the heavy chain amino acid sequence of SEQ ID NO:14 or a sequence that is at least 95% identical to SEQ ID NO:14, and the light chain amino acid sequence of SEQ ID NO:25 or a sequence that is at least 95% identical to SEQ ID NO:25. In some embodiments, the anti-CD48 antibody comprises the heavy chain amino acid sequence of SEQ ID NO:14 and the light chain amino acid sequence of SEQ ID NO:25, or sequences that are at least 95% identical to the disclosed sequences.
  • the anti-CD48 antibody has a heavy chain amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:14 and a light chain amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:25.
  • the anti-CD48 antibody comprises the heavy chain amino acid sequence of SEQ ID NO:38 or a sequence that is at least 95% identical to SEQ ID NO:38, and the light chain amino acid sequence of SEQ ID NO:51 or a sequence that is at least 95% identical to SEQ ID NO:51.
  • the anti-CD48 antibody comprises the heavy chain amino acid sequence of SEQ ID NO:38 and the light chain amino acid sequence of SEQ ID NO:51, or sequences that are at least 95% identical to the disclosed sequences. In some embodiments, the anti-CD48 antibody has a heavy chain amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:38 and a light chain amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:51.
  • the anti-CD48 antibody comprises the heavy chain amino acid sequence of SEQ ID NO:40 or a sequence that is at least 95% identical to SEQ ID NO:40, and the light chain amino acid sequence of SEQ ID NO:51 or a sequence that is at least 95% identical to SEQ ID NO:51. In some embodiments, the anti-CD48 antibody comprises the heavy chain amino acid sequence of SEQ ID NO:40 and the light chain amino acid sequence of SEQ ID NO:51, or sequences that are at least 95% identical to the disclosed sequences.
  • the anti-CD48 antibody has a heavy chain amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:40 and a light chain amino acid sequence that is at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:51.
  • Residues in two or more polypeptides are said to “correspond” if the residues occupy an analogous position in the polypeptide structures. Analogous positions in two or more polypeptides can be determined by aligning the polypeptide sequences based on amino acid sequence or structural similarities. Those skilled in the art understand that it may be necessary to introduce gaps in either sequence to produce a satisfactory alignment.
  • amino acid substitutions are of single residues. Insertions usually will be on the order of from about 1 to about 20 amino acid residues, although considerably larger insertions may be tolerated as long as biological function is retained (e.g., binding to a target antigen). Deletions usually range from about 1 to about 20 amino acid residues, although in some cases deletions may be much larger. Substitutions, deletions, insertions, or any combination thereof may be used to arrive at a final derivative or variant. Generally, these changes are done on a few amino acids to minimize the alteration of the molecule, particularly the immunogenicity and specificity of the antigen binding protein. However, larger changes may be tolerated in certain circumstances. Conservative substitutions can be made in accordance with the following chart depicted as Table 1.
  • variant antibody sequences typically exhibit the same qualitative biological activity and will elicit the same immune response, although variants may also be selected to modify the characteristics of the antigen binding proteins as needed.
  • variants may be designed such that the biological activity of the antigen binding protein is altered. For example, glycosylation sites may be altered or removed.
  • the immunoconjugates of the invention may comprise modified antibodies or antigen binding fragments thereof that further comprise modifications to framework residues within VH and/or VL, e.g. to improve the properties of the antibody.
  • the framework modifications are made to decrease the immunogenicity of the antibody.
  • one approach is to “back-mutate” one or more framework residues to the corresponding germline sequence. More specifically, an antibody that has undergone somatic mutation may contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived.
  • somatic mutations can be “back- mutated” to the germline sequence by, for example, site- directed mutagenesis.
  • back-mutated antibodies are also intended to be encompassed by the invention.
  • Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T-cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as “deimmunization” and is described in further detail in U.S. Patent Publication No. 20030153043 by Carr etal.
  • antibodies of the invention may be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity (ADCC).
  • an antibody of the invention may be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody.
  • the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased.
  • This approach is described further in U.S. Patent No. 5,677,425 by Bodmer et al.
  • the number of cysteine residues in the hinge region of CH1 is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
  • the antibody or antibody fragment disclosed herein include modified or engineered amino acid residues, e.g., one or more cysteine residues, as sites for conjugation to a drug moiety (Junutula JR, et al., Nat Biotechnol 2008, 26:925-932).
  • the invention provides a modified antibody or antibody fragment comprising a substitution of one or more amino acids with cysteine at the positions described herein.
  • Sites for cysteine substitution are in the constant regions of the antibody or antibody fragment and are thus applicable to a variety of antibody or antibody fragment, and the sites are selected to provide stable and homogeneous conjugates.
  • a modified antibody or fragment can have one, two or more cysteine substitutions, and these substitutions can be used in combination with other modification and conjugation methods as described herein. Methods for inserting cysteine at specific locations of an antibody are known in the art, see, e.g., Lyons et al., (1990) Protein Eng., 3:703-708, WO 2011/005481, WO 2 014/124316, WO 2015/138615.
  • a modified antibody comprises a substitution of one or more amino acids with cysteine on its constant region selected from positions 117, 119, 121, 124, 139, 152, 153, 155, 157, 164, 169, 171, 174, 189, 191, 195, 197, 205, 207, 246, 258, 269, 274, 286, 288, 290, 292, 293, 320, 322, 326, 333, 334, 335, 337, 344, 355, 360, 375, 382, 390, 392, 398, 400 and 422 of a heavy chain of the antibody, and wherein the positions are numbered according to the EU system.
  • a modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region selected from positions 107, 108, 109, 114, 129, 142, 143, 145, 152, 154, 156, 159, 161, 165, 168, 169, 170, 182, 183, 197, 199, and 203 of a light chain of the antibody or antibody fragment, wherein the positions are numbered according to the EU system, and wherein the light chain is a human kappa light chain.
  • a modified antibody or antibody fragment thereof comprises a combination of substitution of two or more amino acids with cysteine on its constant regions wherein the combinations comprise substitutions at positions 375 of an antibody heavy chain, position 152 of an antibody heavy chain, position 360 of an antibody heavy chain, or position 107 of an antibody light chain and wherein the positions are numbered according to the EU system.
  • a modified antibody or antibody fragment thereof comprises a substitution of one amino acid with cysteine on its constant regions wherein the substitution is position 375 of an antibody heavy chain, position 152 of an antibody heavy chain, position 360 of an antibody heavy chain, position 107 of an antibody light chain, position 165 of an antibody light chain or position 159 of an antibody light chain and wherein the positions are numbered according to the EU system, and wherein the light chain is a kappa chain.
  • a modified antibody or antibody fragment thereof comprises a combination of substitution of two amino acids with cysteine on its constant regions wherein the combinations comprise substitutions at positions 375 of an antibody heavy chain and position 152 of an antibody heavy chain, wherein the positions are numbered according to the EU system.
  • a modified antibody or antibody fragment thereof comprises a substitution of one amino acid with cysteine at position 360 of an antibody heavy chain, wherein the positions are numbered according to the EU system.
  • a modified antibody or antibody fragment thereof comprises a substitution of one amino acid with cysteine at position 107 of an antibody light chain and wherein the positions are numbered according to the EU system, and wherein the light chain is a kappa chain.
  • the antibodies or antibody fragments can be modified to incorporate Pcl or pyrrolysine (W.
  • peptide tags for enzymatic conjugation methods can be introduced into an antibody (Strop P., et al., Chem Biol.2013, 20(2):161-7; Rabuka D., Curr Opin Chem Biol. 2010 Dec;14(6):790-6; Rabuka D, et al., Nat Protoc.2012, 7(6):1052-67).
  • PPTase 4’-phosphopantetheinyl transferases
  • the Fc hinge region of an antibody is mutated to decrease the biological half-life of the antibody. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding.
  • SpA Staphylococcyl protein A
  • the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector functions of the antibody.
  • one or more amino acids can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen- binding ability of the parent antibody.
  • the effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement.
  • one or more amino acids selected from amino acid residues can be replaced with a different amino acid residue such that the antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC). This approach is described in, e.g., U.S.
  • one or more amino acid residues are altered to thereby alter the ability of the antibody to fix complement.
  • This approach is described in, e.g., the PCT Publication WO 94/29351 by Bodmer etal.
  • Allotypic amino acid residues include, but are not limited to, constant region of a heavy chain of the lgG1 , lgG2, and lgG3 subclasses as well as constant region of a light chain of the kappa isotype as described by Jefferis et al., MAbs. 1 :332-338 (2009).
  • the antibodies comprise mutations that mediate reduced or no antibody-dependent cellular cytotoxicity (ADCC) or complement-dependent cytotoxicity (CDC). In some embodiments, these mutations are known as Fc Silencing, Fc Silent, or Fc Silenced mutations.
  • ADCC antibody-dependent cellular cytotoxicity
  • CDC complement-dependent cytotoxicity
  • amino acid residues L234 and L235 of the lgG1 constant region are substituted to A234 and A235 (also known as “LALA”).
  • amino acid residue N297 of the lgG1 constant region is substituted to A297 (also known as “N297A”).
  • amino acid residues D265 and P329 of the lgG1 constant region are substituted to A265 and A329 (also known as “DAPA”).
  • Other antibody Fc silencing mutations may also be used.
  • the Fc silencing mutations are used in combination, for example D265A, N297A and P329A (also known as “DANAPA”).
  • one or more amino acid residues are altered to thereby alter the ability of the antibody to fix complement. This approach is described in, e.g., the PCT Publication WO 94/29351 by Bodmer etal.
  • one or more amino acids of an antibody or antigen binding fragment thereof of the present invention are replaced by one or more allotypic amino acid residues. Allotypic amino acid residues also include, but are not limited to, the constant region of the heavy chain of the lgG1 , lgG2, and lgG3 subclasses as well as the constant region of the light chain of the kappa isotype as described by Jefferis etal., MAbs. 1 :332-338 (2009).
  • the glycosylation of an antibody is modified.
  • an aglycosylated antibody can be made (i.e., the antibody lacks glycosylation).
  • Glycosylation can be altered to, for example, increase the affinity of the antibody for “antigen.”
  • Such carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence.
  • one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
  • Such aglycosylation may increase the affinity of the antibody for antigen.
  • Such an approach is described in, e.g., U.S. Patent Nos. 5,714,350 and 6,350,861 by Co et al.
  • the antibody is modified to increase its biological half-life.
  • the antibody can be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Patent Nos. 5,869,046 and 6,121,022 by Presta et al.
  • the linker in an ADC is stable extracellularly in a sufficient manner to be therapeutically effective. In some embodiments, the linker is stable outside a cell, such that the ADC remains intact when present in extracellular conditions (e.g., prior to transport or delivery into a cell).
  • the term “intact,” used in the context of an ADC, means that the antibody or antigen-binding fragment remains attached to the drug moiety (e.g., the Mcl-1 inhibitor).
  • “stable,” in the context of a linker or ADC comprising a linker, means that no more than 20%, no more than about 15%, no more than about 10%, no more than about 5%, no more than about 3%, or no more than about 1% of the linkers (or any percentage in between) in a sample of ADC are cleaved (or in the case of an overall ADC are otherwise not intact) when the ADC is present in extracellular conditions.
  • the linkers and/or ADCs disclosed herein are stable compared to alternate linkers and/or ADCs with alternate linkers and/or Mcl-1 inhibitor payloads.
  • the ADCs disclosed herein can remain intact for more than about 48 hours, more than 60 hours, more than about 72 hours, more than about 84 hours, or more than about 96 hours.
  • Whether a linker is stable extracellularly can be determined, for example, by including an ADC in plasma for a predetermined time period (e.g., 2, 4, 6, 8, 16, 24, 48, or 72 hours) and then quantifying the amount of free drug moiety present in the plasma.
  • a predetermined time period e.g., 2, 4, 6, 8, 16, 24, 48, or 72 hours
  • Stability may allow the ADC time to localize to target cancer cells and prevent the premature release of the drug moiety, which could lower the therapeutic index of the ADC by indiscriminately damaging both normal and cancer tissues.
  • the linker is stable outside of a target cell and releases the drug moiety from the ADC once inside of the cell, such that the drug can bind to its target.
  • an effective linker will: (i) maintain the specific binding properties of the antibody or antigen-binding fragment; (ii) allow delivery, e.g., intracellular delivery, of the drug moiety via stable attachment to the antibody or antigen-binding fragment; (iii) remain stable and intact until the ADC has been transported or delivered to its target site; and (iv) allow for the therapeutic effect, e.g., cytotoxic effect, of the drug moiety after cleavage or alternate release mechanism.
  • Linkers may impact the physico-chemical properties of an ADC. As many cytotoxic agents are hydrophobic in nature, linking them to the antibody with an additional hydrophobic moiety may lead to aggregation. ADC aggregates are insoluble and often limit achievable drug loading onto the antibody, which can negatively affect the potency of the ADC. Protein aggregates of biologics, in general, have also been linked to increased immunogenicity. As shown below, linkers disclosed herein result in ADCs with low aggregation levels and desirable levels of drug loading. [235] A linker may be “cleavable” or “non-cleavable” (Ducry and Stump (2010) Bioconjugate Chem.21:5-13).
  • Cleavable linkers are designed to release the drug moiety (e.g., an Mcl-1 inhibitor) when subjected to certain environment factors, e.g., when internalized into the target cell, whereas non-cleavable linkers generally rely on the degradation of the antibody or antigen-binding fragment itself.
  • drug moiety e.g., an Mcl-1 inhibitor
  • non-cleavable linkers generally rely on the degradation of the antibody or antigen-binding fragment itself.
  • C 1 -C 6 alkyl refers to a straight or branched hydrocarbon chain radical consisting solely of carbon and hydrogen atoms, containing no unsaturation, having from one to six carbon atoms, and which is attached to the rest of the molecule by a single bond.
  • C 1 -C 6 alkyl groups include methyl (a C 1 alkyl), ethyl (a C 2 alkyl), 1- methylethyl (a C 3 alkyl), n-propyl (a C 3 alkyl), isopropyl (a C 3 alkyl), n-butyl (a C 4 alkyl), isobutyl (a C 4 alkyl), sec-butyl (a C 4 alkyl), tert-butyl (a C 4 alkyl), n-pentyl (a C 5 alkyl), isopentyl (a C 5 alkyl), neopentyl (a C 5 alkyl) and hexyl (a C 6 alkyl).
  • alkenyl refers to a straight or branched hydrocarbon chain radical group consisting solely of carbon and hydrogen atoms, containing at least one double bond.
  • C 2 -C 6 alkenyl refers to a straight or branched hydrocarbon chain radical group consisting solely of carbon and hydrogen atoms, containing at least one double bond, having from two to six carbon atoms, which is attached to the rest of the molecule by a single bond.
  • C 2 -C 6 alkenyl groups include ethenyl (a C 2 alkenyl), prop-1-enyl (a C 3 alkenyl), but-1-enyl (a C 4 alkenyl), pent-1-enyl (a C 5 alkenyl), pent-4-enyl (a C 5 alkenyl), penta-1,4-dienyl (a C 5 alkenyl), hexa-1-enyl (a C 6 alkenyl), hexa-2-enyl (a C 6 alkenyl), hexa-3-enyl (a C 6 alkenyl), hexa-1-,4-dienyl (a C 6 alkenyl), hexa-1-,5-dienyl (a C 6 alkenyl) and hexa-2-,4-dienyl (a C 6 alkenyl).
  • C 2 - C 3 alkenyl refers to a straight or branched hydrocarbon chain radical group consisting solely of carbon and hydrogen atoms, containing at least one double bond, having from two to three carbon atoms, which is attached to the rest of the molecule by a single bond.
  • Non-limiting examples of “C 2 -C 3 alkenyl” groups include ethenyl (a C 2 alkenyl) and prop-1-enyl (a C 3 alkenyl).
  • alkylene refers to a bivalent straight or branched hydrocarbon chain radical consisting solely of carbon and hydrogen atoms and containing no unsaturation.
  • C 1 -C 6 alkylene refers to a bivalent straight or branched hydrocarbon chain radical consisting solely of carbon and hydrogen atoms, containing no unsaturation, having from one to six carbon atoms.
  • Non-limiting examples of “C 1 -C 6 alkylene” groups include methylene (aC 1a lkylene), ethylene (a C 2 alkylene), 1- methylethylene (a C 3 alkylene), n-propylene (a C 3 alkylene), isopropylene (a C 3 alkylene), n- butylene (a C 4 alkylene), isobutylene (a C 4 alkylene), sec-butylene (a C 4 alkylene), tert- butylene (a C 4 alkylene), n-pentylene (a C 5 alkylene), isopentylene (a C 5 alkylene), neopentylene (a C 5 alkylene), and hexylene (a C 6 alkylene).
  • alkenylene refers to a bivalent straight or branched hydrocarbon chain radical consisting solely of carbon and hydrogen atoms and containing at least one double bond.
  • C 2 -C 6 alkenylene refers to a bivalent straight or branched hydrocarbon chain radical group consisting solely of carbon and hydrogen atoms, containing at least one double bond, and having from two to six carbon atoms.
  • Non-limiting examples of “C 2 -C 6 alkenylene” groups include ethenylene (a C 2 alkenylene), prop-1-enylene (a C 3 alkenylene), but-1-enylene (a C 4 alkenylene), pent-1- enylene (a C 5 alkenylene), pent-4-enylene (a C 5 alkenylene), penta-1,4-dienylene (a C 5 alkenylene), hexa-1-enylene (a C 6 alkenylene), hexa-2-enylene (a C 6 alkenylene), hexa-3- enylene (a C 6 alkenylene), hexa-1-,4-dienylene (a C 6 alkenylene), hexa-1-,5-dienylene (a C 6 alkenylene) and hexa-2-,4-dienylene (a C 6 alkenylene).
  • C 2 -C 6 alkenylene refers to a bivalent straight or branched hydrocarbon chain radical group consisting solely of carbon and hydrogen atoms, containing at least one double bond, and having from two to thee carbon atoms.
  • Non-limiting examples of “C 2 -C 3 alkenylene” groups include ethenylene (a C 2 alkenylene) and prop-1-enylene (a C 3 alkenylene).
  • cycloalkyl or “C 3 -C 8 cycloalkyl,” as used herein, refers to a saturated, monocyclic, fused bicyclic, fused tricyclic or bridged polycyclic ring system.
  • Non-limiting examples of fused bicyclic or bridged polycyclic ring systems include bicyclo[1.1.1]pentane, bicyclo[2.1.1]hexane, bicyclo[2.2.1]heptane, bicyclo[3.1.1]heptane, bicyclo[3.2.1]octane, bicyclo[2.2.2]octane and adamantanyl.
  • Non-limiting examples monocyclic C 3 -C 8 cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl and cyclooctyl groups.
  • haloalkyl refers to a linear or branched alkyl chain substituted with one or more halogen groups in place of hydrogens along the hydrocarbon chain.
  • halogen groups suitable for substitution in the haloalkyl group include Fluorine, Bromine, Chlorine, and Iodine.
  • Haloalkyl groups may include substitution with multiple halogen groups in place of hydrogens in an alkyl chain, wherein said halogen groups can be attached to the same carbon or to another carbon in the alkyl chain.
  • the alkyl, alkenyl, alkynyl, alkoxy, amino, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl groups may be optionally substituted by 1 to 4 groups selected from optionally substituted linear or branched (C 1 -C 6 )alkyl, optionally substituted linear or branched (C 2 -C 6 )alkenyl group, optionally substituted linear or branched (C 2 -C 6 )alkynyl group, optionally substituted linear or branched (C 1 -C 6 )alkoxy, optionally substituted (C 1 - C 6 )alkyl-S-, hydroxy, oxo (or N-oxide where appropriate), nitro, cyano, -C(O)-OR 0 ’, -O-C(O)- R 0 ’, -C(O)-NR 0 ’R 0 ’’, -NR 0
  • polyoxyethylene refers to a linear chain, a branched chain or a star shaped configuration comprised of (OCH 2 CH 2 ) groups.
  • PEG12 as used herein means that t is 12.
  • polyalkylene glycol refers to a linear chain, a branched chain or a star shaped configuration comprised of (O(CH 2 ) m ) n groups.
  • attachment group refers to a bivalent moiety which links the bridging spacer to the antibody or fragment thereof.
  • the attachment or coupling group is a bivalent moiety formed by the reaction between a reaction group and a functional group on the antibody or fragment thereof.
  • Non limiting examples of such bivalent moieties include the bivalent chemical moieties given in Table 2 and Table 3 provided herein.
  • bridging spacer refers to one or more linker components which are covalently attached together to form a bivalent moiety which links the bivalent peptide spacer to the reactive group, links the bivalent peptide space to the coupling group, or links the attachment group to the at least one cleavable group.
  • the “bridging spacer” comprises a carboxyl group attached to the N-terminus of the bivalent peptide spacer via an amide bond.
  • spacer moiety refers to one or more linker components which are covalently attached together to form a moiety which links the self-immolative spacer to the hydrophilic moiety.
  • bivalent peptide spacer refers to bivalent linker comprising one or more amino acid residues covalently attached together to form a moiety which links the bridging spacer to the self immolative spacer.
  • the one or more amino acid residues can be an residue of amino acids selected from alanine (Ala), cysteine (Cys), aspartic acid (Asp), glutamic acid (Glu), phenylalanine (Phe), glycine (Gly), histidine (His), isoleucine (Ile), lysine (Lys), leucine (Leu), methionine (Met), asparagine (Asn), proline (Pro), glutamine (Gln), arginine (Arg), serine (Ser), threonine (Thr), valine (Val), tryptophan (Trp), tyrosine (Tyr), citrulline (Cit), norvaline (Nva), norleucune (Nle), selenocysteine (Sec), pyrrolysine (Pyl), homoserine, homocysteine, and desmethyl pyrrolysine.
  • amino acids selected from alanine (Ala), cyste
  • a “bivalent peptide spacer” is a combination of 2 to four amino acid residues where each residue is independently selected from a residue of an amino acid selected from alanine (Ala), cysteine (Cys), aspartic acid (Asp), glutamic acid (Glu), phenylalanine (Phe), glycine (Gly), histidine (His), isoleucine (Ile), lysine (Lys), leucine (Leu),methionine (Met), asparagine (Asn), proline (Pro), glutamine (Gln), arginine (Arg), serine (Ser), threonine (Thr), valine (Val), tryptophan (Trp), tyrosine (Tyr), citrulline (Cit), norvaline (Nva), norleucune (Nle), selenocysteine (Sec), pyrrolysine (Pyl), homoserine, homocy
  • linker component refers to a chemical moiety that is a part of the linker.
  • Non-limiting examples of such self-immolative spacers include: PG is a protecting (triggering) group; X a is O, NH or S; X b is O, NH, NCH 3 or S; X c is O or NH; Y a is CH 2 , CH 2 O or CH 2 NH; Y b is CH 2 , O or NH; Y c is a bond, CH 2 , O or NH, and LG is a leaving group such as a Drug moiety (D) of the Linker-Drug group of the invention. Additional non-limiting examples of such self-immolative spacers are described in Angew. Chem. Int. Ed.2015, 54, 7492 – 7509. [253] In addition, a linker component can be a chemical moiety which is readily formed by reaction between two reactive groups. Non-limiting examples of such chemical moieties are given in Table 2. Table 2
  • R 32 in Table 2 is H, C 1-4 alkyl, phenyl, pyrimidine or pyridine;
  • R 35 in Table 2 is H, C 1-6 alkyl, phenyl or C 1-4 alkyl substituted with 1 to 3 –OH groups;
  • R 37 in Table 2 is independently selected from H, phenyl and pyridine; q in Table 2 is 0, 1, 2 or 3;
  • R 8 and R 13 in Table 2 are each H or methyl; and
  • R 9 and R 14 in Table 2 are each H, -CH 3 or phenyl;
  • R in Table 2 is H or any suitable substituent; and
  • a linker component can be a group listed in Table 3 below. Table 3. [255] As used herein, when a partial structure of a compound is illustrated, a wavy line indicates the point of attachment of the partial structure to the rest of the molecule.
  • self-immolative spacer and “self-immolative group”, as used herein, refer a moiety comprising one or more triggering groups (TG) which are activated by acid-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, glycosidase induced cleavage, phosphodiesterase induced cleavage, phosphatase induced cleavage, protease induced cleavage, lipase induced cleavage or disulfide bond cleavage, and after activation the protecting group is removed, which generates a cascade of disassembling reactions leading to the temporally sequential release of a leaving group. Such cascade of reactions can be, but not limited to, 1,4-, 1,6- or 1,8- elimination reactions.
  • Non-limiting examples of self-immolative spacer or group include:
  • TG is a triggering group
  • X a is O, NH or S
  • X b is O, NH, NCH 3 or S
  • X c is O or NH
  • Y a is CH 2 , CH 2 O or CH 2 NH
  • Y b is CH 2 , O or NH
  • Y c is a bond, CH 2 , O or NH
  • LG is a leaving group such as a Drug moiety (D) of the Linker-Drug group of the invention. Additional non-limiting examples of self-immolative spacers are described in Angew. Chem. Int. Ed.2015, 54, 7492 – 7509.
  • the self-immolative spacer is moiety having the structure where Lp is an enzymatically cleavable bivalent peptide spacer and A, D, L 3 and R 2 are as defined herein. In preferred embodiments, the self-immolative spacer is moiety having the structure where Lp is an enzymatically cleavable bivalent peptide spacer and D, L 3 and R 2 are as defined herein. In some embodiments, D is a quaternized tertiary amine-containing MCl1 inhibitor.
  • the self-immolative spacer is moiety having the structure where Lp is an enzymatically cleavable bivalent peptide spacer and D, L 3 and R 2 are as defined herein.
  • hydrophilic moiety refers to moiety that is has hydrophilic properties which increases the aqueous solubility of the Drug moiety (D) when the Drug moiety (D) is attached to the linker group of the invention.
  • hydrophilic groups include, but are not limited to, polyethylene glycols, polyalkylene glycols, sugars, oligosaccharides, polypeptides a C 2 -C 6 alkyl substituted with 1 to 3 groups.
  • an intermediate which is the precursor of the linker moiety, is reacted with the drug moiety (e.g., the Mcl-1 inhibitor) under appropriate conditions.
  • the drug moiety e.g., the Mcl-1 inhibitor
  • reactive groups are used on the drug and/or the intermediate or linker.
  • the product of the reaction between the drug and the intermediate, or the derivatized drug (drug plus linker) is subsequently reacted with the antibody or antigen-binding fragment under conditions that facilitate conjugation of the drug and intermediate or derivatized drug and antibody or antigen-binding fragment.
  • the intermediate or linker may first be reacted with the antibody or antigen-binding fragment, or a derivatized antibody or antigen- binding fragment, and then reacted with the drug or derivatized drug.
  • a number of different reactions are available for covalent attachment of the drug moiety and/or linker moiety to the antibody or antigen-binding fragment. This is often accomplished by reaction of one or more amino acid residues of the antibody or antigen- binding fragment, including the amine groups of lysine, the free carboxylic acid groups of glutamic acid and aspartic acid, the sulfhydryl groups of cysteine, and the various moieties of the aromatic amino acids.
  • non-specific covalent attachment may be undertaken using a carbodiimide reaction to link a carboxy (or amino) group on a drug moiety to an amino (or carboxy) group on an antibody or antigen-binding fragment.
  • bifunctional agents such as dialdehydes or imidoesters may also be used to link the amino group on a drug moiety to an amino group on an antibody or antigen-binding fragment.
  • drugs e.g., an Mcl-1 inhibitor
  • This method involves the periodate oxidation of a drug that contains glycol or hydroxy groups, thus forming an aldehyde which is then reacted with the binding agent.
  • Attachment occurs via formation of a Schiff base with amino groups of the binding agent.
  • Isothiocyanates may also be used as coupling agents for covalently attaching drugs to binding agents.
  • Other techniques are known to the skilled artisan and within the scope of the present disclosure.
  • drug moieties that can be generated and linked to an antibody or antigen-binding fragment using various chemistries known to in the art include Mcl-1 inhibitors, e.g., the Mcl-1 inhibitors described and exemplified herein.
  • Suitable drug moieties may comprise a compound of the formulas (I), (II), (III), or an enantiomer, diastereoisomer, atropisomer, deuterated derivative, and/or addition salt thereof with a pharmaceutically acceptable acid or base. Additionally, the drug moiety may comprise any compounds of the Mcl-1 inhibitor (D) described herein.
  • “atropisomers,” are stereoisomers arising because of hindered rotation about a single bond, where energy differences due to steric strain or other contributors create a barrier to rotation that is high enough to allow for isolation of individual conformers (Bringmann et al. Angew. Chem. Int. Ed.2005, 44, 5384-5427).
  • Atropisomers may be as follows: .
  • a preferred atropisomer may be (5S a ), also named (5aS).
  • a drug moiety of the disclosure may be any one of the compounds disclosed in International Patent Application Publication Nos.
  • a drug moiety of the disclosure may comprise a compound of Formula (I): wherein: Ring D 0 is a cycloalkyl group, a heterocycloalkyl group, an aryl group or a heteroaryl group, Ring E 0 is a furyl, thienyl or pyrrolyl ring, X 01 , X 03 , X 04 and X 05 independently of one another are a carbon atom or a nitrogen atom, X02 is a C-R026 group or a nitrogen atom, means that the ring is aromatic, Y 0 is a nitrogen atom or a C-R 03 group, Z 0 is a nitrogen atom or a C-R 04 group, R 01 is a halogen atom, a linear or branched (C 1 -C 6 )alkyl group, a linear or branched (C 2 -C 6 )alkenyl group, a linear or branched (C 2
  • a drug moiety of the disclosure may comprise a compound of Formula (II): wherein: Z0 is a nitrogen atom or a C-R04 group, R01 is a halogen atom, a linear or branched (C 1 -C 6 )alkyl group, a linear or branched (C 2 -C 6 )alkenyl group, a linear or branched (C 2 -C 6 )alkynyl group, a linear or branched (C 1 -C 6 )haloalkyl group, a hydroxy group, a linear or branched (C 1 - C 6 )alkoxy group, a –S-(C 1 -C 6 )alkyl group, a cyano group, -Cy 08 , -NR 011 R 011 ’, R02, R 03 and R04 independently of one another are a hydrogen atom, a halogen atom, a linear or branched
  • a drug moiety of the disclosure may comprise a compound of Formula (III): wherein: R 01 is a linear or branched (C 1 -C 6 )alkyl group, R 03 is –O-(C 1 -C 6 )alkyl-NR 011 R 011 ’, , wherein R 011 and R 011 ’ independently of one another are a hydrogen atom, an optionally substituted linear or branched (C 1 -C 6 )alkyl group, or –(C 0 -C 6 )alkyl-Cy 01 ; or the pair (R 011 , R 011 ’) together with the nitrogen atom to which they are attached form an aromatic or non-aromatic ring containing 5 to 7 ring members, which optionally contains, in addition to the nitrogen atom, 1 to 3 heteroatoms selected from O, S and N, wherein the N atom may be substituted by 1 or 2 groups selected from a hydrogen atom or a linear or
  • Cy 01 , Cy 02 , Cy 03 , Cy 04 , Cy 05 , Cy 06 , Cy 07 , Cy 08 and Cy 010 independently of one another, are an optionally substituted cycloalkyl group, an optionally substituted heterocycloalkyl group, an optionally substituted aryl group or an optionally substituted heteroaryl group, wherein the optional substituents are selected from optionally substituted linear or branched (C 1 -C 6 )alkyl, optionally substituted linear or branched (C 2 -C 6 )alkenyl group, optionally substituted linear or branched (C 2 -C 6 )alkynyl group, optionally substituted linear or branched (C 1 -C 6 )alkoxy, optionally substituted (C 1 -C 6 )alkyl-S-, hydroxy, oxo (or N-oxide where appropriate), nitro, cyano, -C(O)-OR 0 ’,
  • a drug moiety of the disclosure may comprise any one of the
  • the linker-drug (or “linker-payload”) moiety –(L-D) may comprise a compound selected from Table A.
  • Drug Loading is represented by p, and is also referred to herein as the drug-to- antibody ratio (DAR). Drug loading may range from 1 to 16 drug moieties per antibody or antigen-binding fragment.
  • p is an integer from 1 to 16. In some embodiments, p is an integer from 1 to 16, 1 to 15, 1 to 14, 1 to 13, 1 to 12, 1 to 11, 1 to 10, 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2.
  • p is an integer from 2 to 10, 2 to 9, 2 to 8, 2 to 7, 2 to 6, 2 to 5, 2 to 4, or 2 to 3. In some embodiments, p is an integer from 1 to 16. In some embodiments, p is an integer from 1 to 8. In some embodiments, p is an integer from 1 to 5. In some embodiments, p is an integer from 2 to 4. In some embodiments, p is 1, 2, 3, 4, 5, 6, 7, or 8. In some embodiments, p is 2. In some embodiments, p is 4. [272] Drug loading may be limited by the number of attachment sites on the antibody or antigen-binding fragment.
  • the linker moiety (L) of the ADC attaches to the antibody or antigen-binding fragment through a chemically active group on one or more amino acid residues on the antibody or antigen-binding fragment.
  • the linker may be attached to the antibody or antigen-binding fragment via a free amino, imino, hydroxyl, thiol, or carboxyl group (e.g., to the N- or C-terminus, to the epsilon amino group of one or more lysine residues, to the free carboxylic acid group of one or more glutamic acid or aspartic acid residues, or to the sulfhydryl group of one or more cysteine residues).
  • the site to which the linker is attached can be a natural residue in the amino acid sequence of the antibody or antigen-binding fragment, or it can be introduced into the antibody or antigen-binding fragment, e.g., by DNA recombinant technology (e.g., by introducing a cysteine residue into the amino acid sequence) or by protein biochemistry (e.g., by reduction, pH adjustment, or hydrolysis).
  • the number of drug moieties that can be conjugated to an antibody or antigen-binding fragment is limited by the number of free cysteine residues.
  • an antibody may have only one or a few cysteine thiol groups, or may have only one or a few sufficiently reactive thiol groups through which a linker may be attached.
  • antibodies do not contain many free and reactive cysteine thiol groups that may be linked to a drug moiety. Indeed, most cysteine thiol residues in antibodies are involved in either interchain or intrachain disulfide bonds. Conjugation to cysteines can therefore, in some embodiments, require at least partial reduction of the antibody. Over-attachment of linker-toxin to an antibody may destabilize the antibody by reducing the cysteine residues available to form disulfide bonds.
  • an optimal drug:antibody ratio should increase potency of the ADC (by increasing the number of attached drug moieties per antibody) without destabilizing the antibody or antigen-binding fragment.
  • an optimal ratio may be 2, 4, 6, or 8.
  • an optimal ratio may be 2 or 4.
  • an antibody or antigen-binding fragment is exposed to reducing conditions prior to conjugation in order to generate one or more free cysteine residues.
  • An antibody in some embodiments, may be reduced with a reducing agent such as dithiothreitol (DTT) or tris(2-carboxyethyl)phosphine (TCEP), under partial or total reducing conditions, to generate reactive cysteine thiol groups.
  • DTT dithiothreitol
  • TCEP tris(2-carboxyethyl)phosphine
  • Unpaired cysteines may be generated through partial reduction with limited molar equivalents of TCEP, which can reduce the interchain disulfide bonds which link the light chain and heavy chain (one pair per H-L pairing) and the two heavy chains in the hinge region (two pairs per H-H pairing in the case of human lgG1) while leaving the intrachain disulfide bonds intact (Stefano et al. (2013) Methods Mol Biol. 1045:145-71).
  • disulfide bonds within the antibodies are reduced electrochemically, e.g., by employing a working electrode that applies an alternating reducing and oxidizing voltage.
  • This approach can allow for on-line coupling of disulfide bond reduction to an analytical device (e.g., an electrochemical detection device, an NMR spectrometer, or a mass spectrometer) or a chemical separation device (e.g., a liquid chromatograph (e.g., an HPLC) or an electrophoresis device (see, e.g., US 2014/0069822)).
  • an analytical device e.g., an electrochemical detection device, an NMR spectrometer, or a mass spectrometer
  • a chemical separation device e.g., a liquid chromatograph (e.g., an HPLC) or an electrophoresis device (see, e.g., US 2014/0069822)
  • an antibody is subjected to denaturing conditions to reveal reactive nucleophilic groups on amino acid residues, such as cysteine.
  • the drug loading of an ADC may be controlled in different ways, e.g., by: (i) limiting the molar excess of drug-linker intermediate or linker reagent relative to antibody; (ii) limiting the conjugation reaction time or temperature; (iii) partial or limiting reductive conditions for cysteine thiol modification; and/or (iv) engineering by recombinant techniques the amino acid sequence of the antibody such that the number and position of cysteine residues is modified for control of the number and/or position of linker-drug attachments.
  • cysteine engineered antibodies can be prepared wherein one or more amino acids of a parent antibody are replaced with a cysteine amino acid. Any form of antibody may be so engineered, i.e. mutated.
  • a parent Fab antibody fragment may be engineered to form a cysteine engineered Fab referred to as a “ThioFab.”
  • a parent monoclonal antibody may be engineered to form a “ThioMab.”
  • a single site mutation yields a single engineered cysteine residue in a ThioFab, whereas a single site mutation yields two engineered cysteine residues in a ThioMab, due to the dimeric nature of the IgG antibody.
  • DNA encoding an amino acid sequence variant of the parent polypeptide can be prepared by a variety of methods known in the art (see, e.g., the methods described in WO 2006/034488). These methods include, but are not limited to, preparation by site-directed (or oligonucleotide- mediated) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared
  • ADCs of Formula (1) include, but are not limited to, antibodies that have 1, 2, 3, or 4 engineered cysteine amino acids (Lyon et al. (2012) Methods Enzymol.502:123- 38).
  • one or more free cysteine residues are already present in an antibody or antigen-binding fragment, without the use of engineering, in which case the existing free cysteine residues may be used to conjugate the antibody or antigen-binding fragment to a drug moiety.
  • the resulting product can be a mixture of ADC compounds with a distribution of one or more drug moieties attached to each copy of the antibody or antigen-binding fragment in the mixture.
  • the drug loading in a mixture of ADCs resulting from a conjugation reaction ranges from 1 to 16 drug moieties attached per antibody or antigen- binding fragment.
  • the average number of drug moieties per antibody or antigen-binding fragment may be calculated by any conventional method known in the art, e.g., by mass spectrometry (e.g., liquid chromatography-mass spectrometry (LC-MS)) and/or high-performance liquid chromatography (e.g., HIC-HPLC).
  • mass spectrometry e.g., liquid chromatography-mass spectrometry (LC-MS)
  • HIC-HPLC high-performance liquid chromatography
  • the average number of drug moieties per antibody or antigen-binding fragment is determined by liquid chromatography- mass spectrometry (LC-MS).
  • the average number of drug moieties per antibody or antigen-binding fragment is from about 1.5 to about 3.5, about 2.5 to about 4.5, about 3.5 to about 5.5, about 4.5 to about 6.5, about 5.5 to about 7.5, about 6.5 to about 8.5, or about 7.5 to about 9.5. In some embodiments, the average number of drug moieties per antibody or antigen-binding fragment is from about 2 to about 4, about 3 to about 5, about 4 to about 6, about 5 to about 7, about 6 to about 8, about 7 to about 9, about 2 to about 8, or about 4 to about 8. [278] In some embodiments, the average number of drug moieties per antibody or antigen- binding fragment is about 2.
  • the average number of drug moieties per antibody or antigen-binding fragment is about 1.5, about 1.6, about 1.7, about 1.8, about 1.9, about 2, about 2.1, about 2.2, about 2.3, about 2.4, or about 2.5. In some embodiments, the average number of drug moieties per antibody or antigen-binding fragment is 2. [279] In some embodiments, the average number of drug moieties per antibody or antigen- binding fragment is about 4. In some embodiments, the average number of drug moieties per antibody or antigen-binding fragment is about 3.5, about 3.6, about 3.7, about 3.8, about 3.9, about 4, about 4.1, about 4.2, about 4.3, about 4.4, or about 4.5.
  • the average number of drug moieties per antibody or antigen-binding fragment is 4. [280] In some embodiments, the term “about,” as used with respect to the average number of drug moieties per antibody or antigen-binding fragment, means plus or minus 20%, 15%, 10%, 5%, or 1%. In one embodiment, the term “about” refers to a range of values which are 10% more or less than the specified value. In another embodiment, the term “about” refers to a range of values which are 5% more or less than the specified value. In another embodiment, the term “about” refers to a range of values which are 1% more or less than the specified value.
  • ADC compounds may be identified in the mixture by mass spectroscopy and separated by, e.g., UPLC or HPLC, e.g. hydrophobic interaction chromatography (HIC-HPLC).
  • UPLC or HPLC e.g. hydrophobic interaction chromatography
  • a homogeneous or nearly homogenous ADC product with a single loading value may be isolated from the conjugation mixture, e.g., by electrophoresis or chromatography.
  • higher drug loading e.g., p > 16
  • the drug loading for an ADC of the present disclosure ranges from about 2 to about 16, about 2 to about 10, about 2 to about 8; from about 2 to about 6; from about 2 to about 5; from about 3 to about 5; from about 2 to about 4; or from about 4 to about 8. [283] In some embodiments, a drug loading and/or an average drug loading of about 2 is achieved, e.g., using partial reduction of intrachain disulfides on the antibody or antigen- binding fragment, and provides beneficial properties.
  • a drug loading and/or an average drug loading of about 4 or about 6 or about 8 is achieved, e.g., using partial reduction of intrachain disulfides on the antibody or antigen-binding fragment, and provides beneficial properties.
  • a drug loading and/or an average drug loading of less than about 2 may result in an unacceptably high level of unconjugated antibody species, which can compete with the ADC for binding to the target antigen CD48 and/or provide for reduced treatment efficacy.
  • a drug loading and/or average drug loading of more than about 16 may result in an unacceptably high level of product heterogeneity and/or ADC aggregation.
  • a drug loading and/or an average drug loading of more than about 16 may also affect stability of the ADC, due to loss of one or more chemical bonds required to stabilize the antibody or antigen-binding fragment.
  • the present disclosure includes methods of producing the described ADCs. Briefly, the ADCs comprise an antibody or antigen-binding fragment as the antibody or antigen- binding fragment, a drug moiety (e.g., an Mcl-1 inhibitor), and a linker that joins the drug moiety and the antibody or antigen-binding fragment. In some embodiments, the ADCs can be prepared using a linker having reactive functionalities for covalently attaching to the drug moiety and to the antibody or antigen-binding fragment.
  • the antibody or antigen-binding fragment is functionalized to prepare a functional group that is reactive with a linker or a drug-linker intermediate.
  • a cysteine thiol of an antibody or antigen-binding fragment can form a bond with a reactive functional group of a linker or a drug-linker intermediate to make an ADC.
  • an antibody or antigen-binding fragment is prepared with bacterial transglutaminase (BTG) – reactive glutamines specifically functionalized with an amine containing cyclooctyne BCN (N- [(1R,8S,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl]-1,8-diamino-3,6-dioxaoctane) moiety.
  • BCG transglutaminase
  • BCN cyclooctyne
  • site-specific conjugation of a linker or a drug-linker intermediate to a BCN moiety of an antibody or antigen-binding fragment is performed, e.g., as described and exemplified herein.
  • an ADC is produced by contacting an antibody or antigen- binding fragment with a linker and a drug moiety (e.g., an Mcl-1 inhibitor) in a sequential manner, such that the antibody or antigen-binding fragment is covalently linked to the linker first, and then the pre-formed antibody-linker intermediate reacts with the drug moiety.
  • the antibody-linker intermediate may or may not be subjected to a purification step prior to contacting the drug moiety.
  • an ADC is produced by contacting an antibody or antigen-binding fragment with a linker-drug compound pre-formed by reacting a linker with a drug moiety.
  • the pre-formed linker-drug compound may or may not be subjected to a purification step prior to contacting the antibody or antigen-binding fragment.
  • the antibody or antigen-binding fragment contacts the linker and the drug moiety in one reaction mixture, allowing simultaneous formation of the covalent bonds between the antibody or antigen-binding fragment and the linker, and between the linker and the drug moiety.
  • This method of producing ADCs may include a reaction, wherein the antibody or antigen-binding fragment contacts the antibody or antigen-binding fragment prior to the addition of the linker to the reaction mixture, and vice versa.
  • an ADC is produced by reacting an antibody or antigen-binding fragment with a linker joined to a drug moiety, such as an Mcl-1 inhibitor, under conditions that allow conjugation.
  • a linker joined to a drug moiety such as an Mcl-1 inhibitor
  • the ADCs prepared according to the methods described above may be subjected to a purification step.
  • the purification step may involve any biochemical methods known in the art for purifying proteins, or any combination of methods thereof.
  • THF tangential flow filtration
  • affinity chromatography affinity chromatography
  • ion exchange chromatography any charge or isoelectric point-based chromatography
  • mixed mode chromatography e.g., CHT (ceramic hydroxyapatite)
  • hydrophobic interaction chromatography size exclusion chromatography
  • dialysis filtration, selective precipitation, or any combination thereof.
  • compositions described herein e.g., the disclosed ADC compounds and compositions, in treating a subject for a disorder, e.g., a cancer.
  • Compositions e.g., ADCs
  • Treatment efficacy may be evaluated for toxicity as well as indicators of efficacy and adjusted accordingly.
  • Efficacy measures include, but are not limited to, a cytostatic and/or cytotoxic effect observed in vitro or in vivo, reduced tumor volume, tumor growth inhibition, and/or prolonged survival.
  • the cytotoxic or cytostatic activity of an ADC can be measured by, e.g., exposing mammalian cells expressing the target antigen CD48 of the ADC in a cell culture medium; culturing the cells for a period from about 6 hours to about 6 days; and measuring cell viability (e.g., using a CellTiter-Glo® (CTG) or MTT cell viability assay).
  • CCG CellTiter-Glo®
  • MTT cell viability assay Cell-based in vitro assays may also be used to measure viability (proliferation), cytotoxicity, and induction of apoptosis (caspase activation) of the ADC.
  • necrosis or apoptosis may be measured. Necrosis is typically accompanied by increased permeability of the plasma membrane, swelling of the cell, and rupture of the plasma membrane. Apoptosis can be quantitated, for example, by measuring DNA fragmentation. Commercial photometric methods for the quantitative in vitro determination of DNA fragmentation are available. Examples of such assays, including TUNEL (which detects incorporation of labeled nucleotides in fragmented DNA) and ELISA-based assays, are described in Biochemica (1999) 2:34-7 (Roche Molecular Biochemicals).
  • Apoptosis may also be determined by measuring morphological changes in a cell.
  • loss of plasma membrane integrity can be determined by measuring uptake of certain dyes (e.g., a fluorescent dye such as, for example, acridine orange or ethidium bromide).
  • a fluorescent dye such as, for example, acridine orange or ethidium bromide.
  • a method for measuring apoptotic cell number has been described by Duke and Cohen, Current Protocols in Immunology (Coligan et al., eds. (1992) pp. 3.17.1-3.17.16).
  • Cells also can be labeled with a DNA dye (e.g., acridine orange, ethidium bromide, or propidium iodide) and the cells observed for chromatin condensation and margination along the inner nuclear membrane.
  • Apoptosis may also be determined, in some embodiments, by screening for caspase activity.
  • Glo® Assay can be used to measure activity of caspase-3 and caspase-7.
  • the assay provides a luminogenic caspase-3/7 substrate in a reagent optimized for caspase activity, luciferase activity, and cell lysis.
  • adding Caspase-Glo® 3/7 Reagent in an “add-mix-measure” format may result in cell lysis, followed by caspase cleavage of the substrate and generation of a “glow-type” luminescent signal, produced by luciferase.
  • luminescence may be proportional to the amount of caspase activity present, and can serve as an indicator of apoptosis.
  • morphological changes that can be measured to determine apoptosis include, e.g., cytoplasmic condensation, increased membrane blebbing, and cellular shrinkage. Determination of any of these effects on cancer cells indicates that an ADC is useful in the treatment of cancers.
  • Cell viability may be measured, e.g., by determining in a cell the uptake of a dye such as neutral red, trypan blue, Crystal Violet, or ALAMARTM blue (see, e.g., Page et al. (1993) Inti J Oncology 3:473-6).
  • a dye such as neutral red, trypan blue, Crystal Violet, or ALAMARTM blue
  • the cells are incubated in media containing the dye, the cells are washed, and the remaining dye, reflecting cellular uptake of the dye, is measured spectrophotometrically.
  • Cell viability may also be measured, e.g., by quantifying ATP, an indicator of metabolically active cells.
  • in vitro potency and/or cell viability of prepared ADCs or Mcl-1 inhibitor compounds may be assessed using a CellTiter-Glo®
  • CCG cell viability assay
  • the single reagent CellTiter-Glo® Reagent
  • the addition of reagent results in cell lysis and generation of a luminescent signal proportional to the amount of ATP present.
  • the amount of ATP is directly proportional to the number of cells present in culture
  • Cell viability may also be measured, e.g., by measuring the reduction of tetrazolium salts.
  • in vitro potency and/or cell viability of prepared ADCs or Mcl-1 inhibitor compounds may be assessed using an MTT cell viability assay, as described in the examples provided herein.
  • the yellow tetrazolium MTT (3-(4, 5-dimethylthiazolyl-2)-2,5-diphenyltetrazolium bromide) is reduced by metabolically active cells, in part by the action of dehydrogenase enzymes, to generate reducing equivalents such as NADH and NADPH.
  • the resulting intracellular purple formazan can then be solubilized and quantified by spectrophotometric means.
  • the present disclosure features a method of killing, inhibiting or modulating the growth of a cancer cell or tissue by disrupting the expression and/or activity of Mcl-1 and/or one or more upstream modulators or downstream targets thereof.
  • the method may be used with any subject where disruption of Mcl-1 expression and/or activity provides a therapeutic benefit.
  • Subjects that may benefit from disrupting Mcl-1 expression and/or activity include, but are not limited to, those having or at risk of having a cancer such as a tumor or a hematological cancer.
  • the cancer is a breast cancer, multiple myeloma, plasma cell myeloma, leukemia, lymphoma, gastric cancer, acute myeloid leukemia, bladder cancer, brain cancer, bone marrow cancer, cervical cancer, chronic lymphocytic leukemia, colorectal cancer, esophageal cancer, hepatocellular cancer, lymphoblastic leukemia, follicular lymphoma, lymphoid malignancies of T-cell or B-cell origin, melanoma, myelogenous leukemia, myeloma, oral cancer, ovarian cancer, non-small cell lung cancer, chronic lymphocytic leukemia, prostate cancer, small cell lung cancer, or spleen cancer.
  • the cancer is a lymphoma or gastric cancer.
  • Exemplary methods include the steps of contacting a cell with an ADC, as described herein, in an effective amount, i.e., an amount sufficient to kill the cell.
  • the method can be used on cells in culture, e.g., in vitro, in vivo, ex vivo, or in situ.
  • cells that express CD48 e.g., cells collected by biopsy of a tumor or metastatic lesion; cells from an established cancer cell line; or recombinant cells
  • the contacting step can be affected by adding the ADC to the culture medium.
  • the method will result in killing of cells expressing CD48, including in particular cancer cells expressing CD48.
  • the ADC can be administered to a subject by any suitable administration route (e.g., intravenous, subcutaneous, or direct contact with a tumor tissue) to have an effect in vivo.
  • the in vivo effect of a disclosed ADC therapeutic composition can be evaluated in a suitable animal model.
  • xenogeneic cancer models can be used, wherein cancer explants or passaged xenograft tissues are introduced into immune compromised animals, such as nude or SCID mice (Klein et al. (1997) Nature Med. 3:402-8). Efficacy may be predicted using assays that measure inhibition of tumor formation, tumor regression or metastasis, and the like.
  • xenografts from tumor bearing mice treated with the therapeutic composition can be examined for the presence of apoptotic foci and compared to untreated control xenograft-bearing mice. The extent to which apoptotic foci are found in the tumors of the treated mice provides an indication of the therapeutic efficacy of the composition.
  • compositions described herein e.g., the ADCs disclosed herein, can be administered to a non-human mammal or human subject for therapeutic purposes.
  • the therapeutic methods include administering to a subject having or suspected of having a cancer a therapeutically effective amount of a composition comprising an Mcl-1 inhibitor, e.g., an ADC where the inhibitor is linked to a targeting antibody that binds to an antigen (1) expressed on a cancer cell, (2) is accessible to binding, and/or (3) is localized or predominantly expressed on a cancer cell surface as compared to a non-cancer cell.
  • An exemplary embodiment is a method of treating a subject having or suspected of having a cancer, comprising administering to the subject a therapeutically effective amount of a composition disclosed herein, e.g., an ADC, composition, or pharmaceutical composition (e.g., any of the exemplary ADCs, compositions, or pharmaceutical compositions disclosed herein).
  • a composition disclosed herein e.g., an ADC, composition, or pharmaceutical composition
  • the cancer expresses the target antigen CD48.
  • the cancer is a tumor or a hematological cancer.
  • the cancer is a breast cancer, multiple myeloma, plasma cell myeloma, leukemia, lymphoma, gastric cancer, acute myeloid leukemia, bladder cancer, brain cancer, bone marrow cancer, cervical cancer, chronic lymphocytic leukemia, colorectal cancer, esophageal cancer, hepatocellular cancer, lymphoblastic leukemia, follicular lymphoma, lymphoid malignancies of T-cell or B-cell origin, melanoma, myelogenous leukemia, myeloma, oral cancer, ovarian cancer, non-small cell lung cancer, chronic lymphocytic leukemia, prostate cancer, small cell lung cancer, or spleen cancer.
  • the cancer is a lymphoma or gastric cancer.
  • Another exemplary embodiment is a method of delivering an Mcl-1 inhibitor to a cell expressing CD48, comprising conjugating the Mcl-1 inhibitor to an antibody that immunospecifically binds to a CD48 epitope and exposing the cell to the ADC.
  • Exemplary cancer cells that express CD48 for which the ADCs of the present disclosure are indicated include multiple myeloma cells.
  • the present disclosure further provides methods of reducing or inhibiting growth of a tumor (e.g., a CD48-expressing tumor), comprising administering a therapeutically effective amount of an ADC or composition comprising an ADC.
  • a tumor e.g., a CD48-expressing tumor
  • the treatment is sufficient to reduce or inhibit the growth of the patient’s tumor, reduce the number or size of metastatic lesions, reduce tumor load, reduce primary tumor load, reduce invasiveness, prolong survival time, and/or maintain or improve the quality of life.
  • the tumor is resistant or refractory to treatment with the antibody or antigen-binding fragment of the ADC (e.g., an anti-CD48 antibody) when administered alone, and/or the tumor is resistant or refractory to treatment with the Mcl-1 inhibitor drug moiety when administered alone.
  • the antibody or antigen-binding fragment of the ADC e.g., an anti-CD48 antibody
  • the tumor is resistant or refractory to treatment with the Mcl-1 inhibitor drug moiety when administered alone.
  • An exemplary embodiment is a method of reducing or inhibiting the growth of a tumor in a subject, comprising administering to the subject a therapeutically effective amount of an ADC, composition, or pharmaceutical composition (e.g., any of the exemplary ADCs, compositions, or pharmaceutical compositions disclosed herein).
  • the tumor expresses the target antigen CD48.
  • the tumor is a breast cancer, gastric cancer, bladder cancer, brain cancer, cervical cancer, colorectal cancer, esophageal cancer, hepatocellular cancer, melanoma, oral cancer, ovarian cancer, non small cell lung cancer, prostate cancer, small cell lung cancer, or spleen cancer.
  • the tumor is a gastric cancer.
  • administration of the ADC, composition, or pharmaceutical composition reduces or inhibits the growth of the tumor by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 99%, as compared to growth in the absence of treatment.
  • Another exemplary embodiment is a method of delaying or slowing the growth of a tumor in a subject, comprising administering to the subject a therapeutically effective amount of an ADC, composition, or pharmaceutical composition (e.g., any of the exemplary ADCs, compositions, or pharmaceutical compositions disclosed herein).
  • the tumor expresses the target antigen CD48.
  • the tumor is a breast cancer, gastric cancer, bladder cancer, brain cancer, cervical cancer, colorectal cancer, esophageal cancer, hepatocellular cancer, melanoma, oral cancer, ovarian cancer, non- small cell lung cancer, prostate cancer, small cell lung cancer, or spleen cancer.
  • the tumor is a gastric cancer.
  • administration of the ADC, composition, or pharmaceutical composition delays or slows the growth of the tumor by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 99%, as compared to growth in the absence of treatment.
  • the present disclosure further provides methods of reducing or slowing the expansion of a cancer cell population (e.g., a CD48-expressing cancer cell population), comprising administering a therapeutically effective amount of an ADC or composition comprising an ADC.
  • An exemplary embodiment is a method of reducing or slowing the expansion of a cancer cell population in a subject, comprising administering to the subject a therapeutically effective amount of an ADC, composition, or pharmaceutical composition (e.g., any of the exemplary ADCs, compositions, or pharmaceutical compositions disclosed herein).
  • the cancer cell population expresses the target antigen CD48.
  • the cancer cell population is from a tumor or a hematological cancer.
  • the cancer cell population is from a breast cancer, multiple myeloma, plasma cell myeloma, leukemia, lymphoma, gastric cancer, acute myeloid leukemia, bladder cancer, brain cancer, bone marrow cancer, cervical cancer, chronic lymphocytic leukemia, colorectal cancer, esophageal cancer, hepatocellular cancer, lymphoblastic leukemia, follicular lymphoma, lymphoid malignancies of T-cell or B-cell origin, melanoma, myelogenous leukemia, myeloma, oral cancer, ovarian cancer, non-small cell lung cancer, chronic lymphocytic leukemia, prostate cancer, small cell lung cancer, or spleen cancer.
  • the cancer cell population is from a lymphoma or gastric cancer.
  • administration of the ADC, composition, or pharmaceutical composition reduces the cancer cell population by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 99%, as compared to the population in the absence of treatment.
  • administration of the ADC, composition, or pharmaceutical composition slows the expansion of the cancer cell population by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 99%, as compared to expansion in the absence of treatment.
  • An exemplary embodiment is a method of determining whether a subject having or suspected of having a cancer will be responsive to treatment with an ADC, composition, or pharmaceutical composition (e.g., any of the exemplary ADCs, compositions, or pharmaceutical compositions disclosed herein) by providing a biological sample from the subject; contacting the sample with the ADC; and detecting binding of the ADC to cancer cells in the sample.
  • the sample is a tissue biopsy sample, a blood sample, or a bone marrow sample.
  • the method comprises providing a biological sample from the subject; contacting the sample with the ADC; and detecting one or more markers of cancer cell death in the sample (e.g., increased expression of one or more apoptotic markers, reduced expansion of a cancer cell population in culture, etc.).
  • one or more markers of cancer cell death in the sample e.g., increased expression of one or more apoptotic markers, reduced expansion of a cancer cell population in culture, etc.
  • An exemplary embodiment is an ADC, composition, or pharmaceutical composition (e.g., any of the exemplary ADCs, compositions, or pharmaceutical compositions disclosed herein) for use in treating a subject having or suspected of having a cancer (e.g., a CD48-expressing cancer).
  • Another exemplary embodiment is a use of an ADC, composition, or pharmaceutical composition (e.g., any of the exemplary ADCs, compositions, or pharmaceutical compositions disclosed herein) in treating a subject having or suspected of having a cancer (e.g., a CD48-expressing cancer).
  • Another exemplary embodiment is a use of an ADC, composition, or pharmaceutical composition (e.g., any of the exemplary ADCs, compositions, or pharmaceutical compositions disclosed herein) in a method of manufacturing a medicament for treating a subject having or suspected of having a cancer (e.g., a CD48-expressing cancer).
  • a cancer e.g., a CD48-expressing cancer.
  • ADCs of the present disclosure may be administered to a non-human mammal expressing an antigen with which the ADC is capable of binding for veterinary purposes or as an animal model of human disease. Regarding the latter, such animal models may be useful for evaluating the therapeutic efficacy of the disclosed ADCs (e.g., testing of dosages and time courses of administration).
  • compositions used in the practice of the foregoing methods may be formulated into pharmaceutical compositions comprising a pharmaceutically acceptable carrier suitable for the desired delivery method.
  • An exemplary embodiment is a pharmaceutical composition comprising an ADC of the present disclosure and a pharmaceutically acceptable carrier, e.g., one suitable for a chosen means of administration, e.g., intravenous administration.
  • the pharmaceutical composition may also comprise one or more additional inactive and/or therapeutic agents that are suitable for treating or preventing, for example, a cancer (e.g., a standard-of-care agent, etc.).
  • the pharmaceutical composition may also comprise one or more carrier, excipient, and/or stabilizer components, and the like. Methods of formulating such pharmaceutical compositions and suitable formulations are known in the art (see, e.g., “Remington’s Pharmaceutical Sciences,” Mack Publishing Co., Easton, PA).
  • Suitable carriers include any material that, when combined with the therapeutic composition, retains the anti-tumor function of the therapeutic composition and is generally non-reactive with the patient’s immune system.
  • Pharmaceutically acceptable carriers include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • Examples of pharmaceutically acceptable carriers include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, mesylate salt, and the like, as well as combinations thereof.
  • isotonic agents are included, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
  • Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the ADC.
  • a pharmaceutical composition of the present disclosure can be administered by a variety of methods known in the art.
  • the route and/or mode of administration may vary depending upon the desired results.
  • the therapeutic formulation is solubilized and administered via any route capable of delivering the therapeutic composition to the cancer site.
  • Potentially effective routes of administration include, but are not limited to, parenteral (e.g., intravenous, subcutaneous), intraperitoneal, intramuscular, intratumor, intradermal, intraorgan, orthotopic, and the like.
  • the administration is intravenous, subcutaneous, intraperitoneal, or intramuscular.
  • the pharmaceutically acceptable carrier should be suitable for the route of administration, e.g., intravenous or subcutaneous administration (e.g., by injection or infusion).
  • the active compound(s) i.e., the ADC and/or any additional therapeutic agent
  • the active compound(s) may be coated in a material to protect the compound(s) from the action of acids and other natural conditions that may inactivate the compound(s).
  • Administration can be either systemic or local.
  • the therapeutic compositions disclosed herein may be sterile and stable under the conditions of manufacture and storage, and may be in a variety of forms. These include, for example, liquid, semi-solid, and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes, and suppositories. The form depends on the intended mode of administration and therapeutic application.
  • the disclosed ADCs can be incorporated into a pharmaceutical composition suitable for parenteral administration.
  • the injectable solution may be composed of either a liquid or lyophilized dosage form in a flint or amber vial, ampule, or pre-filled syringe, or other known delivery or storage device.
  • one or more of the ADCs or pharmaceutical compositions is supplied as a dry sterilized lyophilized powder or water free concentrate in a hermetically sealed container and can be reconstituted (e.g., with water or saline) to the appropriate concentration for administration to a subject.
  • a therapeutically effective amount or efficacious amount of a disclosed composition is employed in the pharmaceutical compositions of the present disclosure.
  • the composition e.g., one comprising an ADC, may be formulated into a pharmaceutically acceptable dosage form by conventional methods known in the art. Dosages and administration protocols for the treatment of cancers using the foregoing methods will vary with the method and the target cancer, and will generally depend on a number of other factors appreciated in the art.
  • compositions disclosed herein e.g., those comprising ADCs alone or in combination with at least one additional inactive and/or active therapeutic agent, may be adjusted to provide the optimum desired response (e.g., a therapeutic response).
  • a single bolus of one or both agents may be administered at one time, several divided doses may be administered over a predetermined period of time, or the dose of one or both agents may be proportionally increased or decreased as indicated by the exigencies of the therapeutic situation.
  • treatment involves single bolus or repeated administration of the ADC preparation via an acceptable route of administration.
  • the ADC is administered to the patient daily, weekly, monthly, or any time period in between.
  • specific dosage regimens may be adjusted over time according to the individual’s need, and the professional judgment of the treating clinician.
  • Parenteral compositions may be formulated in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • Dosage values for compositions comprising an ADC and/or any additional therapeutic agent(s), may be selected based on the unique characteristics of the active compound(s), and the particular therapeutic effect to be achieved.
  • a physician or veterinarian can start doses of the ADC employed in the pharmaceutical composition at levels lower than that required to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
  • effective doses of the compositions of the present disclosure, for the treatment of a cancer may vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic.
  • the selected dosage level may also depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present disclosure employed, or the ester, salt, or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors. Treatment dosages may be titrated to optimize safety and efficacy.
  • Toxicity and therapeutic efficacy of compounds provided herein can be determined by standard pharmaceutical procedures in cell culture or in animal models. For example, LD50, ED50, EC50, and IC50 may be determined, and the dose ratio between toxic and therapeutic effects (LD50/ED50) may be calculated as the therapeutic index.
  • the data obtained from in vitro and in vivo assays can be used in estimating or formulating a range of dosage for use in humans.
  • the compositions and methods disclosed herein may initially be evaluated in xenogeneic cancer models (e.g., an NCI-FI929 multiple myeloma mouse model).
  • an ADC or composition comprising an ADC is administered on a single occasion. In other embodiments, an ADC or composition comprising an ADC is administered on multiple occasions. Intervals between single dosages can be, e.g., daily, weekly, monthly, or yearly. Intervals can also be irregular, based on measuring blood levels of the administered agent (e.g., the ADC) in the patient in order to maintain a relatively consistent plasma concentration of the agent.
  • the dosage and frequency of administration of an ADC or composition comprising an ADC may also vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage may be administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives.
  • a relatively higher dosage at relatively shorter intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of one or more symptoms of disease. Thereafter, the patient may be administered a lower, e.g., prophylactic regime.
  • the above therapeutic approaches can be combined with any one of a wide variety of additional surgical, chemotherapy, or radiation therapy regimens.
  • the ADCs or compositions disclosed herein are co-formulated and/or co-administered with one or more additional therapeutic agents, e.g., one or more chemotherapeutic agents, one or more standard-of-care agents for the particular condition being treated.
  • Kits for use in the therapeutic and/or diagnostic applications described herein are also provided.
  • Such kits may comprise a carrier, package, or container that is compartmentalized to receive one or more containers such as vials, tubes, and the like, each of the container(s) comprising one of the separate elements to be used in a method disclosed herein.
  • a label may be present on or with the container(s) to indicate that an ADC or composition within the kit is used for a specific therapy or non-therapeutic application, such as a prognostic, prophylactic, diagnostic, or laboratory application.
  • a label may also indicate directions for either in vivo or in vitro use, such as those described herein.
  • Directions and or other information may also be included on an insert(s) or label(s), which is included with or on the kit.
  • the label may be on or associated with the container.
  • a label may be on a container when letters, numbers, or other characters forming the label are molded or etched into the container itself.
  • a label may be associated with a container when it is present within a receptacle or carrier that also holds the container, e.g., as a package insert.
  • the label may indicate that an ADC or composition within the kit is used for diagnosing or treating a condition, such as a cancer a described herein.
  • kits comprises an ADC or composition comprising an ADC.
  • the kit further comprises one or more additional components, including but not limited to: instructions for use; other reagents, e.g., a therapeutic agent
  • a standard-of-care agent e.g., a standard-of-care agent
  • kits for administration; pharmaceutically acceptable carriers; and devices, containers, or other materials for administering the ADC to a subject.
  • Instructions for use can include guidance for therapeutic applications including suggested dosages and/or modes of administration, e.g., in a patient having or suspected of having a cancer.
  • the kit comprises an ADC and instructions for use of the ADC in treating, preventing, and/or diagnosing a cancer.
  • COMBINATION THERAPIES [321]
  • the present disclosure provides methods of treatment wherein the antibody-drug conjugates disclosed herein are administered in combination with one or more additional therapeutic agents. Exemplary combination partners are disclosed herein.
  • a combination described herein comprises a PD-1 inhibitor.
  • the PD-1 inhibitor is chosen from PDR001 (Novartis), Nivolumab (Bristol-Myers Squibb), Pembrolizumab (Merck & Co), Pidilizumab (CureTech), MEDI0680 (Medimmune), REGN2810 (Regeneron), TSR-042 (Tesaro), PF-06801591 (Pfizer), BGB- A317 (Beigene), BGB-108 (Beigene), INCSHR1210 (Incyte), or AMP-224 (Amplimmune).
  • the PD-1 inhibitor is PDR001.
  • PDR001 is also known as Spartalizumab.
  • a combination described herein comprises a LAG-3 inhibitor.
  • the LAG-3 inhibitor is chosen from LAG525 (Novartis), BMS-986016 (Bristol-Myers Squibb), or TSR-033 (Tesaro).
  • a combination described herein comprises a TIM-3 inhibitor.
  • the TIM-3 inhibitor is MBG453 (Novartis), TSR-022 (Tesaro), LY- 3321367 (Eli Lily), Sym23 (Symphogen), BGB-A425 (Beigene), INCAGN-2390 (Agenus), BMS-986258 (BMS), RO-7121661 (Roche), or LY-3415244 (Eli Lilly).
  • a combination descdribed herein comprises a PDL1 inhibitor.
  • the PDL1 inhibitor is chosen from FAZ053 (Novartis), atezolizumab (Genentech), durvalumab (Astra Zeneca), or avelumab (Pfizer).
  • a combination described herein comprises a GITR agonist.
  • the GITR agonist is chosen from GWN323 (NVS), BMS-986156, MK- 4166 or MK-1248 (Merck), TRX518 (Leap Therapeutics), INCAGN1876 (Incyte/Agenus), AMG 228 (Amgen) or INBRX-110 (Inhibrx).
  • a combination described herein comprises an IAP inhibitor.
  • the IAP inhibitor comprises LCL161 or a compound disclosed in International Application Publication No. WO 2008/016893.
  • the combination comprises an mTOR inhibitor, e.g., RAD001 (also known as everolimus).
  • the combination comprises a HDAC inhibitor, e.g., LBH589. LBH589 is also known as panobinostat.
  • the combination comprises an IL-17 inhibitor, e.g., CJM112.
  • a combination described herein comprises an estrogen receptor (ER) antagonist.
  • the estrogen receptor antagonist is used in combination with a PD-1 inhibitor, a CDK4/6 inhibitor, or both.
  • the combination is used to treat an ER positive (ER+) cancer or a breast cancer (e.g ., an ER+ breast cancer).
  • the estrogen receptor antagonist is a selective estrogen receptor degrader (SERD).
  • SESDs are estrogen receptor antagonists which bind to the receptor and result in e.g., degradation or down-regulation of the receptor (Boer K. et al.,
  • ER is a hormone- activated transcription factor important for e.g., the growth, development and physiology of the human reproductive system. ER is activated by, e.g., the hormone estrogen (17beta estradiol). ER expression and signaling is implicated in cancers ⁇ e.g., breast cancer), e.g., ER positive (ER+) breast cancer.
  • the SERD is chosen from LSZ102, fulvestrant, brilanestrant, or elacestrant.
  • the SERD comprises a compound disclosed in International Application Publication No. WO 2014/130310, which is hereby incorporated by reference in its entirety.
  • the SERD comprises LSZ102.
  • LSZ102 has the chemical name: (E)-3-(4-((2-(2-(1 ,1-difluoroethyl)-4-fluorophenyl)-6-hydroxybenzo[b]thiophen-3- yl)oxy)phenyl)acrylic acid.
  • the SERD comprises fulvestrant (CAS Registry Number: 129453-61-8), or a compound disclosed in International Application Publication No. WO 2001/051056, which is hereby incorporated by reference in its entirety.
  • the SERD comprises elacestrant (CAS Registry Number: 722533-56- 4), or a compound disclosed in U.S. Patent No. 7,612,114, which is incorporated by reference in its entirety.
  • Elacestrant is also known as RAD1901 , ER-306323 or (6R)-6- ⁇ 2- [Ethyl( ⁇ 4-[2-(ethylamino)ethyl]phenyl ⁇ methyl)amino]-4-methoxyphenyl ⁇ -5, 6,7,8- tetrahydronaphthalen-2-ol.
  • Elacestrant is an orally bioavailable, non-steroidal combined selective estrogens receptor modulator (SERM) and a SERD.
  • SERM non-steroidal combined selective estrogens receptor modulator
  • Elacestrant is also disclosed, e.g., in Garner F et al., (2015) Anticancer Drugs 26(9):948-56.
  • the SERD is brilanestrant (CAS Registry Number: 1365888-06-7), or a compound disclosed in International Application Publication No. WO 2015/136017, which is incorporated by reference in its entirety.
  • the SERD is chosen from RU 58668, GW7604, AZD9496, apeledoxifene, pipendoxifene, arzoxifene, OP-1074, or acolbifene, e.g., as disclosed in McDonell etal. (2015) Journal of Medicinal Chemistry 58(12) 4883-4887.
  • a combination described herein comprises an inhibitor of Cyclin-Dependent Kinases 4 or 6 (CDK4/6).
  • CDK4/6 Cyclin-Dependent Kinases 4 or 6
  • the CDK4/6 inhibitor is used in combination with a PD-1 inhibitor, an estrogen receptor (ER) antagonist, or both.
  • the combination is used to treat an ER positive (ER+) cancer or a breast cancer (e.g., an ER+ breast cancer).
  • the CDK4/6 inhibitor is chosen from ribociclib, abemaciclib (Eli Lilly), or palbociclib.
  • the CDK4/6 inhibitor comprises ribociclib (CAS Registry Number: 1211441-98-3), or a compound disclosed in U.S. Patent Nos.8,415,355 and 8,685,980, which are incorporated by reference in their entirety.
  • the CDK4/6 inhibitor comprises a compound disclosed in International Application Publication No. WO 2010/020675 and U.S. Patent Nos.8,415,355 and 8,685,980, which are incorporated by reference in their entirety.
  • the CDK4/6 inhibitor comprises ribociclib (CAS Registry Number: 1211441-98-3). Ribociclib is also known as LEE011, KISQALI®, or 7-cyclopentyl- N,N-dimethyl-2-((5-(piperazin-1-yl)pyridin-2-yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6- carboxamide. [341] In some embodiments, the CDK4/6 inhibitor comprises abemaciclib (CAS Registry Number: 1231929-97-7).
  • Abemaciclib is also known as LY835219 or N-[5-[(4-Ethyl-1- piperazinyl)methyl]-2-pyridinyl]-5-fluoro-4-[4-fluoro-2-methyl-1-(1-methylethyl)-1H- benzimidazol-6-yl]-2-pyrimidinamine.
  • Abemaciclib is a CDK inhibitor selective for CDK4 and CDK6 and is disclosed, e.g., in Torres-Guzman R et al. (2017) Oncotarget 10.18632/oncotarget.17778. [342]
  • the CDK4/6 inhibitor comprises palbociclib (CAS Registry Number: 571190-30-2).
  • Palbociclib is also known as PD-0332991, IBRANCE® or 6-Acetyl- 8-cyclopentyl-5-methyl-2- ⁇ [5-(1-piperazinyl)-2-pyridinyl]amino ⁇ pyrido[2,3-d]pyrimidin-7(8H)- one.
  • Palbociclib inhibits CDK4 with an IC50 of 11nM, and inhibits CDK6 with an IC50 of 16nM, and is disclosed, e.g., in Finn et al. (2009) Breast Cancer Research 11(5):R77.
  • a combination described herein comprises an inhibitor of chemokine (C-X-C motif) receptor 2 (CXCR2).
  • the CXCR2 inhibitor is chosen from 6-chloro-3-((3,4-dioxo-2-(pentan-3-ylamino)cyclobut-1-en-1-yl)amino)-2- hydroxy-N-methoxy-N-methylbenzenesulfonamide, danirixin, reparixin, or navarixin.
  • the CSF-1/1R binding agent is chosen from an inhibitor of macrophage colony-stimulating factor (M-CSF), e.g., a monoclonal antibody or Fab to M- CSF (e.g., MCS110), a CSF-1R tyrosine kinase inhibitor (e.g., 4-((2-(((1R,2R)-2- hydroxycyclohexyl)amino)benzo[d]thiazol-6-yl)oxy)-N-methylpicolinamide or BLZ945), a receptor tyrosine kinase inhibitor (RTK) (e.g., pexidartinib), or an antibody targeting CSF-1R (e.g., emactuzumab or FPA008).
  • M-CSF macrophage colony-stimulating factor
  • MCS110 monoclonal antibody or Fab to M- CSF
  • CSF-1R tyrosine kinase inhibitor e
  • the CSF-1/1R inhibitor is BLZ945.
  • the CSF-1/1R binding agent is MCS110.
  • the CSF-1/1R binding agent is pexidartinib.
  • a combination described herein comprises a c-MET inhibitor.
  • C-MET a receptor tyrosine kinase overexpressed or mutated in many tumor cell types, plays key roles in tumor cell proliferation, survival, invasion, metastasis, and tumor angiogenesis. Inhibition of c-MET may induce cell death in tumor cells overexpressing c- MET protein or expressing constitutively activated c-MET protein.
  • the c-MET inhibitor is chosen from capmatinib (INC280), JNJ-3887605, AMG 337, LY2801653, MSC2156119J, crizotinib, tivantinib, or golvatinib.
  • a combination described herein comprises a transforming growth factor beta (also known as TGF- ⁇ TGF ⁇ , TGFb, or TGF-beta, used interchangeably herein) inhibitor.
  • the TGF- ⁇ inhibitor is chosen from fresolimumab or XOMA 089.
  • a combination described herein comprises an adenosine A2a receptor (A2aR) antagonist (e.g., an inhibitor of A2aR pathway, e.g., an adenosine inhibitor, e.g., an inhibitor of A2aR or CD-73).
  • A2aR antagonist is used in combination with a PD-1 inhibitor, and one or more (e.g., two, three, four, five, or all) of a CXCR2 inhibitor, a CSF-1/1R binding agent, LAG-3 inhibitor, a GITR agonist, a c-MET inhibitor, or an IDO inhibitor.
  • the combination is used to treat a pancreatic cancer, a colorectal cancer, a gastric cancer, or a melanoma (e.g., a refractory melanoma).
  • the A2aR antagonist is chosen from PBF509 (NIR178) (Palobiofarma/Novartis), CPI444/V81444 (Corvus/Genentech), AZD4635/HTL-1071 (AstraZeneca/Heptares), Vipadenant (Redox/Juno), GBV-2034 (Globavir), AB928 (Arcus Biosciences), Theophylline, Istradefylline (Kyowa Hakko Kogyo), Tozadenant/SYN-115 (Acorda), KW-6356 (Kyowa Hakko Kogyo), ST-4206 (Leadiant Biosciences), or Preladenant/SCH 420814 (Merck/Scher
  • a combination described herein comprises an inhibitor of indoleamine 2,3-dioxygenase (IDO) and/or tryptophan 2,3-dioxygenase (TDO).
  • IDO indoleamine 2,3-dioxygenase
  • TDO tryptophan 2,3-dioxygenase
  • the IDO inhibitor is used in combination with a PD-1 inhibitor, and one or more (e.g., two, three, four, or all) of a TGF- ⁇ inhibitor, an A2aR antagonist, a CSF-1/1R binding agent, a c-MET inhibitor, or a GITR agonist.
  • the combination is used to treat a pancreatic cancer, a colorectal cancer, a gastric cancer, or a melanoma (e.g., a refractory melanoma).
  • the IDO inhibitor is chosen from (4E)- 4-[(3-chloro-4-fluoroanilino)-nitrosomethylidene]-1,2,5-oxadiazol-3-amine (also known as epacadostat or INCB24360), indoximod (NLG8189), (1-methyl-D-tryptophan), ⁇ -cyclohexyl- 5H-Imidazo[5,1-a]isoindole-5-ethanol (also known as NLG919), indoximod, BMS-986205 (formerly F001287).
  • a combination described herein comprises a Galectin, e.g., Galectin-1 or Galectin-3, inhibitor.
  • the combination comprises a Galectin-1 inhibitor and a Galectin-3 inhibitor.
  • the combination comprises a bispecific inhibitor (e.g., a bispecific antibody molecule) targeting both Galectin- 1 and Galectin-3.
  • the Galectin inhibitor is used in combination with one or more therapeutic agents described herein.
  • the Galectin inhibitor is chosen from an anti-Galectin antibody molecule, GR-MD-02 (Galectin Therapeutics), Galectin-3C (Mandal Med), Anginex, or OTX-008 (OncoEthix, Merck).
  • a combination described herein comprises a MEK inhibitor.
  • the MEK inhibitor is chosen from Trametinib, selumetinib, AS703026, BIX 02189, BIX 02188, CI-1040, PD0325901, PD98059, U0126, XL-518, G-38963, or G02443714.
  • the MEK inhibitor is Trametinib.
  • a combination described herein includes an interleukin-1 beta (IL-1 ⁇ ) inhibitor.
  • the IL-1 ⁇ inhibitor is chosen from canakinumab, gevokizumab, Anakinra, or Rilonacept.
  • a combination described herein comprises an IL-15/IL-15Ra complex.
  • the IL-15/IL-15Ra complex is chosen from NIZ985 (Novartis), ATL-803 (Altor) or CYP0150 (Cytune).
  • a combination described herein comprises a mouse double minute 2 homolog (MDM2) inhibitor. The human homolog of MDM2 is also known as HDM2.
  • an MDM2 inhibitor described herein is also known as a HDM2 inhibitor.
  • the MDM2 inhibitor is chosen from HDM201 or CGM097.
  • the MDM2 inhibitor comprises (S)-1-(4-chlorophenyl)-7- isopropoxy-6-methoxy-2-(4-(methyl(((1r,4S)-4-(4-methyl-3-oxopiperazin-1- yl)cyclohexyl)methyl)amino)phenyl)-1,2-dihydroisoquinolin-3(4H)-one (also known as CGM097) or a compound disclosed in PCT Publication No.
  • a therapeutic agent disclosed herein is used in combination with CGM097.
  • a combination described herein comprises a hypomethylating agent (HMA).
  • the HMA is chosen from decitabine or azacitidine.
  • a combination described herein comprises an inhibitor acting on pro-survival proteins of the Bcl2 family.
  • a combination described herein comprises a Bcl-2 inhibitor.
  • the Bcl-2 inhibitor is venetoclax: In one embodiment, the Bcl-2 inhibitor is selected from the compounds described in WO 2013/110890 and WO 2015/011400. In some embodiments, the Bcl-2 inhibitor comprises navitoclax (ABT-263), ABT-737, BP1002, SPC2996, APG-1252, obatoclax mesylate (GX15- 070MS), PNT2258, Zn-d5, BGB-11417, or oblimersen (G3139).
  • the Bcl-2 inhibitor is (S)-5-(5-chloro-2-(3-(morpholinomethyl)-1,2,3,4-tetrahydroisoquinoline-2- carbonyl)phenyl)-N-(5-cyano-1,2-dimethyl-1H-pyrrol-3-yl)-N-(4-hydroxyphenyl)-1,2-dimethyl- 1H-pyrrole-3-carboxamide), compound A1:
  • the Bcl-2 inhibitor is N-(4-hydroxyphenyl)-3-[6-[(3S)-3-(morpholinomethyl)-3,4-dihydro-1H-isoquinoline-2- carbonyl]-1,3-benzodioxol-5-yl]-N-phenyl-5,6,7,8-tetrahydroindolizine-1-carboxamide, compound A2: [357]
  • the antibody-drug conjugates or combinations disclosed herein are suitable for the treatment of cancer
  • the combination can be used to inhibit the growth of cancerous tumors.
  • the combination can also be used in combination with one or more of: a standard of care treatment (e.g., for cancers or infectious disorders), a vaccine (e.g., a therapeutic cancer vaccine), a cell therapy, a radiation therapy, surgery, or any other therapeutic agent or modality, to treat a disorder herein.
  • a standard of care treatment e.g., for cancers or infectious disorders
  • a vaccine e.g., a therapeutic cancer vaccine
  • the combination can be administered together with an antigen of interest.
  • a combination disclosed herein can be administered in either order or simultaneously.
  • R 2 is a hydrophilic moiety selected from polyethylene glycol, polyalkylene glycol, a sugar, an oligosaccharide, a polypeptide or C 2 -C 6 alkyl substituted with 1 to
  • D is a Drug moiety as defined herein and comprising an N or an O, wherein D is connected to A via a direct bond from A to the N or the O of the Drug moiety.
  • Embodiment 8 The compound of Formula (A’) or of any one of Embodiments 1 to 7, or pharmaceutically acceptable salt thereof, wherein:
  • Lp is a bivalent peptide spacer selected from (ValCit), where the * of Lp indicates the attachment point to Li and the ** of Lp indicates the attachment point to the -NH- group of G;
  • Embodiment 9 The compound of Formula (A’) or of any one of Embodiments 1 to 8, or pharmaceutically acceptable salt thereof, wherein R 1 is a reactive group selected from Table 2.
  • Embodiment 12 The compound of Formula (A’) or of any one of Embodiments 1 to 9, or pharmaceutically acceptable salt thereof, wherein: Embodiment 13.
  • Embodiment 15. The compound of Formula (A’) or of any one of Embodiments 1 to 9, or pharmaceutically acceptable salt thereof, wherein R 1 is –ONH 2 .
  • Embodiment 17. The compound of Formula (A’) or of any one of Embodiments 1 to 9, or pharmaceutically acceptable salt thereof, wherein: R 1 is Embodiment 18.
  • the compound of Formula (A’) or of any one of Embodiments 1 to 9 or pharmaceutically acceptable salt thereof, having the structure: Xa is –CH 2 -, -OCH 2 -, -NHCH 2 - or –NRCH 2 - and each R independently is H, -CH 3 or – CH 2 CH 2 C( O)OH.
  • the compound of Formula (A’) or of any one of Embodiments 1 to 9, or pharmaceutically acceptable salt thereof, having the structure: Xb is –CH 2 -, -OCH 2 -, -NHCH 2 - or –NRCH 2 - and each R independently is H, -CH 3 or -CH 2 CH 2 C( O)OH.
  • Embodiment 50 The linker of any one of Embodiments 32 to 46, having the structure:
  • Embodiment 54 The linker of any one of Embodiments 32 to 46, having the structure:
  • Embodiment 55 The linker of any one of Embodiments 32 to 46, having the structure:
  • Embodiment 56 The linker of any one of Embodiments 32 to 46, having the structure:
  • Embodiment 57 The linker of any one of Embodiments 32 to 46, having the structure:
  • Embodiment 58 The linker of any one of Embodiments 32 to 46, having the structure:
  • Embodiment 59 The linker of any one of Embodiments 32 to 46, having the structure:
  • Antibody Drug Conjugates of the Invention provides Antibody Drug Conjugates, also referred to herein as immunoconjugates, which comprise linkers which comprise one or more hydrophilic moieties.
  • Embodiment 69 Embodiment 69.
  • Embodiment 76 The immunoconjugate of Formula (E’) or any one of Embodiments 60 to 70 having the structure:
  • the immunoconjugate of Formula (E’) or any one of Embodiments 60 to 70 having the structure: Xb is –CH 2 -, -OCH 2 -, -NHCH 2 - or –NRCH 2 - and each R independently is H, -CH 3 or – CH 2 CH 2 C( O)OH and y is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. Embodiment 79.
  • y is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16.
  • Embodiment 91 Embodiment 91.
  • Lp is a bivalent peptide spacer selected from and (LeuCit), where the * of Lp indicates the attachment point to L 1 and the ** of Lp indicates the attachment point to the –NH- group of Formula (B’) or the ** of Lp indicates the attachment point to the G of Formula (A’).
  • Embodiment 99 is a bivalent peptide spacer selected from and (LeuCit), where the * of Lp indicates the attachment point to L 1 and the ** of Lp indicates the attachment point to the –NH- group of Formula (B’) or the ** of Lp indicates the attachment point to the G of Formula (A’).
  • Embodiment 110 Embodiment 110.
  • Embodiment 122 The compound of Formula (A’) or any one of Embodiments 1 to 17, or pharmaceutically acceptable salt thereof, the linker of Formula (C’) or any one of Embodiments 32 to 46, and the immunoconjugate of Formula (E’) or any one of Embodiments 60 to 70, or any one of Embodiments 84 to 121, wherein R 2 is a hydrophilic moiety selected from polyethylene glycol, polyalkylene glycol, a sugar, an oligosaccharide, a polypeptide or C 2 -C 6 alkyl substituted with 1 to 3 groups..
  • Embodiment 123 Embodiment 123.
  • Embodiment 133 The compound of Formula (A’) or any one of Embodiments 1 to 17, or pharmaceutically acceptable salt thereof, the linker of Formula (C’) or any one of Embodiments 32 to 46, and the immunoconjugate of Formula (E’) or any one of Embodiments 60 to 70, or any one of Embodiments 84 to 122, wherein: R 2 is where the * of R 2 indicates the point of attachment to X or L 3 .
  • Embodiment 134 Embodiment 134.
  • each m is independently selected from 1, 2, 3, 4, and 5.
  • each t is independently selected from 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 and 30.
  • each t is independently selected from 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 and 30.
  • each t is independently selected from 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25.
  • Embodiment 144 is independently selected from 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25.
  • Embodiment 150 The immunoconjugate of Formula (E’) or any one of Embodiments 60 to 70, or any one of Embodiments 84 to 144, wherein y is 1, 2, 3 or 4.
  • Embodiment 151 The immunoconjugate of Formula (E’) or any one of Embodiments 60 to 70, or any one of Embodiments 84 to 144, wherein y is 1 or 2.
  • Embodiment 152 Embodiment 152.
  • Embodiment 155 Embodiment 155.
  • Embodiment 156 The compound of Formula (A’) or any one of Embodiments 1 to 30, or pharmaceutically acceptable salt thereof, the immunoconjugate of Formula (E’) or any one of Embodiments 60 to 70, or any one of Embodiments 84 to 155, wherein D is a MCl-1 inhibitor when released from the immunoconjugates.
  • linker groups that are suitable for making ADCs or immunoconjugates of a MCl-1 inhibitor disclosed herein includes those disclosed in international application publications such as WO 2 018200812, WO2017214456, WO 2 017214458, WO2017214462, WO2017214233, WO2017214282, WO 2 017214301, WO2017214322, WO2017214335, WO2017214339, WO2016094509, WO 2 016094517, and WO2016094505, the contents of each of which are incorporated by reference in their entireties.
  • the immunoconjugates of MCl-1 inhibitors disclosed herein can have a linker-payload (“-L-D”) structure selected from: , wherein: Lc is a linker component and each Lc is independently selected from a linker component as disclosed herein; x is an integer selected from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20; y is an integer selected from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20; p is an integer selected from 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10; D is a MCl-1 inhibitor disclosed herein; and each cleavage element (CE) is independently selected from a self-immolative spacer and a group that is susceptible to cleavage selected from acid-induced cleavage, peptidase- induced cleavage, esterase-induced cleavage, glycosidase induced cleavage, phosphodiesterase induced cleavage, phosphatase
  • L has a structure selected from the following, or L comprises a structural component selected from the following:
  • Lc is a linker component and each Lc is independently .
  • the present invention provides various methods of conjugating Linker-Drug groups of the invention to antibodies or antibody fragments to produce Antibody Drug Conjugates which comprise a linker having one or more hydrophilic moieties.
  • a general reaction scheme for the formation of Antibody Drug Conjugates of Formula (E’) is shown in Scheme 2 below: Scheme 2 where: RG2 is a reactive group which reacts with a compatible R 1 group to form a corresponding R 100 group (such groups are illustrated in Table 2 and Table 3). D, R 1 , L 1 , Lp, Ab, y and R 100 are as defined herein.
  • Scheme 3 further illustrates this general approach for the formation of Antibody Drug Conjugates of Formula (E’), wherein the antibody comprises reactive groups (RG2) which react with an R 1 group (as defined herein) to covalently attach the Linker-Drug group to the antibody via an R 100 group (as defined herein).
  • RG2 reactive groups
  • Scheme 3 shows the antibody having four RG2 groups.
  • Linker-Drug groups are conjugated to antibodies via modified cysteine residues in the antibodies (see for example WO2014/124316).
  • Scheme 4 illustrates this approach for the formation of Antibody Drug Conjugates of Formula (E’) wherein a free thiol group generated from the engineered cysteine residues in the antibody react with an R 1 group (where R 1 is a maleimide) to covalently attach the Linker-Drug group to the antibody via an R 100 group (where R 100 is a succinimide ring).
  • R 1 where R 1 is a maleimide
  • R 100 where R 100 is a succinimide ring
  • Linker-Drug groups are conjugated to antibodies via lysine residues in the antibodies.
  • Scheme 5 illustrates this approach for the formation of Antibody Drug Conjugates of Formula (E’) wherein a free amine group from the lysine residues in the antibody react with an R 1 group (where R 1 is an NHS ester, a pentafluorophenyl or a tetrafluorophenyl) to covalently attach the Linker-Drug group to the antibody via an R 100 group (where R 100 is an amide).
  • R 1 is an NHS ester, a pentafluorophenyl or a tetrafluorophenyl
  • R 100 group where R 100 is an amide
  • the oxime bridge is formed by initially creating a ketone bridge by reduction of an interchain disulfide bridge of the antibody and re-bridging using a 1,3-dihaloacetone (e.g.1,3-dichloroacetone). Subsequent reaction with a Linker-Drug group comprising a hydroxyl amine thereby form an oxime linkage (oxime bridge) which attaches the Linker-Drug group to the antibody (see for example WO2014/083505).
  • Scheme 6 illustrates this approach for the formation of Antibody Drug Conjugates of Formula (E’).
  • Scheme 6 A general reaction scheme for the formation of Antibody Drug Conjugates of Formula (F’) is shown in Scheme 7 below: Scheme 7 where: RG 2 is a reactive group which reacts with a compatible R 1 group to form a corresponding R 100 group (such groups are illustrated in Table 2 and Table 3). D, R 1 , L 1 , Lp, Ab, y and R 100 are as defined herein.
  • Scheme 8 further illustrates this general approach for the formation of Antibody Drug Conjugates of Formula (F’), wherein the antibody comprises reactive groups (RG 2 ) which react with an R 1 group (as defined herein) to covalently attach the Linker-Drug group to the antibody via an R 100 group (as defined herein).
  • Scheme 8 shows the antibody having four RG2 groups.
  • Scheme 8 shows the antibody having four RG2 groups.
  • Scheme 8 shows Linker-Drug groups are conjugated to antibodies via modified cysteine residues in the antibodies (see for example WO2014/124316).
  • Scheme 9 illustrates this approach for the formation of Antibody Drug Conjugates of Formula (F’) wherein a free thiol group generated from the engineered cysteine residues in the antibody react with an R 1 group (where R 1 is a maleimide) to covalently attach the Linker-Drug group to the antibody via an R 100 group (where R 100 is a succinimide ring).
  • R 1 group where R 1 is a maleimide
  • Scheme 9 shows the antibody having four free thiol groups.
  • Scheme 9 In another aspect, Linker-Drug groups are conjugated to antibodies via lysine residues in the antibodies.
  • Scheme 10 illustrates this approach for the formation of Antibody Drug Conjugates of Formula (F’) wherein a free amine group from the lysine residues in the antibody react with an R 1 group (where R 1 is an NHS ester, a pentafluorophenyl or a tetrafluorophenyl) to covalently attach the Linker-Drug group to the antibody via an R 100 group (where R 100 is an amide).
  • R 1 is an NHS ester, a pentafluorophenyl or a tetrafluorophenyl
  • R 100 group where R 100 is an amide
  • Linker-Drug groups are conjugated to antibodies via formation of an oxime bridge at the naturally occurring disulfide bridges of an antibody.
  • the oxime bridge is formed by initially creating a ketone bridge by reduction of an interchain disulfide bridge of the antibody and re-bridging using a 1,3-dihaloacetone (e.g.1,3-dichloroacetone).
  • a Linker-Drug group comprising a hydroxyl amine thereby form an oxime linkage (oxime bridge) which attaches the Linker-Drug group to the antibody (see for example WO 2 014/083505).
  • Scheme 11 illustrates this approach for the formation of Antibody Drug Conjugates of Formula (F’).
  • conjugates have favorable properties, for example properties that would make them easier to manufacture, easier to administer to patients, more efficacious, and/or potentially safer for patients.
  • One example is the determination of molecular size by size exclusion chromatography (SEC) wherein the amount of desired antibody species in a sample is determined relative to the amount of high molecular weight contaminants (e.g., dimer, multimer, or aggregated antibody) or low molecular weight contaminants (e.g., antibody fragments, degradation products, or individual antibody chains) present in the sample.
  • SEC size exclusion chromatography
  • hydrophobicity by hydrophobic interaction chromatography (HIC) wherein the hydrophobicity of a sample is assessed relative to a set of standard antibodies of known properties.
  • HIC hydrophobic interaction chromatography
  • Example 1 Synthesis and Characterization of Linkers, Linker-Payloads, and Precursors thereof. [360] Exemplary linkers, linker-payloads, and precursors thereof were synthesized using exemplary methods described in this example.
  • Flash chromatography was performed on CombiFlash Rf (Teledyne ISCO) with pre-packed silica-gel cartridges (Macherey-Nagel Chromabond Flash). Thin layer chromatography was conducted with 5 x 10 cm plates coated with Merck Type 60 F254 silica-gel. Microwave heating was performed in CEM Discover® instrument. [362] 1 H-NMR measurements were performed on 400 MHz Bruker Avance or 500 MHz Avance Neo spectrometer, using DMSO-d6 or CDCl3 as solvent.
  • 1 H NMR data is in the form of chemical shift values, given in part per million (ppm), using the residual peak of the solvent (2.50 ppm for DMSO-d 6 and 7.26 ppm for CDCl 3 ) as internal standard.
  • Splitting patterns are designated as: s (singlet), d (doublet), t (triplet), q (quartet), quint (quintet), m (multiplet), br s (broad singlet), br t (broad triplet) dd (doublet of doublets), td (triplet of doublets), dt (doublet of triplets), ddd (doublet of doublet of doublets).
  • IR measurements were performed on a Bruker Tensor 27 equipped with ATR Golden Gate device (SPECAC). HRMS measurements were performed on a LTQ OrbiTrap Velos Pro mass spectrometer (ThermoFisher Scientific). Samples were dissolved in CH 3 CN/H2O (2/1:v/v) at a concentration range from 0.01 to 0.05 mg/mL approximately and introduced in the source by an injection of 2 ⁇ L in a flow of 0.1 mL/min. ESI ionization parameters were as follow: 3.5 kV and 350°C transfer ion capillary. All the spectra were acquired in positive ion mode with a resolving power of 30,000 or 60,000 using a lock mass.
  • Preparative-HPLC (“Prep-HPLC”) data were acquired using an instrument with the following parameters (Table 5):
  • TFA method solvent: A water + 0.05 % TFA, B acetonitrile + 0.05 % TFA, gradient from 5 to 100% B in 15 to 30 CV
  • NH4HCO3 method solvent: A water + 0.02 M NH4HCO3, B acetonitrile/water 80/20 + 0.02 M NH4HCO3, gradient from 5 to 100 % B in 15 to 30 CV
  • Neutral method solvent: A water, B acetonitrile, gradient from 5 to 100% B in 15 to 30 CV
  • Preparative SFC purification [368] Preparative chiral SFC was performed on a PIC solution Prep200 system. The sample was dissolved in ethanol at a concentration of 150 mg/mL. The mobile phase was held isocratically at 40% ethanol/CO 2 . The instrument was fitted with a Chiralpak IA column and a loop of 3 mL. The ABPR (automatic back-pressure regulator) was set at 100 bars.
  • Step 2 [4-[[(2S)-2-[[(2S)-2-[[2-[2-[2-(2-azidoethoxy)ethoxy]ethoxy]acetyl]amino]-3-methyl- butanoyl]amino]-5-ureido-pentanoyl]amino]phenyl]methyl (4- nitrophenyl)carbonate [371] To a solution of (2S)-2-[[(2S)-2-[[2-[2-[2-(2-azidoethoxy)ethoxy]ethoxy]acetyl]amino]- 3-methyl-butanoyl]amino]-N-[4-(hydroxymethyl)phenyl]-5-ureido-pentanamide (100 mg, 0.168 mmol) in DMF (30 mL) was added DIPEA (32 ⁇ L, 0.179 mmol) and bis(4-nitrophenyl) carbonate (100 mg, 0.329 mmol
  • reaction mixture was stirred at room temperature for 2h and purified by C18 reverse phase prep-HPLC by direct deposit of the reaction mixture on the Xbridge column and using the NH4HCO3 method to afford L19-C3 (22 mg, 0.016 mmol).
  • the reaction mixture was stirred at - 40°C for 30 min. Another portion of diphosphoryl chloride (10 ⁇ L, 0.074 mmol) was added at -40°C and the reaction was stirred at -40°C for 20 min, quenched by addition of an aqueous saturated solution of potassium carbonate (0.1 mL) and allowed to warm to room temperature. The pH was adjusted to 10 by addition of potassium carbonate (powder) and the reaction was stirred for 20 min at room temperature. The reaction mixture was acidified to pH 2 by slow addition of aqueous 2 M HCl solution at 0°C, extracted with dichloromethane (4 times).
  • reaction mixture was stirred at room temperature overnight, diluted with dichloromethane, partitioned with a saturated aqueous solution of NaHCO 3 and extracted with dichloromethane. The combined organic layers were washed with brine, dried over Magnesium sulfate and concentrated to approximately 1 mL. The residue was diluted with DMF (1 mL), 2-aminoethyl dihydrogen phosphate (30 mg, 0.214 mmol) was added and the reaction mixture was stirred at 80°C overnight, diluted with dichloromethane, washed with water.
  • the reaction mixture was heated at 65°C for 48h. Another portion of sodium cyanoborohydride (24 mg, 0.389 mmol) and 6-deoxy-6-azido-D-galactose (120 mg, 0.584 mmol) were then added at room temperature. The reaction mixture was heated at 65°C for an additional 48h and was purified by C18 reverse phase prep-HPLC by direct deposit of the reaction mixture on the Xbridge column and using the TFA method to afford L17-C3 (38 mg, 28 ⁇ mol).
  • HR-ESI+: m/z [M+H]+ 1369.4918 / 1369.4913 (measured/theoretical).
  • the reaction mixture was stirred at room temperature for 1 h and concentrated under reduced pressure.
  • the residue was diluted with dioxane (1 mL) and a solution of lithium hydroxide monohydrate (14 mg, 0.0334 mmol) in water (0.3 mL) was added.
  • the reaction mixture was stirred at room temperature overnight, neutralized by addition of an aqueous 1 M HCl solution (0.33mL, 0.33 mmol), concentrated under reduced pressure.
  • the crude product was purified by C18 reverse phase prep-HPLC by direct deposit of the reaction mixture on the Xbridge column and using the TFA method to afford L24-P6 (47 mg, 32 ⁇ mol).
  • HR-ESI+: m/z [M+2H]/2+ 726.2957 / 726.2941 (measured/theoretical).
  • the reaction mixture was stirred at room temperature overnight, concentrated under reduced pressure, diluted with dioxane (0.5 mL) and a solution of lithium hydroxide monohydrate (3.7 mg, 89 ⁇ mol) in water (0.3 mL) was added.
  • the reaction was stirred at room temperature overnight, neutralized at 0°C by a dropwise addition of an aqueous 1M HCl solution until pH7 and concentrated under reduced pressure.
  • the crude product was purified by C18 reverse phase prep-HPLC by direct deposit of the reaction mixture on the Xbridge column and using the NH4HCO3 method to afford L20- C6 (13 mg, 8 ⁇ mol).
  • HR-ESI+: m/z [M+H]+ 1609.6517 / 1609.6500 (measured/theoretical).
  • reaction mixture was stirred at room temperature for 3h, concentrated under reduced pressure and purified by C18 reverse phase prep-HPLC by direct deposit of the reaction mixture on the Xbridge column and using the TFA method to afford L22-C1 (67 mg, 37 ⁇ mol).
  • Step 2 (2S)-N-[4-(bromomethyl)phenyl]-2-[[(2S)-2-[3-[2-(2,5-dioxopyrrol-1- yl)ethoxy]propanoylamino]-3-methyl-butanoyl]amino]-5-ureido-pentanamide [394] To a solution of (2S)-2-[[(2S)-2-[3-[2-(2,5-dioxopyrrol-1-yl)ethoxy]propanoylamino]-3- methyl-butanoyl]amino]-N-[4-(hydroxymethyl)phenyl]-5-ureido-pentanamide (37.2 mg, 65 ⁇ mol) in THF (1 mL) was added dropwise at 0°C under argon phosphorus tribromide (45 ⁇ L, 97 mmol).
  • the reaction was stirred at 0°C for 1 h and at room temperature for 2h. The progress of the reaction was followed by UPLC-MS: an aliquot was treated by a large excess of morpholine in acetonitrile, following the formation of the corresponding morpholine adduct.
  • the reaction was diluted with THF (3 mL), quenched by addition of 2 drops of a saturated solution of NaHCO 3 , stirred for 5 min at room temperature, dried over Magnesium sulfate and filtered.
  • the aqueous layer was extracted with ethyl acetate (2 x 250 mL) and the combined organic layers were washed with an aqueous solution of hydrogen chloride 1 M (100 mL), dried over sodium sulfate, filtered and concentrated to dryness. The resulting residue was taken up in dichloromethane (1 L) and was washed with an aqueous solution of HCl 1 M (100 mL). The organic layer was dried over sodium sulfate, filtered and concentrated to dryness to afford 2-iodo-4-nitro-benzoic acid (15.0 g, 51.2 mmol) as an orange powder.
  • Step 3 (4-amino-2-iodo-phenyl)methanol [399] To a solution of (2-iodo-4-nitro-phenyl)methanol (3.70 g, 13.26 mmol) in ethanol (100 mL) and water (25 mL) were successively added iron (3.70 g, 66.25 mmol) and ammonium chloride (800 mg, 14.96 mmol). The reaction mixture was stirred for 3 hours at 80°C. After completion of the reaction, the reaction mixture was filtered over Celite®, washed with ethanol and concentrated to dryness.
  • Step 4 4-[[tert-butyl(dimethyl)silyl]oxymethyl]-3-iodo-aniline [400] To a solution of (4-amino-2-iodo-phenyl)methanol (3.51 g, 13.37 mmol) in dichloromethane (150 mL) was added imidazole (0.95 g, 13.95 mmol). The mixture was cooled to 0°C, then a solution of tert-butyl-chloro-dimethyl-silane (2.40 mL, 13.85 mmol) in dichloromethane (150 mL) was added dropwise over 15 minutes. The ice bath was removed, and the reaction mixture was stirred at room temperature for 16 h.
  • Step 5 (2S)-2-[[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-methyl- butanoyl]amino]propanoic acid [401] To a solution of (2S)-2-aminopropanoic acid (3.22 g, 36.09 mmol) in water (90 mL) were successively added sodium carbonate (7.29 g, 68.74 mmol) and a solution of (2,5- dioxopyrrolidin-1-yl) (2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-methyl-butanoate (15.0 g, 34.37 mmol) in dimethoxyethane (90 mL).
  • Step 6 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-2-[4-[[tert-butyl(dimethyl)silyl]oxymethyl]-3- iodo-anilino]-1-methyl-2-oxo-ethyl]carbamoyl]-2-methyl-propyl]carbamate [402] To a solution of (2S)-2-[[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-methyl- butanoyl]amino]propanoic acid (1.50 g, 3.65 mmol) in dichloromethane (18 mL) and methanol (18 mL) were successively added 4-[[tert-butyl(dimethyl)silyl]oxymethyl]-3-iodo- aniline (1.33 g, 3.65 mmol) and ethyl 2-ethoxy-2H-quinoline-1-
  • Step 7 (3R,4S,5R,6R)-3,4,5-tribenzyloxy-6-(benzyloxymethyl)tetrahydropyran-2-one
  • a suspension of (3R,4S,5R,6R)-3,4,5-tribenzyloxy-6- (benzyloxymethyl)tetrahydropyran-2-ol (30.0 g, 55.49 mmol) in DMSO (120 mL) was stirred for 30 min at room temperature (until full solubilisation) then acetic anhydride (90 mL) was added dropwise at room temperature over 15 min.
  • the beige solution was stirred for 16 h then was cooled to 0°C and an aqueous solution of hydrogen chloride 1 M (100 mL) was slowly added.
  • the reaction mixture was stirred for 20 min at room temperature then acetic acid was evaporated.
  • the resulting residue was diluted with water (200 mL) and ethyl acetate (200 mL).
  • the aqueous layer was extracted with ethyl acetate (2 x 200 mL) and the combined organic layers were washed with water (2 x 500 mL), with a saturated solution of sodium hydrogen carbonate (2 x 500 mL), then dried over sodium sulfate, filtered and concentrated to dryness to afford the crude mixture.
  • Step 8 (3R,4S,5R,6R)-3,4,5-tribenzyloxy-6-(benzyloxymethyl)-2-(2- trimethylsilylethynyl)tetrahydropyran-2-ol
  • THF trimethylsilylacetylene
  • Step 9 trimethyl-[2-[(2S,3S,4R,5R,6R)-3,4,5-tribenzyloxy-6- (benzyloxymethyl)tetrahydropyran-2-yl]ethynyl]silane [405] To a solution of (3R,4S,5R,6R)-3,4,5-tribenzyloxy-6-(benzyloxymethyl)-2-(2- trimethylsilylethynyl)tetrahydropyran-2-ol (29.56 g, 46.42 mmol) in acetonitrile (83 mL) and dichloromethane (193 mL) were added in 20 min at -15°C a solution of triethylsilane (44.98 mL, 278.5 mmol) in a mixture of acetonitrile/dichloromethane (37 mL/18 mL) followed by a solution of boron trifluoride diethyl etherate (23
  • Step 10 (2R,3R,4R,5S,6S)-3,4,5-tribenzyloxy-2-(benzyloxymethyl)-6-ethynyl- tetrahydropyran [406] To a solution of trimethyl-[2-[(2S,3S,4R,5R,6R)-3,4,5-tribenzyloxy-6- (benzyloxymethyl)tetrahydropyran-2-yl]ethynyl]silane (28.80 g, 46.39 mmol) in methanol (1.12 L) and dichloromethane (240 mL) was added an aqueous solution of sodium hydroxide 1 M (80 mL).
  • Step 11 (2S,3R,4R,5S,6R)-2-ethynyl-6-(hydroxymethyl)tetrahydropyran-3,4,5-triol
  • (2R,3R,4R,5S,6S)-3,4,5-tribenzyloxy-2-(benzyloxymethyl)-6-ethynyl- tetrahydropyran (20.00 g, 36.45 mmol) in ethanthiol (400 mL) was added dropwise at room temperature over 5 min, boron trifluoride diethyl etherate (147.8 mL, 1166 mmol).
  • the beige solution was stirred for 16 h at room temperature, then was cooled to 0°C and equipped with a gas trap containing an aqueous saturated solution of sodium hypochlorite.
  • a saturated aqueous solution of sodium hydrogen carbonate 500 mL was added dropwise at 0°C in 1 h (formation of carbon dioxide).
  • the crude product was purified by silica gel chromatography (gradient of methanol in dichloromethane) to afford (2S,3R,4R,5S,6R)-2-ethynyl-6-(hydroxymethyl)tetrahydropyran-3,4,5-triol (4.05 g, 21.52 mmol) as a white solid.
  • Step 12 methyl (2S,3S,4R,5R,6S)-6-ethynyl-3,4,5-trihydroxy-tetrahydropyran-2- carboxylate [408] To a solution of (2S,3R,4R,5S,6R)-2-ethynyl-6-(hydroxymethyl)tetrahydropyran- 3,4,5-triol (4.05 g, 21.52 mmol) in a saturated aqueous solution of sodium hydrogen carbonate (81 mL) and THF (81 mL) was added (2,2,6,6-tétraméthylpi Solutionsdin-1-yl)oxyl (168 mg, 1.08 mmol).
  • Step 13 methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-ethynyl-tetrahydropyran-2- carboxylate [409] To a solution of methyl (2S,3S,4R,5R,6S)-6-ethynyl-3,4,5-trihydroxy-tetrahydropyran- 2-carboxylate (3.00 g, 13.88 mmol) in DMF (37.5 mL) and pyridine (12.5 mL) was added N,N-dimethylpyridin-4-amine (84.8 mg, 0.693 mmol).
  • the crude product was purified by silica gel chromatography (gradient of ethyl acetate in cyclohexane cerium developer) to afford methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-ethynyl-tetrahydropyran-2-carboxylate (4.60 g, 13.44 mmol) as a white solid.
  • Step 14 methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[2-[[tert- butyl(dimethyl)silyl]oxymethyl]-5-[[(2S)-2-[[(2S)-2-(9H-fluoren-9- ylmethoxycarbonylamino)-3-methyl- butanoyl]amino]propanoyl]amino]phenyl]ethynyl]tetrahydropyran-2-carboxylate [410] To a solution of methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-ethynyl-tetrahydropyran- 2-carboxylate (496 mg, 1.45 mmol) in DMF (7.3 mL) were successively added 9H-fluoren-9- ylmethyl N-[(1S)-1-[[(1S)-2-[4-[[tert
  • Step 15 methyl (3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[2-[[tert- butyl(dimethyl)silyl]oxymethyl]-5-[[(2S)-2-[[(2S)-2-(9H-fluoren-9- ylmethoxycarbonylamino)-3-methyl- butanoyl]amino]propanoyl]amino]phenyl]ethyl]tetrahydropyran-2-carboxylate [411] A solution of methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[2-[[tert- butyl(dimethyl)silyl]oxymethyl]-5-[[(2S)-2-[[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3- methyl-butanoyl]amino]propanoyl]amin
  • Step 16 methyl (3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[5-[[(2S)-2-[[(2S)-2-(9H-fluoren-9- ylmethoxycarbonylamino)-3-methyl-butanoyl]amino]propanoyl]amino]-2- (hydroxymethyl)phenyl]ethyl]tetrahydropyran-2-carboxylate [412] To a solution of methyl (3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[2-[[[tert- butyl(dimethyl)silyl]oxymethyl]-5-[[(2S)-2-[[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3- methyl-butanoyl]amino]propanoyl]amino]phenyl]ethyl]tetrahydr
  • the colorless solution was stirred for 16 h at room temperature then diluted with water (100 mL).
  • the aqueous layer was extracted with ethyl acetate (2 x 100 mL).
  • the combined organic layers were washed with water (2 x 200 mL), and with a saturated aqueous solution of sodium hydrogen carbonate (200 mL), then were dried over sodium sulfate, filtered and concentrated to dryness.
  • Step 17 methyl (3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[5-[[(2S)-2-[[(2S)-2-(9H-fluoren-9- ylmethoxycarbonylamino)-3-methyl-butanoyl]amino]propanoyl]amino]-2-[(4- nitrophenoxy)carbonyloxymethyl]phenyl]ethyl]tetrahydropyran-2-carboxylate [413] To a solution of methyl (3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[5-[[(2S)-2-[[(2S)-2-(9H- fluoren-9-ylmethoxycarbonylamino)-3-methyl-butanoyl]amino]propanoyl]amino]-2- (hydroxymethyl)phenyl]ethyl]tetrahydropyran-2-car
  • Step 21 (2SR,3SR,4RS,5RS,6SR)-6-[2-[(5S a )-5-[[(2S)-2-[[(2S)-2-[[2-[2-[2-(2- azidoethoxy)ethoxy]ethoxy]acetyl]amino]-3-methyl- butanoyl]amino]propanoyl]amino]-2-[[4-[2-[4-[4-[4-[(1R)-1-carboxy-2-[2-[[2-(2- methoxyphenyl)pyrimidin-4-yl]methoxy]phenyl]ethoxy]-6-(4- fluorophenyl)thieno[2,3-d]pyrimidin-5-yl]-2-chloro-3-methyl- phenoxy]ethyl]piperazine-1-carbonyl]oxymethyl]phenyl]ethyl]-3,4,5-trihydroxy- tetrahydropyran-2-carbox
  • Step 2 (2S)-2-amino-N-[(1S)-2-[4-(hydroxymethyl)anilino]-1-methyl-2-oxo-ethyl]-3-methyl- butanamide [419]
  • To a solution of 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-2-[4-(hydroxymethyl)anilino]-1- methyl-2-oxo-ethyl]carbamoyl]-2-methyl-propyl]carbamate (5.16 g, 10.01 mmol) in DMF (120 mL) was added piperidine (52 mL, 525mmol).
  • reaction mixture was stirred for 2 h at room temperature then the piperidine was evaporated and the resulting solution was diluted with water (500 mL). The resulting solid was filtered off and the filtrate was washed twice with diethyl ether (2 x 500 mL). The aqueous layer was concentrated to dryness to afford the crude reaction mixture.
  • Step 3 [(2R)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-oxo-3-sodiooxy- propyl]sulfonyloxysodium [420] To a solution of [(2R)-2-amino-3-oxo-3-sodiooxy-propyl]sulfonyloxysodium monohydrate (3.00 g, 12.98 mmol) in water (127 mL) was added sodium carbonate (4.13 g, 38.94 mmol).
  • Step 4 [(2R)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-[[(1S)-1-[[(1S)-2-[4- (hydroxymethyl)anilino]-1-methyl-2-oxo-ethyl]carbamoyl]-2-methyl-propyl]amino]- 3-oxo-propyl]sulfonyloxysodium [421] To a solution of (2S)-2-amino-N-[(1S)-2-[4-(hydroxymethyl)anilino]-1-methyl-2-oxo- ethyl]-3-methyl-butanamide (1.19 g, 4.04 mmol) in DMF (395 mL) were successively added [(2R)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-oxo-3-sodiooxy-propyl]sulfonyloxysodium
  • Step 2 9H-fluoren-9-ylmethyl N-[1-[[(1S)-5-(tert-butoxycarbonylamino)-1-[[4- (hydroxymethyl)phenyl]carbamoyl]pentyl]carbamoyl]-2-methyl-propyl]carbamate [427] To a solution of (2S)-6-(tert-butoxycarbonylamino)-2-[[2-(9H-fluoren-9- ylmethoxycarbonylamino)-3-methyl-butanoyl]amino]hexanoic acid (1.5 g, 2.64 mmol) in dichloromethane (19 mL) and methanol (9.5 mL) was added (4-aminophenyl)methanol (651.0 mg, 5.28 mmol) in methanol (1.5 mL).
  • Step 3 [4-[[(2S)-6-(tert-butoxycarbonylamino)-2-[[2-(9H-fluoren-9- ylmethoxycarbonylamino)-3-methyl- butanoyl]amino]hexanoyl]amino]phenyl]methyl (4-nitrophenyl) carbonate [428] To a solution of 9H-fluoren-9-ylmethyl N-[1-[[(1S)-5-(tert-butoxycarbonylamino)-1-[[4- (hydroxymethyl)phenyl]carbamoyl]pentyl]carbamoyl]-2-methyl-propyl]carbamate (600.0 mg, 0.892 mmol) in THF (19 mL), were added pyridine (361 ⁇ L, 4.46 mmol) then 4-Nitrophenyl chloroformate (448 mg, 2.22 mmol).
  • Step 2 methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[2-[[tert- butyl(dimethyl)silyl]oxymethyl]-5-nitro-phenyl]ethynyl]tetrahydropyran-2- carboxylate [434] To a solution of tert-butyl-[(2-iodo-4-nitro-phenyl)methoxy]-dimethyl-silane compound (3.0 g, 7.63 mmol) in DMF (55 mL) were successively added methyl (2S,3S,4R,5S,6S)- 3,4,5-triacetoxy-6-ethynyl-tetrahydropyran-2-carboxylate (3.39 g, 9.92 mmol; obtained according to Step 13 of the preparation of L14-C 3 ), DIPEA (5.80 mL, 35.09 mmol), copper iodide (145 mg, 0.7
  • Step 3 methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[2-(hydroxymethyl)-5-nitro- phenyl]ethynyl]tetrahydropyran-2-carboxylate [435] To a solution of methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[2-[[tert- butyl(dimethyl)silyl]oxymethyl]-5-nitro-phenyl]ethynyl]tetrahydropyran-2-carboxylate (4.01 g, 6.60 mmol) in THF (48 mL) and water (48 mL) was added acetic acid (193 mL, 3.36 mol).
  • the colorless solution was stirred for 2 days at room temperature then diluted with water (300 mL).
  • the aqueous layer was extracted with dichloromethane (2 x 300 mL).
  • the combined organic layers were washed with water (2 x 300 mL), and with a saturated aqueous solution of sodium hydrogen carbonate (400 mL), then dried over sodium sulfate, filtered and concentrated to dryness.
  • Step 4 methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[5-amino-2- (hydroxymethyl)phenyl]ethyl]tetrahydropyran-2-carboxylate [436] A solution of methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[2-(hydroxymethyl)-5- nitro-phenyl]ethynyl]tetrahydropyran-2-carboxylate (2.67 g, 5.41 mmol) in THF (59 mL) was flushed with Argon. Platinum on carbon 5% dry (1.34 g, 50% w/w) was added.
  • the reaction mixture was successively flushed with argon, with H 2 and was stirred for 2 days at room temperature under H 2 atmosphere (P atm).
  • the reaction mixture was filtered through a Celite® pad, washed with a solution of ethyl acetate/methanol 9/1 (500 mL), then concentrated to dryness. All the sequence, (addition of platinum on carbon 5% dry (1.34 g, 50% w/w), stirring for 16 h at room temperature under H 2 (P atm) and filtration through a Celite® pad), was repeated to allow a complete conversion.
  • Step 5 methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[5-[[(2S)-2-(tert- butoxycarbonylamino)-5-ureido-pentanoyl]amino]-2- (hydroxymethyl)phenyl]ethyl]tetrahydropyran-2-carboxylate [437] To a solution of methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[5-amino-2- (hydroxymethyl)phenyl]ethyl]tetrahydropyran-2-carboxylate (1.00 g, 2.14 mmol) in DMF (21 mL) were successively added (2S)-2-(tert-butoxycarbonylamino)-5-ureido-pentanoic acid (589 mg, 2.14 mmol), DIPEA (707 ⁇ l, 4.28 mmol) and HB
  • Step 6 methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[5-[[(2S)-2-[[(2S)-2-(9H-fluoren-9- ylmethoxycarbonylamino)-3-methyl-butanoyl]amino]-5-ureido-pentanoyl]amino]-2- (hydroxymethyl)phenyl]ethyl]tetrahydropyran-2-carboxylate [438] To a solution of compound methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[5-[[(2S)-2- (tert-butoxycarbonylamino)-5-ureido-pentanoyl]amino]-2- (hydroxymethyl)phenyl]ethyl]tetrahydropyran-2-carboxylate (950 mg, 1.31 mmol) in dichloromethan
  • Step 7 methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[2-(bromomethyl)-5-[[(2S)-2-[[(2S)- 2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-methyl-butanoyl]amino]-5-ureido- pentanoyl]amino]phenyl]ethyl]tetrahydropyran-2-carboxylate [440] To a solution of compound methyl (2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-[2-[5-[[(2S)-2- [[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-methyl-butanoyl]amino]-5-ureido- pentanoyl]amino]-2-(hydroxymethyl)phenyl]ethyl
  • Step 8 (2R)-2-[(5S a )-5-[3-chloro-4-[2-[4-[[4-[[(2S)-2-[[(2S)-2-(9H-fluoren-9- ylmethoxycarbonylamino)-3-methyl-butanoyl]amino]-5-ureido-pentanoyl]amino]-2- [2-[(2S,3S,4R,5S,6S)-3,4,5-triacetoxy-6-methoxycarbonyl-tetrahydropyran-2- yl]ethyl]phenyl]methyl]-4-methyl-piperazin-4-ium-1-yl]ethoxy]-2-methyl-phenyl]-6- (4-fluorophenyl)thieno[2,3-d]pyrimidin-4-yl]oxy-3-[2-[[2-(2- methoxyphenyl)pyrimidin-4-yl]methoxy]phenyl]prop
  • Step 1 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-1-[[4-(bromomethyl)phenyl]carbamoyl]-4- ureido-butyl]carbamoyl]-2-methyl-propyl]carbamate
  • Step 2 (2R)-2-[(5S a )-5-[3-chloro-4-[2-[4-[[4-[[(2S)-2-[[(2S)-2-(9H-fluoren-9- ylmethoxycarbonylamino)-3-methyl-butanoyl]amino]-5-ureido- pentanoyl]amino]phenyl]methyl]-4-methyl-piperazin-4-ium-1-yl]ethoxy]-2-methyl- phenyl]-6-(4-fluorophenyl)thieno[2,3-d]pyrimidin-4-yl]oxy-3-[2-[[2-(2- methoxyphenyl)pyrimidin-4-yl]methoxy]phenyl]propanoic acid [446] To the solution of 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-1-[[4- (bromomethyl)phenyl]
  • the reaction mixture was stirred at room temperature for 0.5 hour.
  • the crude product was purified by C18 reverse phase prep-HPLC by direct deposit of the reaction mixture on the X-Bridge column and using the TFA method to afford L9-P15 (11.9 mg, 0.00733 mmol) as a white powder.
  • the reaction mixture was stirred at room temperature for 18 hours. The progress of the reaction was monitored by UPLC-MS. The reaction mixture was concentrated to dryness and solubilized in DMF (1 ml) and the solution was purified by X-Bridge column C 18 by direct deposit of the reaction mixture on the column and in using the TFA method to afford the title compound (57.3 mg; 0.156 mmol). IR (cm -1 ): 3390, 1697/1666.
  • reaction mixture was stirred at room temperature for 15 hours and the progress of the reaction was monitored by UPLC-MS.
  • the reaction mixture was a suspension, the precipitate is filtered off and washed with THF (1 ml) to afford a solution of (2,5-dioxopyrrolidin-1-yl) 1-[2-[2-(2,5-dioxopyrrol-1- yl)ethoxy]ethylcarbamoyl]cyclobutanecarboxylate in THF.
  • the crude product solution was used in step 9.
  • Step 5 5-[[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-5-ureido-pentanoyl]amino]-2- (hydroxymethyl)benzenesulfonic acid [464] To a solution of Fmoc-Cit-OH (2.224 g; 5.596 mmol) in DCM (22.2 mL) and methanol (22.2 mL), were successively added sodium 5-amino-2-(hydroxymethyl) benzenesulfonate (1.89 mg; 8.395 mmol) and EEDQ (2.768 g; 11.19 ml). The reaction mixture was stirred at room temperature for 25 hours, then was concentrated to dryness.
  • Step 6 2-(chloromethyl)-5-[[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-5-ureido- pentanoyl]amino]benzenesulfonic acid [465] To a solution of 5-[[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-5-ureido- pentanoyl]amino]-2-(hydroxymethyl)benzenesulfonic acid (543.6 mg; 0.933 mmol) in NMP (5 mL) were added at room temperature a solution of SOCl 2 (68.1 ⁇ L; 0.933 mmol) in NMP (200 ⁇ L).
  • the reaction mixture was stirred at room temperature for 15 min and the progress of the reaction was monitored by UPLC-MS. To achieve a complete conversion, the SOCl 2 addition (68 ⁇ L) has to be done 7 more times. The excess SOCl 2 was evaporated under vaccum, and the residue was purified by direct deposit of the reaction mixture on an Oasis column in using the TFA method to afford the title compound (362 mg; 0.512 mmol) as a white solid.
  • the reaction mixture was stirred at room temperature for 1.5 hours and the progress of the reaction was monitored by UPLC-MS.
  • the crude product solution was purified by direct deposit of the reaction mixture on a X-Bridge column in using the TFA method to afford the title compound (45.6 mg; 0.0374 mmol) as a white powder.
  • Step 2 9H-fluoren-9-ylmethyl N-[(1S)-1-[[4-[[tert-butyl(dimethyl)silyl]oxymethyl]-3-iodo- phenyl]carbamoyl]-4-ureido-butyl]carbamate
  • [470] To a solution of [[tert-butyl(dimethyl)silyl]oxymethyl]-3-iodo-aniline (10.0 g; 27.52 mmol) in methanol (70 mL) and DCM (140 mL), were successively added Fmoc-Cit-OH (12.0 g; 30.28 mmol) and EEDQ (8.17 g; 33.03 mmol).
  • Step 3 (2S)-2-amino-N-[4-[[tert-butyl(dimethyl)silyl]oxymethyl]-3-iodo-phenyl]-5-ureido- pentanamide [471]
  • Step 4 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-1-[[4-[[tert-butyl(dimethyl)silyl]oxymethyl]-3- iodo-phenyl]carbamoyl]-4-ureido-butyl]carbamoyl]-2-methyl-propyl]carbamate [472] To a solution of (2S)-2-amino-N-[4-[[tert-butyl(dimethyl)silyl]oxymethyl]-3-iodo- phenyl]-5-ureido-pentanamide (3.00 g; 5.76 mmol) in 2-methyltetrahydrofuran (240 mL), were successively added Fmoc-Val-Osu (8.65 g; 8.65 mmol) and DIPEA (1.90 mL; 11.53 mmol).
  • reaction mixture was stirred for 15 hours at room temperature.
  • the reaction mixture was filtered through a sintered funnel and the recovered solid was washed with 2- methyltetrahydrofuran (2 x 250 mL), then dried under high vacuum to afford the title compound (3.57 g; 4.24 mmol) as a white solid.
  • Step 5 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-1-[[4-[[tert-butyl(dimethyl)silyl]oxymethyl]-3- [3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy] prop-1-ynyl]phenyl]carbamoyl]-4-ureido-butyl]carbamoyl]-2-methyl-propyl]carbamate [473] To a solution of 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-1-[[4-[[tert-butyl(dimethyl)silyl] oxymethyl]-3-iodo-phenyl]carbamoyl]-4-ureido
  • Step 6 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-1-[[4-(hydroxymethyl)-3-[3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]prop-1- ynyl]phenyl]carbamoyl]-4-ureido-butyl]carbamoyl]-2-methyl-propyl]carbamate [474] To a solution of 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-1-[[4-[[tert-butyl(dimethyl)silyl] oxymethyl]-3-[3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-meth
  • reaction mixture was stirred for 22 hours at room temperature and the progress of the reaction was monitored by UPLC-MS. After concentration to dryness, the crude product was purified by C18 reverse phase prep-HPLC by direct deposit of the reaction mixture on the X-Bridge column ad using neutral method to afford the title compound (327 mg, 0.32 mmol) as a white gum.
  • Step 7 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-1-[[4-(hydroxymethyl)-3-[3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propyl]phenyl] carbamoyl]-4-ureido-butyl]carbamoyl]-2-methyl-propyl]carbamate [475] To a solution of 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-1-[[4-(hydroxymethyl)-3-[3-[2- [2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[
  • the reaction mixture was stirred at room temperature for 15 hours and the progress of the reaction was monitored by UPLC-MS.
  • the crude product was purified by C18 reverse phase prep-HPLC by direct deposit of the reaction mixture on the X-Bridge column and using the TFA method to afford L26-P1 (28 mg; 0.0151 mmol) as a white powder.
  • the Fmoc deprotection step was realized in adding DEA (53 ⁇ L; 0.515 mmol) to the reaction and stirring at room temperature overnight. Purification was realized by direct injection of the mixture on Oasis eluted with a gradient of a solution A :H 2 O/CH 3 CN/NH 4 HCO 3 (1960 ml/40/3.16 g) to a solution B: CH 3 CN/H 2 O/NH 4 HCO 3 (1600 ml/400 ml/3.16 g) to afford the title compound (17 mg; 0.009 mmol).
  • Step 1 9H-fluoren-9-ylmethyl N-[(1S)-1-[[(1S)-2-[4-(chloromethyl)-3-methyl-anilino]-1- methyl-2-oxo-ethyl]carbamoyl]-2-methyl-propyl]carbamate [484] To a solution of 5-[[(2S)-2-[[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-methyl- butanoyl]amino]propanoyl]amino]-2-(hydroxymethyl)benzenesulfonate (504.1 mg; 0.816 mmol) in NMP (5 mL), were added 6 times over a 75 minutes period, a solution of SOCl 2 (60 ⁇ L; 0.816 mmol) in NMP (500 ⁇ L).
  • the reaction mixture was stirred at room temperature for 15 minutes.
  • the crude product was purified by direct deposit of the reaction mixture on an Oasis column in using the TFA method to afford (337 mg) as a a mixture of 70% the title compound (384 mmol) and 30% of the starting material (170 mmol) as a white powder.
  • the reaction mixture was stirred at 80°C for 28 hours.
  • the reaction mixture is cooled down to room temperature.
  • a solution of LiOH.H 2 O (13.7 mg, 0.342 mmol) in water (500 ⁇ L) is then added.
  • the reaction mixture was stirred at room temperature for 48 hours.
  • the crude product was purified by C18 reverse phase prep-HPLC by direct deposit of the reaction mixture on the X-Bridge column and using the TFA method to afford the title compound (40 mg; 0.0325 mmol) as a white powder.
  • the reaction mixture was stirred at room temperature for 1.5 hours and was monitored by UPLC-MS.
  • the crude product was purified by direct deposit of the reaction mixture on the X-Bridge column in using the TFA method to afford L28-P1 (2.9 mg; 0.0020 mmol) as a white powder.
  • reaction mixture was stirred for 16 hours at room temperature then concentrated to dryness and co-evaporated with water to afford the crude reaction mixture.
  • the resulting residue was purified by column chromatography on silica gel using ethyl acetate/methanol 95:5 to 80:20 as eluent to afford the title compound (1.17 g; 2.95 mmol) as a white solid.
  • Step 2 5-[[(2S)-2-aminopropanoyl]amino]-2-(hydroxymethyl)benzenesulfonate, hydrochloride [488] Sodium 5-[[(2S)-2-(tert-butoxycarbonylamino)propanoyl]amino]-2-(hydroxymethyl) benzenesulfonate (1.17 g; 2.95 mmol; 1 eq.) was suspended in a solution of HCl 4N in dioxane (10 mL). The mixture was stirred at room temperature for 2 hours then concentrated to dryness to afford the crude mixture (982 mg; 2.95 mmol) as a white solid.
  • Step 3 5-[[(2S)-2-[[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-methyl- butanoyl]amino]propanoyl]amino]-2-(hydroxymethyl)benzenesulfonate [489] To a solution of 5-[[(2S)-2-aminopropanoyl]amino]-2- (hydroxymethyl)benzenesulfonate, hydrochloride (981 mg; 2.95 mmol) in DMF (34.5 mL) were added Fmoc-L-Val-Osu (1.29 g; 2.95 mmol; 1 eq.) and DIPEA (975 ⁇ L; 5.9 mmol).
  • Step 4 5-[[(2S)-2-[[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-methyl- butanoyl]amino]propanoyl]amino]-2-[(4-nitrophenoxy)carbonyloxymethyl]benzenesulfonic acid [490] To a suspension of 5-[[(2S)-2-[[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3- methyl-butanoyl]amino]propanoyl]amino]-2-(hydroxymethyl)benzenesulfonate (1.28 g; 2.07 mmol) in THF (65 mL), were added pyridine (875 ⁇ L; 10.8 mmol), followed by 4-nitrophenyl chloroformate (1.09 g; 5.41 mmol).
  • Step 8 (2R)-2-[5-[4-[2-[4-[[4-[[4-[[4-[[(2S)-2-[[(2S)-2-[[2-(2-azidoethoxy)acetyl]amino]-3-methyl- butanoyl]amino]propanoyl]amino]-2-sulfo-phenyl]methoxycarbonyl]piperazin-1-yl]ethoxy]-3- chloro-2-methyl-phenyl]-6-(4-fluorophenyl)thieno[2,3-d]pyrimidin-4-yl]oxy-3-[2-[[2-(2- methoxyphenyl)pyrimidin-4-yl]methoxy]phenyl]propanoic acid L29-C3 [494] To a solution of
  • the reaction mixture was cooled to 0°C, then was added water (22 mL) very slowly and followed by the addition of 20% NaOH (22 mL) and water (66 mL). The reaction mixture was stirred at 0°C for 30 min. Anhydrous sodium sulphate was added to absorb excess of water. The mixture was filtered through celite®. The filter cake was washed with ethylacetate (1000 mL) and 10% MeOH/DCM (500 mL). The filtrate was concentrated under reduced pressure.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Cell Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Heterocyclic Carbon Compounds Containing A Hetero Ring Having Oxygen Or Sulfur (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2021/060560 2020-11-24 2021-11-23 Mcl-1 inhibitor antibody-drug conjugates and methods of use Ceased WO2022115451A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CA3202759A CA3202759A1 (en) 2020-11-24 2021-11-23 Mcl-1 inhibitor antibody-drug conjugates and methods of use
AU2021385349A AU2021385349A1 (en) 2020-11-24 2021-11-23 Mcl-1 inhibitor antibody-drug conjugates and methods of use
EP21827762.2A EP4251208A1 (en) 2020-11-24 2021-11-23 Mcl-1 inhibitor antibody-drug conjugates and methods of use
CN202180091558.3A CN117136076A (zh) 2020-11-24 2021-11-23 Mcl-1抑制剂抗体药物缀合物和使用方法
KR1020237021028A KR20230138444A (ko) 2020-11-24 2021-11-23 Mcl-1 억제제 항체-약물 접합체 및 사용 방법
US18/038,437 US20240042051A1 (en) 2020-11-24 2021-11-23 Mcl-1 inhibitor antibody-drug conjugates and methods of use
IL303079A IL303079A (en) 2020-11-24 2021-11-23 Mcl-1 inhibitor antibody-drug conjugates and methods of use
JP2023530996A JP2023553808A (ja) 2020-11-24 2021-11-23 Mcl-1阻害剤抗体-薬物コンジュゲートおよび使用方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202063117724P 2020-11-24 2020-11-24
US63/117,724 2020-11-24

Publications (1)

Publication Number Publication Date
WO2022115451A1 true WO2022115451A1 (en) 2022-06-02

Family

ID=78957864

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/060560 Ceased WO2022115451A1 (en) 2020-11-24 2021-11-23 Mcl-1 inhibitor antibody-drug conjugates and methods of use

Country Status (9)

Country Link
US (1) US20240042051A1 (cg-RX-API-DMAC7.html)
EP (1) EP4251208A1 (cg-RX-API-DMAC7.html)
JP (1) JP2023553808A (cg-RX-API-DMAC7.html)
KR (1) KR20230138444A (cg-RX-API-DMAC7.html)
CN (1) CN117136076A (cg-RX-API-DMAC7.html)
AU (1) AU2021385349A1 (cg-RX-API-DMAC7.html)
CA (1) CA3202759A1 (cg-RX-API-DMAC7.html)
IL (1) IL303079A (cg-RX-API-DMAC7.html)
WO (1) WO2022115451A1 (cg-RX-API-DMAC7.html)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023234427A1 (ja) * 2022-06-03 2023-12-07 Ube株式会社 抗体・複数薬物コンジュゲート前駆体およびその合成中間体
WO2023234426A1 (ja) * 2022-06-03 2023-12-07 Ube株式会社 抗体・複数薬物コンジュゲート
WO2024083162A1 (en) * 2022-10-19 2024-04-25 Multitude Therapeutics Inc. Antibodies, antibody-drug conjugates, preparations and uses thereof
WO2025106634A1 (en) * 2023-11-17 2025-05-22 Genentech, Inc. Mcl-1 inhibitor compounds and use in antibody drug conjugates
WO2025111431A1 (en) * 2023-11-22 2025-05-30 Les Laboratoires Servier Anti-cd7 antibody-drug conjugates and methods of use thereof

Citations (46)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US6165745A (en) 1992-04-24 2000-12-26 Board Of Regents, The University Of Texas System Recombinant production of immunoglobulin-like domains in prokaryotic cells
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO2001051056A1 (en) 2000-01-10 2001-07-19 Astrazeneca Ab Fulvestrant formulation
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
US20030153043A1 (en) 1997-05-21 2003-08-14 Biovation Limited Method for the production of non-immunogenic proteins
US6703199B1 (en) 1997-06-12 2004-03-09 Research Corporation Technologies, Inc. Artificial antibody polypeptides
WO2006034488A2 (en) 2004-09-23 2006-03-30 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2008016893A1 (en) 2006-08-02 2008-02-07 Novartis Ag Smac peptidomimetics useful as iap inhibitors
US7612114B2 (en) 2002-12-26 2009-11-03 Eisai R&D Management Co., Ltd. Selective estrogen receptor modulator
WO2010020675A1 (en) 2008-08-22 2010-02-25 Novartis Ag Pyrrolopyrimidine compounds as cdk inhibitors
WO2011005481A1 (en) 2009-06-22 2011-01-13 Medimmune, Llc ENGINEERED Fc REGIONS FOR SITE-SPECIFIC CONJUGATION
WO2011076786A1 (en) 2009-12-22 2011-06-30 Novartis Ag Substituted isoquinolinones and quinazolinones
WO2011156518A2 (en) 2010-06-10 2011-12-15 Aragon Pharmaceuticals, Inc. Estrogen receptor modulators and uses thereof
WO2011159769A2 (en) 2010-06-17 2011-12-22 Aragon Pharmaceuticals, Inc. Indane estrogen receptor modulators and uses thereof
WO2012037410A2 (en) 2010-09-16 2012-03-22 Aragon Pharmaceuticals, Inc. Estrogen receptor modulators and uses thereof
WO2013110890A1 (fr) 2012-01-24 2013-08-01 Les Laboratoires Servier Nouveaux derives d'indolizine, leur procede de preparation et les compositions pharmaceutiques qui les contiennent
WO2013184514A1 (en) 2012-06-04 2013-12-12 Irm Llc Site-specific labeling methods and molecules produced thereby
US20140069822A1 (en) 2012-09-10 2014-03-13 Antec Leyden B.V. Electrochemical reduction of disulfide bonds in proteinaceous substances and electrochemical cell for carrying out such reduction
WO2014124258A2 (en) 2013-02-08 2014-08-14 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
WO2014124316A2 (en) 2013-02-08 2014-08-14 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
WO2014130310A1 (en) 2013-02-19 2014-08-28 Novartis Ag Benzothiophene derivatives and compositions thereof as selective estrogen receptor degraders
WO2015011400A1 (fr) 2013-07-23 2015-01-29 Les Laboratoires Servier Nouveaux dérives de pyrrole, leur procédé de préparation et les compositions pharmaceutiques qui les contiennent
WO2015097123A1 (en) 2013-12-23 2015-07-02 Les Laboratoires Servier New thienopyrimidine derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2015138615A2 (en) 2014-03-12 2015-09-17 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
WO2015136017A1 (en) 2014-03-13 2015-09-17 F. Hoffmann-La Roche Ag Methods and compositions for modulating estrogen receptor mutants
WO2016033486A1 (en) 2014-08-29 2016-03-03 Amgen Inc. Tetrahydronaphthalene derivatives that inhibit mcl-1 protein
WO2016207226A1 (en) 2015-06-23 2016-12-29 Les Laboratoires Servier New aminoacid derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2016207217A1 (en) 2015-06-23 2016-12-29 Les Laboratoires Servier New bicyclic derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2016207216A1 (en) 2015-06-23 2016-12-29 Les Laboratoires Servier New hydroxyacid derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2016207225A1 (en) 2015-06-23 2016-12-29 Les Laboratoires Servier New hydroxyester derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2017125224A1 (en) 2016-01-19 2017-07-27 Les Laboratoires Servier New ammonium derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2017147410A1 (en) 2016-02-25 2017-08-31 Amgen Inc. Compounds that inhibit mcl-1 protein
WO2017182625A1 (en) 2016-04-22 2017-10-26 Astrazeneca Ab Macrocyclic mcl1 inhibitors for treating cancer
WO2018183418A1 (en) 2017-03-30 2018-10-04 Amgen Inc. Compounds that inhibit mcl-1 protein
WO2019035899A1 (en) 2017-08-15 2019-02-21 Abbvie Inc. MACROCYCLIC MCL-1 INHIBITORS AND METHODS OF USE
WO2019035911A1 (en) 2017-08-15 2019-02-21 Abbvie Inc. MACROCYCLIC INHIBITORS OF MCL-1 AND METHODS OF USE
WO2019035927A1 (en) 2017-08-15 2019-02-21 Abbvie Inc. MACROCYCLIC MCL-1 INHIBITORS AND METHODS OF USE
US20200289661A1 (en) * 2015-03-18 2020-09-17 Seattle Genetics, Inc. Cd48 antibodies and conjugates thereof
WO2020236825A2 (en) * 2019-05-20 2020-11-26 Novartis Ag Mcl-1 inhibitor antibody-drug conjugates and methods of use

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9498532B2 (en) * 2013-03-13 2016-11-22 Novartis Ag Antibody drug conjugates
ES2701051T3 (es) * 2013-03-15 2019-02-20 Novartis Ag Conjugados de anticuerpo-fármaco

Patent Citations (54)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US6350861B1 (en) 1992-03-09 2002-02-26 Protein Design Labs, Inc. Antibodies with increased binding affinity
US6165745A (en) 1992-04-24 2000-12-26 Board Of Regents, The University Of Texas System Recombinant production of immunoglobulin-like domains in prokaryotic cells
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
US20030153043A1 (en) 1997-05-21 2003-08-14 Biovation Limited Method for the production of non-immunogenic proteins
US6703199B1 (en) 1997-06-12 2004-03-09 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO2001051056A1 (en) 2000-01-10 2001-07-19 Astrazeneca Ab Fulvestrant formulation
US7612114B2 (en) 2002-12-26 2009-11-03 Eisai R&D Management Co., Ltd. Selective estrogen receptor modulator
WO2006034488A2 (en) 2004-09-23 2006-03-30 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2008016893A1 (en) 2006-08-02 2008-02-07 Novartis Ag Smac peptidomimetics useful as iap inhibitors
WO2010020675A1 (en) 2008-08-22 2010-02-25 Novartis Ag Pyrrolopyrimidine compounds as cdk inhibitors
US8685980B2 (en) 2008-08-22 2014-04-01 Novartis Ag Pyrrolopyrimidine compounds and their uses
US8415355B2 (en) 2008-08-22 2013-04-09 Novartis Ag Pyrrolopyrimidine compounds and their uses
WO2011005481A1 (en) 2009-06-22 2011-01-13 Medimmune, Llc ENGINEERED Fc REGIONS FOR SITE-SPECIFIC CONJUGATION
WO2011076786A1 (en) 2009-12-22 2011-06-30 Novartis Ag Substituted isoquinolinones and quinazolinones
WO2011156518A2 (en) 2010-06-10 2011-12-15 Aragon Pharmaceuticals, Inc. Estrogen receptor modulators and uses thereof
WO2011159769A2 (en) 2010-06-17 2011-12-22 Aragon Pharmaceuticals, Inc. Indane estrogen receptor modulators and uses thereof
US20120071535A1 (en) 2010-09-16 2012-03-22 Aragon Pharmaceuticals, Inc. Estrogen receptor modulators and uses thereof
WO2012037411A2 (en) 2010-09-16 2012-03-22 Aragon Pharmaceuticals, Inc. Estrogen receptor modulators and uses thereof
WO2012037410A2 (en) 2010-09-16 2012-03-22 Aragon Pharmaceuticals, Inc. Estrogen receptor modulators and uses thereof
WO2013110890A1 (fr) 2012-01-24 2013-08-01 Les Laboratoires Servier Nouveaux derives d'indolizine, leur procede de preparation et les compositions pharmaceutiques qui les contiennent
WO2013184514A1 (en) 2012-06-04 2013-12-12 Irm Llc Site-specific labeling methods and molecules produced thereby
US20140069822A1 (en) 2012-09-10 2014-03-13 Antec Leyden B.V. Electrochemical reduction of disulfide bonds in proteinaceous substances and electrochemical cell for carrying out such reduction
WO2014124316A2 (en) 2013-02-08 2014-08-14 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
WO2014124258A2 (en) 2013-02-08 2014-08-14 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
WO2014130310A1 (en) 2013-02-19 2014-08-28 Novartis Ag Benzothiophene derivatives and compositions thereof as selective estrogen receptor degraders
WO2015011400A1 (fr) 2013-07-23 2015-01-29 Les Laboratoires Servier Nouveaux dérives de pyrrole, leur procédé de préparation et les compositions pharmaceutiques qui les contiennent
WO2015097123A1 (en) 2013-12-23 2015-07-02 Les Laboratoires Servier New thienopyrimidine derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2015138615A2 (en) 2014-03-12 2015-09-17 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
WO2015136017A1 (en) 2014-03-13 2015-09-17 F. Hoffmann-La Roche Ag Methods and compositions for modulating estrogen receptor mutants
WO2016033486A1 (en) 2014-08-29 2016-03-03 Amgen Inc. Tetrahydronaphthalene derivatives that inhibit mcl-1 protein
US20200289661A1 (en) * 2015-03-18 2020-09-17 Seattle Genetics, Inc. Cd48 antibodies and conjugates thereof
WO2016207217A1 (en) 2015-06-23 2016-12-29 Les Laboratoires Servier New bicyclic derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2016207226A1 (en) 2015-06-23 2016-12-29 Les Laboratoires Servier New aminoacid derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2016207225A1 (en) 2015-06-23 2016-12-29 Les Laboratoires Servier New hydroxyester derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2016207216A1 (en) 2015-06-23 2016-12-29 Les Laboratoires Servier New hydroxyacid derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2017125224A1 (en) 2016-01-19 2017-07-27 Les Laboratoires Servier New ammonium derivatives, a process for their preparation and pharmaceutical compositions containing them
WO2017147410A1 (en) 2016-02-25 2017-08-31 Amgen Inc. Compounds that inhibit mcl-1 protein
WO2017182625A1 (en) 2016-04-22 2017-10-26 Astrazeneca Ab Macrocyclic mcl1 inhibitors for treating cancer
WO2018183418A1 (en) 2017-03-30 2018-10-04 Amgen Inc. Compounds that inhibit mcl-1 protein
WO2019035899A1 (en) 2017-08-15 2019-02-21 Abbvie Inc. MACROCYCLIC MCL-1 INHIBITORS AND METHODS OF USE
WO2019035914A1 (en) 2017-08-15 2019-02-21 Abbvie Inc. MACROCYCLIC MCL-1 INHIBITORS AND METHODS OF USE
WO2019035927A1 (en) 2017-08-15 2019-02-21 Abbvie Inc. MACROCYCLIC MCL-1 INHIBITORS AND METHODS OF USE
US20190055264A1 (en) 2017-08-15 2019-02-21 Abbvie Inc. Macrocyclic MCL-1 inhibitors and methods of use
WO2019035911A1 (en) 2017-08-15 2019-02-21 Abbvie Inc. MACROCYCLIC INHIBITORS OF MCL-1 AND METHODS OF USE
WO2020236825A2 (en) * 2019-05-20 2020-11-26 Novartis Ag Mcl-1 inhibitor antibody-drug conjugates and methods of use

Non-Patent Citations (51)

* Cited by examiner, † Cited by third party
Title
AB ET AL., MOL CANCER THER., vol. 14, 2015, pages 1605 - 13
AL-LAZIKANI ET AL., J MOL BIOL., vol. 273, no. 4, 1997, pages 927 - 48
ANGEW. CHEM. INT. ED., vol. 54, 2015, pages 7492 - 7509
BAST ET AL., J CLIN INVEST., vol. 68, no. 5, 1981, pages 1331 - 7
BERGE ET AL.: "Pharmaceutical Salts", J. PHARMACEUTICAL SCIENCES, vol. 66, no. 1, 1977, XP002675560, DOI: 10.1002/jps.2600660104
BEROUKHIM ET AL., NATURE, vol. 463, no. 7283, 2010, pages 899 - 905
BIOCHEMICA, vol. 2, 1999, pages 34 - 7
BOER K. ET AL., THERAPEUTIC ADVANCES IN MEDICAL ONCOLOGY, vol. 9, no. 7, 2017, pages 465 - 479
BOUDOUSQ ET AL., PLOS ONE, vol. 8, no. 7, 2013, pages e69613
BRINGMANN ET AL., ANGEW. CHEM. INT. ED., vol. 44, 2005, pages 5384 - 5427
C.C. LIUP.G. SCHULTZ, ANNU REV BIOCHEM, vol. 79, 2010, pages 413 - 444
C.H. KIM ET AL., CURR OPIN CHEM BIOL., vol. 17, 2013, pages 412 - 419
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 8
CORY ET AL., NATURE REVIEW CANCER, vol. 2, 2002, pages 647 - 656
DUCRYSTUMP, BIOCONJUGATE CHEM, vol. 21, 2010, pages 5 - 13
DUKECOHEN ET AL.: "Current Protocols in Immunology", 1992
FINN ET AL., BREAST CANCER RESEARCH, vol. 11, no. 5, 2009, pages R77
GARNER F ET AL., ANTICANCER DRUGS, vol. 26, no. 9, 2015, pages 948 - 56
GERSHONI ET AL., BIODRUGS, vol. 21, 2007, pages 145 - 56
GRUNEWALD ET AL., BIOCONJUGATE CHEM., 2015
HAGER-BRAUNTOMER, EXPERT REV PROTEOMICS, vol. 2, 2005, pages 745 - 56
HANAHAN ET AL., CELL, vol. 100, 2000, pages 57 - 70
HARLOWLANE: "Antibodies, A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY
HAYNES ET AL.: "J. Pharmaceutical Sciences", vol. 94, 2005, article "Commentary: Occurrence of Pharmaceutically Acceptable Anions and Cations in the Cambridge Structural Database"
HOLLIGERHUDSON, NAT BIOTECHNOL., vol. 23, no. 9, 2005, pages 1126 - 36
J.Y. AXUP ET AL., PROC NATL ACAD SCI U S A, vol. 109, 2012, pages 16101 - 16106
JEFFERIS ET AL., MABS, vol. 1, 2009, pages 332 - 338
JUNUTULA JR ET AL., NAT BIOTECHNOL, vol. 26, 2008, pages 925 - 932
KLEIN ET AL., NATURE MED., vol. 3, 1997, pages 402 - 8
KNAPPIK ET AL., J MOL BIOL., vol. 296, no. 1, 2000, pages 57 - 86
KOHLER ET AL., NATURE, vol. 256, 1975, pages 495
LEFRANC ET AL., DEV COMP IMMUNOL., vol. 27, no. 1, 2003, pages 55 - 77
LEFRANC, NUCLEIC ACIDS RES., vol. 29, no. 1, 2001, pages 207 - 9
LEWIS ET AL., BLOOD, vol. 128, no. 22, 2016, pages 4470
LYON ET AL., METHODS ENZYMOL., vol. 502, 2012, pages 123 - 38
LYONS ET AL., PROTEIN ENG., vol. 3, 1990, pages 1289 - 1329
MARKS ET AL., J MOL BIOL., vol. 222, 1991, pages 581 - 97
MCARDEL ET AL., CLIN IMMUNOL, vol. 164, 2016, pages 10 - 20
MCDONELL ET AL., JOURNAL OF MEDICINAL CHEMISTRY, vol. 58, no. 12, 2015, pages 4883 - 4887
MEYERSMILLER, CABIOS, vol. 4, 1989, pages 11 - 17
PAGE ET AL., INTL J ONCOLOGY, vol. 3, 1993, pages 473 - 6
RABUKA D ET AL., NAT PROTOC., vol. 7, no. 6, 2012, pages 1052 - 67
RABUKA D., CURR OPIN CHEM BIOL., vol. 14, no. 6, December 2010 (2010-12-01), pages 790 - 6
SCHOLLERURBAN, BIOMARK MED., vol. 1, no. 4, 2007, pages 513 - 23
STEFANO ET AL., METHODS MOL BIOL., vol. 1045, 2013, pages 145 - 71
STROP P. ET AL., CHEM BIOL., vol. 20, no. 2, 2013, pages 161 - 7
SZLAVIK ZOLTAN ET AL: "Discovery of S64315, a Potent and Selective Mcl-1 Inhibitor", JOURNAL OF MEDICINAL CHEMISTRY, vol. 63, no. 22, 4 November 2020 (2020-11-04), US, pages 13762 - 13795, XP055893607, ISSN: 0022-2623, Retrieved from the Internet <URL:https://pubs.acs.org/doi/pdf/10.1021/acs.jmedchem.0c01234> DOI: 10.1021/acs.jmedchem.0c01234 *
TORRES-GUZMAN R ET AL., ONCOTARGET 10.18632/ONCOTARGET.L 7778, 2017
TZARTOS, METHODS IN MOLECULAR BIOLOGY, vol. 66, 1998, pages 55 - 66
W. OU ET AL., PNAS, vol. 108, no. 26, 2011, pages 10437 - 10442
WUNSCH, J MOL BIOL., vol. 48, 1970, pages 444 - 53

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023234427A1 (ja) * 2022-06-03 2023-12-07 Ube株式会社 抗体・複数薬物コンジュゲート前駆体およびその合成中間体
WO2023234426A1 (ja) * 2022-06-03 2023-12-07 Ube株式会社 抗体・複数薬物コンジュゲート
WO2024083162A1 (en) * 2022-10-19 2024-04-25 Multitude Therapeutics Inc. Antibodies, antibody-drug conjugates, preparations and uses thereof
US12496354B2 (en) 2022-10-19 2025-12-16 Multitude Therapeutics Inc. CD142 antibodies, antibody-drug conjugates, preparations and uses thereof
WO2025106634A1 (en) * 2023-11-17 2025-05-22 Genentech, Inc. Mcl-1 inhibitor compounds and use in antibody drug conjugates
WO2025111431A1 (en) * 2023-11-22 2025-05-30 Les Laboratoires Servier Anti-cd7 antibody-drug conjugates and methods of use thereof

Also Published As

Publication number Publication date
IL303079A (en) 2023-07-01
AU2021385349A1 (en) 2023-06-22
US20240042051A1 (en) 2024-02-08
KR20230138444A (ko) 2023-10-05
CN117136076A (zh) 2023-11-28
AU2021385349A9 (en) 2024-06-27
JP2023553808A (ja) 2023-12-26
EP4251208A1 (en) 2023-10-04
CA3202759A1 (en) 2022-06-02

Similar Documents

Publication Publication Date Title
JP7663514B2 (ja) Mcl-1阻害剤抗体-薬物コンジュゲートおよび使用方法
US20240042051A1 (en) Mcl-1 inhibitor antibody-drug conjugates and methods of use
JP2023553811A (ja) Bcl-xl阻害剤抗体-薬物コンジュゲートおよびその使用方法
AU2023273734A1 (en) Met bcl-xl inhibitor antibody-drug conjugates and methods of use thereof
RU2849608C2 (ru) Конъюгаты антитело-лекарственное средство ингибитора mcl-1 и способы их применения
RU2854591C2 (ru) Конъюгаты антитело-лекарственное средство ингибитора MCL-1 и способы их применения
HK40104526A (zh) Mcl-1抑制剂抗体药物缀合物和使用方法
EA052397B1 (ru) КОНЪЮГАТЫ АНТИТЕЛО-ЛЕКАРСТВЕННОЕ СРЕДСТВО ИНГИБИТОРА Mcl-1 И СПОСОБЫ ИХ ПРИМЕНЕНИЯ
KR20250027281A (ko) Epha2 bcl-xl 억제제 항체-약물 접합체 및 그의 사용 방법
OA21037A (en) Mcl-1 inhibitor antibody-drug conjugates and methods of use.
HK40077041A (en) Mcl-1 inhibitor antibody-drug conjugates and methods of use
HK40077285A (en) Mcl-1 inhibitor antibody-drug conjugates and methods of use

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21827762

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3202759

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2023530996

Country of ref document: JP

ENP Entry into the national phase

Ref document number: 2021385349

Country of ref document: AU

Date of ref document: 20211123

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021827762

Country of ref document: EP

Effective date: 20230626