WO2022094433A2 - Compositions and methods for preventing, inhibiting, disrupting, or treating a polymicrobial biofilm - Google Patents
Compositions and methods for preventing, inhibiting, disrupting, or treating a polymicrobial biofilm Download PDFInfo
- Publication number
- WO2022094433A2 WO2022094433A2 PCT/US2021/057626 US2021057626W WO2022094433A2 WO 2022094433 A2 WO2022094433 A2 WO 2022094433A2 US 2021057626 W US2021057626 W US 2021057626W WO 2022094433 A2 WO2022094433 A2 WO 2022094433A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- dnabii
- biologically active
- biofilm
- active fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/425—Thiazoles
- A61K31/429—Thiazoles condensed with heterocyclic ring systems
- A61K31/43—Compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula, e.g. penicillins, penems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/63—Compounds containing para-N-benzenesulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonyl hydrazide
- A61K31/635—Compounds containing para-N-benzenesulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonyl hydrazide having a heterocyclic ring, e.g. sulfadiazine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/164—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/285—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Pasteurellaceae (F), e.g. Haemophilus influenza
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
- C07K16/1203—Gram-negative bacteria
- C07K16/1242—Gram-negative bacteria from Pasteurellaceae (F), e.g. Haemophilus influenza
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- Biofilm-associated diseases such as otitis media (OM), cystic fibrosis, chronic obstructive pulmonary disease, chronic rhinosinusitis, chronic wound infections, periodontitis, cystitis and infections of medical implants and indwelling catheters, among many others, are typically chronic and/or recurrent due to the presence of bacteria within biofilms that are highly resistant to killing by host immune effectors and antibiotics (Costerton et al., 1999; Flemming and Wingender, 2010).
- OM otitis media
- cystic fibrosis chronic obstructive pulmonary disease
- chronic rhinosinusitis chronic wound infections
- periodontitis cystitis and infections of medical implants and indwelling catheters
- NTHI is the predominant pathogen
- OM otitis media
- OM is still commonly treated with broad-spectrum oral antibiotics, which do not reach sufficient levels in the middle ear (or other sites) to eradicate biofilms or even the planktonically growing bacteria within this anatomical niche (Belfield et al., 2015). Although their use is sometimes indicated or necessary, broad-spectrum antibiotics can also cause collateral damage in the form of skin rashes, diarrhea and life-long disruption of the gut microbiome, with accompanied immunological and/or developmental consequences (Gilbert et al., 2018; Kuehn et al., 2015; Lamont et al., 2020).
- the method comprises, or consists essentially of, or yet further consists of administering to the subject: (i) an anti-DNABII antibody or a biologically active fragment thereof and an anti-PilA antibody or biologically active fragment thereof; or (ii) an anti-DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof.
- the anti-DNABII antibody comprises one or more of an anti-DNABII antibody, an anti-DNABII tip antibody, an anti-DNABII tip chimer antibody or biologically active fragment of each thereof.
- the anti- DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- CDRs of an anti-tip chimer antibody are shown in SEQ ID NOs: 1-3, 7-9, 13 and 14 are illustrated below.
- the CDRs of an anti tail chimer are shown in SEQ ID NOs: 4-6 and 10-12.
- the antibody is a polyclonal antibody. In one aspect the antibody is a monoclonal antibody.
- the antibody is a monoclonal antibody or a biologically active fragment thereof.
- the anti- DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp — 003864351.1).
- the polymicrobial biofilm is caused by Haemophilus, e.g.
- the method further comprises administering to the subject an antibiotic.
- the antibiotic comprises or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic and/or a sulfonamide antibiotic.
- the method comprises, or consists essentially of, or yet further consists of administering to the subject: i) an anti-DNABII antibody or a biologically active fragment thereof and an anti- PilA antibody or biologically active fragment thereof; or (ii) an anti-DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof.
- the antibody is a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises one or more of an anti-DNABII antibody, an anti-DNABII tip antibody, an anti-DNABII tip chimer antibody or biologically active fragment of each thereof.
- the anti-DNABII antibody comprises an anti- DNABII tip chimer antibody or biologically active fragment thereof.
- CDRs of an anti-tip chimer antibody are shown in SEQ ID NOs: 1-3, 7-9, 13 and 14 are illustrated below.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp — 003864351.1).
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- the disease is selected from: cystic fibrosis (CF), lung CF, chronic obstructive pulmonary disease (COPD), chronic rhinosinusitis (CRS), periodontitis, periimplantitis, middle ear infection, otitis media, (OM), acute otitis media (AOM), otitis media with effusion (OME), post-tympanostomy tube otorrhea (PTTO), ventilator-associated pneumonia (VAP), community-acquired pneumonia (CAP), chest tube/catheter/indwelling device biofilm infections, tonsillitis, pharyngitis, laryngitis, epiglottitis, sinusitis, pneumonia, bronchitis, or other respiratory tract infection (RTI).
- CF cystic fibrosis
- COPD chronic obstructive pulmonary disease
- CRS chronic rhinosinusitis
- periodontitis periimplantitis
- middle ear infection otitis media
- OM middle
- the method further comprises administering to the subject an antibiotic.
- the antibiotic comprises, or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic and/or a sulfonamide antibiotic.
- the method comprises, or consists essentially of, or yet further consists of contacting the biofilm with (i) an anti DNA binding and bending protein (DNABII) antibody or a biologically active fragment thereof; and (ii) an anti majority subunit (PilA) of type IV pilus (T4P) antibody or a biologically active fragment thereof.
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- the anti-DNABII antibody comprises one or more of an anti-DNABII antibody, an anti-DNABII tip antibody, an anti-DNABII tip chimer antibody or biologically active fragment of each thereof.
- the anti-DNABII antibody is a anti-DNABII tip chimer antibody or a biologically active fragment thereof.
- CDRs of an anti-tip chimer antibody are shown in SEQ ID NOs: 1-3, 7-9, 13 and 14 are illustrated below.
- the method further comprises contacting the polymicrobial biofilm with an antibiotic.
- the antibiotic comprises or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic and/or a sulfonamide antibiotic.
- the contacting may be in vitro or in vivo.
- a method for sensitizing a polymicrobial biofilm that was caused by, will be caused by, or comprises a Haemophilus bacteria for an antibiotic therapy or inducing bacteria that forms the polymicrobial biofilm to a newly released (NRel) state.
- the method comprises, or consists essentially of, or yet further consists of contacting the biofilm with (i) an anti DNA binding and bending protein (DNABII) antibody or a biologically active fragment thereof; and (ii) an anti majority subunit (PilA) of type IV pilus (T4P) antibody or a biologically active fragment thereof.
- DNABII anti DNA binding and bending protein
- PVA anti majority subunit of type IV pilus
- the antibody can be a polyclonal antibody or monoclonal antibody or biologically active fragment thereof.
- the anti-DNABII antibody comprises one or more of an anti-DNABII antibody, an anti-DNABII tip antibody, an anti-DNABII tip chimer antibody or biologically active fragment of each thereof.
- CDRs of an anti-tip chimer antibody are shown in SEQ ID NOs: 1-3, 7-9, 13 and 14 are illustrated below.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp—003864351.1).
- the method further comprises contacting the polymicrobial biofilm with an antibiotic.
- the antibiotic comprises or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic and/or a sulfonamide antibiotic.
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis. The contacting may be in vitro or in vivo.
- a method for sensitizing a polyclonal microbial biofilm that was caused by, will be caused by, or comprises a Haemophilus bacteria in a subject in need thereof for an antibiotic therapy or inducing bacteria of the polymicrobial biofilm in a subject in need thereof to a newly released (NRel) state.
- the method comprises or consists essentially of, or yet further consists of administering to the subject: (i) an anti- DNABII antibody or a biologically active fragment thereof; and (ii) a PilA polypeptide or a biologically active fragment thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises one or more of an anti-DNABII antibody, an anti-DNABII tip antibody, an anti-DNABII tip chimer antibody or biologically active fragment of each thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- CDRs of an anti-tip chimer antibody are shown in SEQ ID NOs: 1-3, 7- 9, 13 and 14 are illustrated below.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp — 003864351.1).
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- the method further comprises administering to the subject an antibiotic.
- the antibiotic comprises or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic and/or a sulfonamide antibiotic.
- kits and compositions such as those for use in a method as disclosed herein.
- a kit comprising, or consisting essentially of, or yet further consisting of at least two of: (i) an anti-DNABII antibody or a biologically active fragment thereof, (ii) one or both of: an anti-PilA antibody or a biologically active fragment thereof, or a PilA polypeptide or a biologically active fragment thereof, or (iii) an antibiotic; and optionally instructions for use.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises one or more of an anti-DNABII antibody, an anti-DNABII tip antibody, an anti-DNABII tip chimer antibody or biologically active fragment of each thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- CDRs of an anti-tip chimer antibody are shown in SEQ ID NOs: 1-3, 7- 9, 13 and 14 are illustrated below.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp— 003864351.1).
- the antibiotic comprises or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic and/or a sulfonamide antibiotic.
- composition comprising, or consisting essentially of, or yet further consisting of at least two of the following: (i) an anti-DNABII antibody or a biologically active fragment thereof, (ii) one or both of: an anti-PilA antibody or a biologically active fragment thereof, or a PilA polypeptide or a biologically active fragment thereof, or (iii) an antibiotic; and a carrier optionally a pharmaceutically acceptable carrier.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti- DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- CDRs of an anti-tip chimer antibody are shown in SEQ ID NOs: 1-3, 7-9, 13 and 14 are illustrated below.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp— 003864351.1).
- the antibodies can be detectably labeled.
- the antibiotic comprises or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic and/or a sulfonamide antibiotic.
- the antibody, polypeptide, biologically active fragment of each thereof, or any combination thereof may be administered to a subject in a composition as disclosed herein. In other embodiments, the antibody, polypeptide, biologically active fragment of each thereof, or any combination thereof may be administered to a subject as a polynucleotide encoding such antibody, polypeptide, biologically active fragment or a polynucleotide complementary thereto.
- such polynucleotide may be suitable for expressing the antibody, polypeptide, biologically active fragment in the subject, for example via further comprising a regulatory sequence directing the expression.
- a vector such as a gene delivery vehicle, comprising a polynucleotide as disclosed herein may also be used for administration.
- the vector may be a viral or a non-viral vector as disclosed herein.
- a host cell comprising one or more of the polynucleotides and/or the vectors as disclosed herein.
- kits and compositions comprising one or more of such polynucleotides and/or vectors and/or host cells in addition to or in replacement of the corresponding antibody, peptide or biological active fragment thereof expressed.
- methods and compositions suitable for producing such polypeptides, antibodies, biologically active fragments, polynucleotides, vectors and host cells are provided.
- a method for selecting a polymicrobial biofilm that was caused by, will be caused by, or comprises a Haemophilus bacteria suitable for one or more of the following: prevention, inhibition, disruption, dispersion, treatment or sensitization by a method as disclosed herein.
- the polymicrobial biofilm is caused by Haemophilus, e.g.
- the screening method comprises or consists essentially of, or yet further consists of (a) contacting the polymicrobial biofilm, or a polymicrobial biofilm isolated and grown therefrom, with any one of an anti- DNABII antibody or a biologically active fragment thereof, an anti-PilA antibody or biologically active fragment thereof, or a PilA polypeptide or a biologically active fragment thereof (b) and assaying released bacteria from the biofilm of (a) for expression of one or more of the following genes: deaD, artM, fis, folA, folP, emrA, emrB, or acrR and level of one or more of proteins: AsnC, CyaA, GlpC, NrfA, TehB, TrpB, TrpC, TrpD, TruA, TrxA; Ab
- one or more of the following indicates the biofilm is suitable for a method as disclosed herein: an altered gene expression of one or more of the following genes: deaD, artM, fis, folA, folP, emrA, emrB, or acrR; an altered level of one or more of the following proteins: AsnC, CyaA, GlpC, NrfA, TehB, TrpB, TrpC, TrpD, TruA, or TrxA; a low level of one or more of the following proteins: AbgA, AroE, AroK, ArtP, AtpH, BioB, BioF, CcmA, CitD, CitT, CmK, CoaD, DcD, DjlA, DksA, DnaE, DnaQ, DsbE, FabG, FdhX, FtnB, FtsE, FtsI, FumC, Fur, GlpA, GlpB,
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises one or more of an anti-DNABII antibody, an anti-DNABII tip antibody, an anti-DNABII tip chimer antibody or biologically active fragment of each thereof.
- the anti-DNABII antibody comprises an anti- DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- CDRs of an anti-tip chimer antibody are shown in SEQ ID NOs: 1-3, 7-9, 13 and 14 are illustrated below.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp—003864351.1).
- the antibodies can be detectably labeled.
- the high, low, altered expression or level is compared to the same bacteria but grown planktonically.
- a kit for use in the method comprising, or consisting essentially of, or yet further consisting of instruction for use and probes suitable for the assay. In some embodiments, one or more of the probes are labeled.
- FIGS.1A to 1B show quantitation of NTHI released from biofilm-residence by either anti-rsPilA or anti-IHF.
- NTHI biofilms established for 16 h were incubated for an additional (FIG.1A) 6 h with rabbit anti-rsPilA IgG or (FIG.1B) 15 min with rabbit anti- IHF IgG or with each of three negative controls (sBHI, IgG isolated from naive serum or IgG isolated from anti-OMP P5 serum) followed by quantitation of NTHI recovered from supernatants above the biofilms.
- FIGS.2A to 2E show that anti-rsPilA NRel were released from a biofilm as individual cells whereas anti-IHF NRel were aggregated.
- FIG.2A provides contour plots depicted side scatter and forward scatter profiles for two control samples, NTHI briefly sonicated to produce an individual cell suspension or NTHI colonies collected from an agar plate to represent bacterial aggregates, assessed by flow cytometry.
- FIG.2B Representative contour plots of (FIG.2B) anti-rsPilA NRel and (FIG.2C) anti-IHF NRel demonstrated unique scatter profiles between the two NRel populations.
- the distribution of anti-IHF NRel (right histogram) versus anti-rsPilA NRel (left histogram) by (FIG.2D) forward scatter and (FIG. 2E) side scatter was also distinct.
- the percent increase in cumulative distribution of anti-IHF NRel compared to anti-rsPilA NRel shown in (FIG.2D) and (FIG.2E) was determined by Kolmogorov-Smirnov test (99% CI).
- FIGS.3A to 3D show that release of NTHI from a biofilm by incubation with anti- rsPilA or anti-IHF antibodies generated NRel populations with distinct proteomic expression profiles compared to planktonically grown NTHI and, importantly, to each other.
- FIG.3A provides principal component analysis (PCA) plot generated from the normalized spectral counts of each protein in anti-rsPilA NRel (dots in the middle circle), anti-IHF NRel (dots in the left circle) and planktonically grown NTHI (dots in the right circle).
- PCA principal component analysis
- FIG.3B provides Venn diagram of the number of proteins with a significant (P ⁇ 0.05) 1.5-fold increase (above the dashed line) or decrease (below the dashed line) specific to anti-rsPilA (left section), anti-IHF (right section), or shared (center section), compared to planktonic NTHI.
- FIG.3C shows that the anti-rsPilA (top bar of each group) and anti-IHF (bottom bar of each group) NRel demonstrated distinct protein expression patterns with a significant (P ⁇ 0.05) 1.5-fold increase or decrease represented by different COG categories when compared to planktonically grown NTHI.
- FIG.3D provides direct comparison of differences in protein expression profiles of anti-IHF and anti-rsPilA NRel populations with a significant (P ⁇ 0.05) 1.5-fold increase or decrease compared to each other, as shown by a volcano plot of anti-IHF NRel versus anti-rsPilA NRel. Negative significant fold decreases represent proteins with greater abundance in the anti-rsPilA NRel (dots in the top left section), while positive fold increases represent greater protein abundance in the anti- IHF NRel (dots in the top right section) compared to each other.
- FIGS.4A to 4C show differences in relative gene expression support the observed distinct anti-IHF and anti-rsPilA NRel phenotypes, including antibiotic sensitivities. Results of qRT-PCR assay to examine the expression of genes by NRel relative to planktonic NTHI.
- FIG.4A provides relative expression of deaD, artM, and fis, genes associated with lag phase of growth, was significantly greater in anti-IHF vs. anti-rsPilA NRel.
- FIG.4B shows the enzymes targeted by TMP and SMX are encoded by folA and folP respectively, and thereby increased expression confers resistance.
- FIG.4C shows that relative expression of emrA and emrB, which encode subunits of an efflux pump that transports TMP-SMX, was significantly less by anti-rsPilA vs. anti-IHF NRel.
- FIGS 5A to 5E show that NRel NTHI populations were more sensitive to killing than their planktonic counterparts, and this sensitivity was distinct from each other.
- FIG.5A provides a diagram of the four populations of NTHI tested herein. NRel were generated by incubation of NTHI biofilms with rabbit polyclonal IgG isolated from anti-rsPilA serum (6 h, left bottom) or from anti-IHF serum (15 min, right bottom).
- FIG.5B & FIG.5C show that anti-rsPilA NRel were significantly more sensitive to killing by trimethoprim/sulfamethoxazole than planktonic NTHI (TMP-SMX at 0.94 ⁇ g and 4.7 ⁇ g per ml respectively, FIG.5B), but only equally as sensitive to killing by amoxicillin/clavulanate (AMC at 2.5 ⁇ g and 1.25 ⁇ g per ml, respectively FIG.5C).
- Biofilm-resident NTHI displayed minimal sensitivity to either TMP-SMX or AMC as expected. In contrast, as shown in FIG.
- anti-IHF NRel were only equally as sensitive to killing by TMP-SMX as planktonic NTHI (0.09 and 0.45 ⁇ g/ml respectively, FIG.5D), but significantly more sensitive to killing by AMC (0.30 and 0.15 pg/ml respectively, FIG. 5E).
- the uniquely heightened sensitivity of NTHI NRel to killing by either TMP-SMX or AMC was dependent upon the mechanism by which they were released from biofilm residence. Individual data points are shown, bars represent mean ⁇ SEM. ***P ⁇ 0.001, ****P ⁇ 0.0001, one-way analysis of variance with the Holm-Sidak correction.
- FIGS. 6A to 6D provide that enhanced sensitivity of anti-rsPilA or anti-HTF NRel NTHI to TMP-SMX or AMC, respectively, was independent of the timing of NTHI release from biofilm residence. Applicant exposed biofilms to rabbit polyclonal IgG isolated from either anti-rsPilA or anti-IHF serum for 2 h, then collected NRel NTHI and assayed for relative antibiotic sensitivity. (FIG. 6A & FIG.
- FIG. 6B show that anti-rsPilA NRel were significantly more sensitive to killing by TMP/SMX than planktonic NTHI (TMP-SMX at 0.09 pg and 0.45 pg per ml respectively, (FIG. 6A), but only equally as sensitive to killing by AMC (AMC at 0.3 pg and 0.15 pg per ml, respectively FIGURE).
- FIG. 6C & FIG. 6D anti-IHF NRel were only equally as sensitive to killing by TMP- SMX as planktonic NTHI (0.94 and 4.7 pg/ml respectively, FIG.
- FIG. 6C shows that time-matched anti-rsPilA or anti-IHF NRel maintained the same distinct antibiotic sensitivity phenotype as shown when 15 min anti-IHF NRel were compared to 6h anti-rsPilA NRel (see FIG. 5). Individual data points are shown, bars represent mean ⁇ SEM.
- FIG. 7 shows synergistic effects of an anti-rsPilA antibody and an anti-IHF (e.g., an anti-DNABII) antibody.
- Wells were incubated with NTHI + Streptococcus pneumoniae + Staphylococcus aureas in a 1 : 1 : 1 ratio and allowed to form a biofilm for 16 hours at 37°C and 5% CO2 prior to a 2 hour treatment to determine relative disruption compared to treatment with medium alone (see treatments marked in the figure).
- Bacteria were labeled with FM1-43 FX and relative fluorescence was calculated per well.
- a clear synergistic outcome was achieved via combinatorial treatment with anti-rsPilA plus anti-tip chimer monoclonal antibody, demonstrated here for the first time.
- FIGS. 8A to 8C show antibiotic sensitivity of NTHI newly released from a biofilm by anti-IHFNTHi. Biofilms were grown at 37°C for 16 hours, and then treated for 6 h with (1 :50 dilution) or sBHI only. Planktonic population was collected and assayed for antibiotic sensitivity. AC concentration used is 1/0.5 ⁇ g/ml and TS concentration used is 7.5/37.5 ⁇ g/ml.
- FIG.8A plots data from anti-IHF diluted at 1/10 or no anti-IHF treatment.
- FIG.8B plots data from anti-IHF diluted at 1/100 or no anti-IHF treatment.
- FIGS.9A to 9C show synergistic activity against multi-species biofilms.
- FIG.9A show NTHI + Burkholderia cenocepacia. The NTHI alone biofilms continued to perform as expected with the cocktails synergy clearly shown.
- FIG.9B shows activity against NTHI + Staphylococcus aureus biofilm.
- FIG.9C shows NTHI + Streptococcus pneumonia.
- FIGS.10A to 10E show synergistic activity of anti-rsPilA + anti-tip chimer to release by Moraxella catarrhalis (Mcat) from a dual species biofilm.
- FIG.10A NRels released from either a 2-species biofilm formed by NTHI + Mcat or an NTHI biofilm after 2 hour exposure to 2.5 ⁇ g of either anti-rsPilA, anti-Tip or a combination of both antibodies compared to non-associated bacteria from a nontreated biofilm.
- FIG.10B NRels released from either a 2-species biofilm formed by NTHI + Mcat or an NTHI biofilm after 6 hour exposure to 2.5 ⁇ g of either anti-rsPilA, anti-Tip or a combination of both antibodies compared to non-associated bacteria from a nontreated biofilm.
- FIG.10C NRels released from either a 2-species biofilm formed by NTHI + Mcat or an NTHI biofilm after 16 hour exposure to 2.5 ⁇ g of either anti-rsPilA, anti-Tip or a combination of both antibodies compared to non-associated bacteria from a nontreated biofilm.
- FIG.10D NRels released from either a 2-species biofilm formed by NTHI + Mcat or an NTHI biofilm after 6 hour exposure to 10 ⁇ g of either anti-rsPilA, anti-Tip or a combination of both antibodies compared to non-associated bacteria from a nontreated biofilm.
- FIG.10E NRels released from either a 2-species biofilm formed by NTHI + Mcat or an NTHI biofilm after 16 hour exposure to 10 ⁇ g of either anti-rsPilA, anti-Tip or a combination of both antibodies compared to non-associated bacteria from a nontreated biofilm.
- compositions consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives and the like.
- Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions of this disclosure or process steps to produce a composition or achieve an intended result. Embodiments defined by each of these transition terms are within the scope of this disclosure. [0031] “Optional” or “optionally” means that the subsequently described circumstance may or may not occur, so that the description includes instances where the circumstance occurs and instances where it does not.
- “and/or” refers to and encompasses any and all possible combinations of one or more of the associated listed items, as well as the lack of combinations when interpreted in the alternative (“or”).
- “Substantially” or “essentially” means nearly totally or completely, for instance, 95% or greater of some given quantity. In some embodiments, “substantially” or “essentially” means 95%, 96%, 97%, 98%, 99%, 99.5%, or 99.9%.
- comparative terms as used herein, such as high, low, increase, decrease, reduce, or any grammatical variation thereof, can refer to certain variation from the reference.
- such variation can refer to an increase of about 10%, or about 20%, or about 30%, or about 40%, or about 50%, or about 60%, or about 70%, or about 80%, or about 90%, or about 1 fold, or about 2 folds, or about 3 folds, or about 4 folds, or about 5 folds, or about 6 folds, or about 7 folds, or about 8 folds, or about 9 folds, or about 10 folds, or about 20 folds, or about 30 folds, or about 40 folds, or about 50 folds, or about 60 folds, or about 70 folds, or about 80 folds, or about 90 folds, or about 100 folds or more higher than the reference.
- such variation can refer to an decrease, such as about 1%, or about 2%, or about 3%, or about 4%, or about 5%, or about 6%, or about 7%, or about 8%, or about 0%, or about 10%, or about 20%, or about 30%, or about 40%, or about 50%, or about 60%, or about 70%, or about 75%, or about 80%, or about 85%, or about 90%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% of the reference.
- the term “polymicrobial biofilm” intends a biofilm caused by more than one species of biofilm causing bacteria.
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and another bacteria, e.g., one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- the term “disrupt” or a grammatical variation thereof intends interference with DNA/protein matrix that is a component of a microbial biofilm, such as targeting an antigen in the biofilm structural linchpin outside of the microbes, such as bacteria, thus breaking down the biofilm and resulting in reduction and/or elimination of the biofilm.
- disrupting a biofilm refers to dispersing the biofilm, releasing microorganisms from the DNA/protein matrix of the biofilm, and optionally allowing killing the microorganisms by host immune effectors and/or antibiotics.
- the term “disperse” or a grammatical variation refers to interference with a molecule on the surface of or inside a microbe in a biofilm, such as targeting an antigen on the surface of the microbe, thus breaking down the biofilm and resulting in reduction and/or elimination of the biofilm.
- an anti-PilA antibody disperses a biofilm.
- the biofilm comprises and/or is generated by nontypeable Haemophilus influenzae.
- “Inhibiting, preventing or disrupting” a biofilm intends the prophylactic or therapeutic reduction in the structure of a biofilm.
- Microbial DNA intends single or double stranded DNA from a microorganism, such as a bacteria, that is incorporated into a biofilm.
- eDNA refers to extracellular DNA found as a component to pathogenic biofilms.
- polynucleotide refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogs thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown.
- polynucleotides a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers.
- a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
- modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide.
- the sequence of nucleotides can be interrupted by non-nucleotide components.
- a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
- the term also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any embodiment of this disclosure that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
- polynucleotide and “oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogs thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown. [0042] A polynucleotide is composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); thymine (T); and uracil (U) for thymine when the polynucleotide is RNA.
- a polynucleotide is composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); thymine (T); and uracil (U) for thymine when the polynucleotide is RNA.
- polynucleotide sequence is the alphabetical representation of a polynucleotide molecule. This alphabetical representation can be input into databases in a computer having a central processing unit and used for bioinformatics applications such as functional genomics and homology searching.
- the polynucleotide as disclosed herein is a RNA.
- the polynucleotide as disclosed herein is a DNA.
- the polynucleotide as disclosed herein is a hybrid of DNA and RNA.
- isolated refers to molecules separated from other DNAs or RNAs, respectively that are present in the natural source of the macromolecule.
- isolated nucleic acid is meant to include nucleic acid fragments which are not naturally occurring as fragments and would not be found in the natural state.
- isolated is also used herein to refer to polypeptides, proteins and/or host cells that are isolated from other cellular proteins and is meant to encompass both purified and recombinant polypeptides.
- the term “isolated” means separated from constituents, cellular and otherwise, in which the cell, tissue, polynucleotide, peptide, polypeptide, protein, antibody or fragment(s) thereof, which are normally associated in nature.
- an isolated cell is a cell that is separated form tissue or cells of dissimilar phenotype or genotype.
- a non-naturally occurring polynucleotide, peptide, polypeptide, protein, antibody or fragment(s) thereof does not require “isolation” to distinguish it from its naturally occurring counterpart.
- the term “engineered” or “recombinant” refers to having at least one modification not normally found in a naturally occurring protein, polypeptide, polynucleotide, strain, wild-type strain or the parental host strain of the referenced species. In some embodiments, the term “engineered” or “recombinant” refers to being synthetized by human intervention. [0045] It is to be inferred without explicit recitation and unless otherwise intended, that when the present disclosure relates to a polypeptide, protein, polynucleotide or antibody, an equivalent or a biologically equivalent of such is intended within the scope of this disclosure.
- biological equivalent thereof is intended to be synonymous with “equivalent thereof” when referring to a reference protein, antibody, fragment, polypeptide or nucleic acid, intends those having minimal homology while still maintaining desired structure or functionality. Unless specifically recited herein, it is contemplated that any polynucleotide, polypeptide or protein mentioned herein also includes equivalents thereof. In some embodiments, an equivalent to a reference nucleic acid, polynucleotide or oligonucleotide encodes the same sequence encoded by the reference.
- an equivalent to a reference nucleic acid, polynucleotide or oligonucleotide hybridizes to the reference, a complement reference, a reverse reference, and/or a reverse-complement reference, optionally under conditions of high stringency.
- an equivalent nucleic acid, polynucleotide or oligonucleotide is one having at least 70%, or at least 75%, or at least 80% sequence identity, or alternatively at least 85 % sequence identity, or alternatively at least 90% sequence identity, or alternatively at least 92% sequence identity, or alternatively at least 95% sequence identity, or alternatively at least 97% sequence identity, or alternatively at least 98 % sequence identity to the reference nucleic acid, polynucleotide, or oligonucleotide, or alternatively an equivalent nucleic acid hybridizes under conditions of high stringency to a reference polynucleotide or its complement.
- an equivalent must encode functional protein that optionally can be identified through one or more assays described herein.
- an equivalent has at least the 70%, or at least 75%, or at least 80 % sequence identity, or alternatively at least 85% sequence identity, or alternatively at least 90% sequence identity, or alternatively at least 92% sequence identity, or alternatively at least 95% sequence identity, or alternatively at least 97% sequence identity, or alternatively at least 98% sequence identity to the reference nucleic acid, polynucleotide, or oligonucleotide, or alternatively an equivalent nucleic acid hybridizes under conditions of high stringency to a reference polynucleotide or its complement, with the proviso that one or more mutated polynucleotides identified herein having one or more non-naturally occurring glycosylation sites are not mutated from the corresponding mutated polynucleotides in the disclosed sequences.
- an equivalent polynucleotide is one that hybridizes under stringent conditions to the polynucleotide or complement of the polynucleotide as described herein for use in the described methods.
- an equivalent antibody or antigen binding polypeptide intends one that binds to an antigen with at least 70%, or alternatively at least 75%, or alternatively at least 80%, or alternatively at least 85%, or alternatively at least 90%, or alternatively at least 95% affinity or higher affinity compared to a reference antibody or antigen binding fragment.
- the equivalent thereof competes with the binding of the reference antibody or antigen binding fragment to its antigen under a competitive ELISA assay.
- an equivalent intends at least about 80% homology or identity and alternatively, at least about 85%, or alternatively at least about 90%, or alternatively at least about 95%, or alternatively 98% percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid.
- biologically equivalent polypeptides are provided in Table 9 of WO 2011/123396 which identifies conservative amino acid substitutions to the disclosed amino acid sequences.
- a polynucleotide or polynucleotide region has a certain percentage (for example, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) of “sequence identity” to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences.
- This alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Ausubel et al. eds. (2007) Current Protocols in Molecular Biology.
- default parameters are used for alignment.
- One alignment program is BLAST, using default parameters.
- Homology refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences. An “unrelated” or “non-homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences of the present disclosure.
- “Homology” or “identity” or “similarity” can also refer to two nucleic acid molecules that hybridize under stringent conditions.
- “Hybridization” refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues. The hydrogen bonding may occur by Watson- Crick base pairing, Hoogstein binding, or in any other sequence-specific manner.
- the complex may comprise two strands forming a duplex structure, three or more strands forming a multi -stranded complex, a single self-hybridizing strand, or any combination of these.
- a hybridization reaction may constitute a step in a more extensive process, such as the initiation of a PCR reaction, or the enzymatic cleavage of a polynucleotide by a ribozyme.
- Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
- the hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein binding, or in any other sequence-specific manner.
- the complex may comprise two strands forming a duplex structure, three or more strands forming a multi -stranded complex, a single self-hybridizing strand, or any combination of these.
- a hybridization reaction may constitute a step in a more extensive process, such as the initiation of a PCR reaction, or the enzymatic cleavage of a polynucleotide by a ribozyme.
- the reaction is called “annealing” and those polynucleotides are described as “complementary.”
- a double-stranded polynucleotide can be “complementary” or “homologous” to another polynucleotide, if hybridization can occur between one of the strands of the first polynucleotide and the second.
- Hybridization reactions can be performed under conditions of different “stringency”. In general, a low stringency hybridization reaction is carried out at about 40 °C in 10 x SSC or a solution of equivalent ionic strength/temperature. A moderate stringency hybridization is typically performed at about 50 °C in 6 x SSC, and a high stringency hybridization reaction is generally performed at about 60 °C in 1 x SSC.
- stringent hybridization conditions include: incubation temperatures of about 25° C. to about 37° C.; hybridization buffer concentrations of about 6 ⁇ SSC to about 10 ⁇ SSC; formamide concentrations of about 0% to about 25%; and wash solutions from about 4 ⁇ SSC to about 8 ⁇ SSC.
- moderate hybridization conditions include: incubation temperatures of about 40° C. to about 50° C.; buffer concentrations of about 9 ⁇ SSC to about 2 ⁇ SSC; formamide concentrations of about 30% to about 50%; and wash solutions of about 5 ⁇ SSC to about 2 ⁇ SSC.
- high stringency conditions include: incubation temperatures of about 55° C.
- hybridization incubation times are from 5 minutes to 24 hours, with 1, 2, or more washing steps, and wash incubation times are about 1, 2, or 15 minutes.
- SSC is 0.15 M NaCl and 15 mM citrate buffer. It is understood that equivalents of SSC using other buffer systems can be employed. Hybridization reactions can also be performed under “physiological conditions” which is well known to one of skill in the art.
- a non-limiting example of a physiological condition is the temperature, ionic strength, pH and concentration of Mg 2+ normally found in a cell.
- the expression “amplification of polynucleotides” includes methods such as PCR, ligation amplification (or ligase chain reaction, LCR) and amplification methods. These methods are known and widely practiced in the art. See, e.g., U.S. Pat. Nos.4,683,195 and 4,683,202 and Innis et al., 1990 (for PCR); and Wu et al. (1989) Genomics 4:560-569 (for LCR).
- the PCR procedure describes a method of gene amplification which is comprised of (i) sequence-specific hybridization of primers to specific genes within a DNA sample (or library), (ii) subsequent amplification involving multiple rounds of annealing, elongation, and denaturation using a DNA polymerase, and (iii) screening the PCR products for a band of the correct size.
- the primers used are oligonucleotides of sufficient length and appropriate sequence to provide initiation of polymerization, i.e. each primer is specifically designed to be complementary to each strand of the genomic locus to be amplified.
- Reagents and hardware for conducting PCR are commercially available.
- Primers useful to amplify sequences from a particular gene region are preferably complementary to, and hybridize specifically to sequences in the target region or its flanking regions. Nucleic acid sequences generated by amplification may be sequenced directly. Alternatively, the amplified sequence(s) may be cloned prior to sequence analysis. A method for the direct cloning and sequence analysis of enzymatically amplified genomic segments is known in the art.
- a “gene” refers to a polynucleotide containing at least one open reading frame (ORF) that is capable of encoding a particular polypeptide or protein after being transcribed and translated.
- ORF open reading frame
- the term “express” refers to the production of a gene product.
- expression refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.
- encode refers to a polynucleotide which is said to “encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, it can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof.
- the antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
- a “gene product” or alternatively a “gene expression product” refers to the mRNA and/or the amino acid (e.g., peptide or polypeptide) generated when a gene is transcribed and translated.
- “Under transcriptional control” is a term well understood in the art and indicates that transcription of a polynucleotide sequence, usually a DNA sequence, depends on its being operatively linked to an element which contributes to the initiation of, or promotes, transcription. “Operatively linked” intends the polynucleotides are arranged in a manner that allows them to function in a cell. [0060]
- a regulatory sequence “an expression control element” or “promoter” as used herein, intends a polynucleotide that is operatively linked to a target polynucleotide to be transcribed and/or replicated, and facilitates the expression and/or replication of the target polynucleotide.
- a promoter is an example of an expression control element or a regulatory sequence. Promoters can be located 5’ or upstream of a gene or other polynucleotide, that provides a control point for regulated gene transcription. Polymerase II and III are examples of promoters.
- An enhancer is a regulatory element that increases the expression of a target sequence.
- a "promoter/enhancer” is a polynucleotide that contains sequences capable of providing both promoter and enhancer functions. For example, the long terminal repeats of retroviruses contain both promoter and enhancer functions.
- the enhancer/promoter may be "endogenous” or “exogenous” or “heterologous.”
- An “endogenous” enhancer/promoter is one which is naturally linked with a given gene in the genome.
- An “exogenous” or “heterologous” enhancer/promoter is one which is placed in juxtaposition to a gene by means of genetic manipulation (i.e., molecular biological techniques) such that transcription of that gene is directed by the linked enhancer/promoter.
- a “probe” when used in the context of polynucleotide manipulation refers to an oligonucleotide that is provided as a reagent to detect a target potentially present in a sample of interest by hybridizing with the target.
- a probe will comprise a detectable label or marker or a means by which a label or marker can be attached, either before or subsequent to the hybridization reaction.
- a “probe” can be a biological compound such as a polypeptide, antibody, or fragments thereof that is capable of binding to the target potentially present in a sample of interest.
- a “primer” is a short polynucleotide, generally with a free 3’ -OH group that binds to a target or “template” potentially present in a sample of interest by hybridizing with the target, and thereafter promoting polymerization of a polynucleotide complementary to the target.
- PCR polymerase chain reaction
- PCR is a reaction in which replicate copies are made of a target polynucleotide using a “pair of primers” or a “set of primers” consisting of an “upstream” and a “downstream” primer, and a catalyst of polymerization, such as a DNA polymerase, and typically a thermally-stable polymerase enzyme.
- Methods for PCR are well known in the art, and taught, for example in MacPherson et al. (1991) PCR 1: A Practical Approach (IRL Press at Oxford University Press).
- a primer can also be used as a probe in hybridization reactions, such as Southern or Northern blot analyses. Sambrook and Russell (2001), infra.
- the term “protein”, “peptide” and “polypeptide” are used interchangeably and in their broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics.
- the subunits may be linked by peptide bonds. In another embodiment, the subunit may be linked by other bonds, e.g., ester, ether, etc.
- a protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise a protein's or peptide's sequence.
- amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics.
- a “C-terminal polypeptide” intends at least the 10, or alternatively at least the 15, or alternatively at least 20, or at least the 25 C-terminal amino acids or alternatively half of a polypeptide. In another aspect, for polypeptides containing 90 amino acids, the C-terminal polypeptide would comprise amino acids 46 through 90.
- the term intends the C-terminal 20 amino acids from the carboxyl terminus.
- an amino acid (aa) or nucleotide (nt) residue position in a sequence of interest “corresponding to” an identified position in a reference sequence refers to that the residue position is aligned to the identified position in a sequence alignment between the sequence of interest and the reference sequence.
- Various programs are available for performing such sequence alignments, such as Clustal Omega and BLAST.
- the term "conservative amino acid substitution” refers to a substitution of a native amino acid residue with a normative residue, including naturally occurring and nonnaturally occurring amino acids, such that there is little or no effect on the polarity or charge of the amino acid residue at that position. For example, a conservative substitution results from the replacement of a non-polar residue in a polypeptide with any other non-polar residue.
- any native residue in the polypeptide may also be substituted with alanine, according to the methods of "alanine scanning mutagenesis".
- Naturally occurring amino acids are characterized based on their side chains as follows: basic: arginine, lysine, histidine; acidic: glutamic acid, aspartic acid; uncharged polar: glutamine, asparagine, serine, threonine, tyrosine; and non-polar: phenylalanine, tryptophan, cysteine, glycine, alanine, valine, proline, methionine, leucine, norleucine, isoleucine
- Basic rules for amino acid substitutions are set forth below.
- an equivalent antibody, antibody fragment, protein or polypeptide is one having at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, or at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the reference protein or polypeptide.
- an equivalent antibody, antibody fragment, protein or polypeptide has at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, or at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to a polypeptide or protein as disclosed herein.
- an equivalent antibody, antibody fragment, protein or polypeptide has at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, or at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to antibody, antibody fragment, polypeptide or protein encoded by an equivalent polynucleotide as noted herein.
- the equivalent of a polynucleotide would encode an antibody, antibody fragment, protein or polypeptide of the same or similar function as the reference or parent polynucleotide.
- the equivalent is a functional protein that optionally can be identified through one or more assays described herein.
- an equivalent has at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, or at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%sequence identity to the reference protein or polypeptide.
- the equivalent or biologically equivalent antibody, antibody fragment, protein or polypeptide performs functions similar to a wildtype and/or at a similar level compared to a wildtype.
- the term “EC 50 ” refers to the concentration of an antibody or a fragment thereof which induces a response (for example, binding between the antibody or a fragment thereof and its target) halfway between the baseline and maximum after a specified exposure time.
- receptor such as an antibody or a fragment thereof
- ligand such as the target of the antibody or a fragment thereof
- the reaction is characterized by the on-rate constant kon and the off-rate constant koff, which have units of M ⁇ 1 s ⁇ 1 and s ⁇ 1 , respectively.
- the term “tip” or “conformational tip domain” of a polypeptide refers to a polypeptide that comprises a primary amino acid sequence wherein the structure has an anti-parallel beta ribbon with a sharp turn that is typically mediated by a proline residue.
- a “tip chimer” of a polypeptide intends a polypeptide comprising two tips of one or more polypeptides. The tip chimer may comprise two tips of the same polypeptide or a tip from two different polypeptides.
- a tip chimer of a DNABII polypeptide intends a DNABII polypeptide that, using IHFalpha and IHFbeta as examples, forms the two arms of the proteins.
- Non-limiting examples of such include the tip fragment of IhfA, which is also referred to herein as A tip fragment: NFELRDKSSRPGRNPKTGDVV, SEQ ID NO: , and IhfB modified B4which is also referred to herein as mB4 tip fragment: SLHHRQPRLGRNPKTGDSVNL (SEQ ID NO: ) or FSLHHRQPRLGRNPKTGDSV, SEQ ID NO: , or 2 IhfA tip fragments, or 2 IhfB modified B4 tip fragments. Additional examples are disclosed in PCT Publ. No. WO 2018/129078, incorporated herein by reference.
- the tip-chimeric peptide comprises the peptide designated IhfA5-mIhfB4NTHI herein that comprises, or consists essentially of, or yet further consists of: a polypeptide sequence of RPGRNPX 1 TGDVVPVSARRVV-X- FSLHHRQPRLGRNPX 1 TGDSV (SEQ ID NO. ), wherein “X” is an optional amino acid linker sequence, optionally comprising, or consisting essentially of, or yet further consisting of between 1 to 20 amino acids; and wherein “X1” is any amino acid or alternatively “X1” is selected from the amino acids Q, R, K, S, or T.
- “Xi” is a K or Q.
- the tip-chimeric peptide IhfA5-mIhfB4NTHi comprises, or consists essentially of, or yet further consists of: a polypeptide sequence of RPGRNPKTGDVVPVSARRVV-X-FSLHHRQPRLGRNPKTGDSV (SEQ ID NO: ), wherein “X” is an optional amino acid linker sequence optionally comprising, or consisting essentially of, or yet further consisting of between 1 to 20 amino acids.
- the tip-chimeric peptide IhfA5-mIhfB4NTHi comprises or consists essentially of, or yet further consists of: a polypeptide sequence of
- RPGRNPKTGDVVPVSARRVVGPSLFSLHHRQPRLGRNPKTGDSV (SEQ ID NO: ), in some embodiments, which is referred to herein as the tip chimer), wherein GPSL serves as the amino acid linker sequence.
- a “tail fragment” of a DNABII polypeptide intends a region of the protein that is both exposed to the bulk medium and not occluded by DNA or other polypeptides.
- An immunodominant antigen intends a region of the protein that is recognized and binds with high affinity to an antibody.
- an “antibody” includes whole antibodies and any antigen-binding fragment or a single chain thereof, variant, or derivative thereof.
- the term “antibody” includes any protein or peptide containing molecule that comprises at least a portion of an immunoglobulin molecule. Examples of such include, but are not limited to a complementarity determining region (CDR) of a heavy or light chain or a ligand binding portion thereof, a heavy chain or light chain variable region, a heavy chain or light chain constant region, a framework (FR) region, or any portion thereof, or at least one portion of a binding protein, any of which can be incorporated into an antibody of the present disclosure.
- CDR complementarity determining region
- antibody is further intended to encompass digestion fragments, specified portions, derivatives and variants thereof, including antibody mimetics or comprising portions of antibodies that mimic the structure and/or function of an antibody or specified fragment or portion thereof, including single chain antibodies and fragments thereof.
- binding fragments encompassed within the term “antigen binding portion” of an antibody include a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH, domains; a F(ab’)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CH, domains; a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, a dAb fragment (Ward et al.
- V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv)).
- scFv single chain Fv
- Single chain antibodies are also intended to be encompassed within the term “fragment of an antibody” or “a biologically active fragment” of an antibody. Any of the above-noted antibody fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for binding specificity and neutralization activity in the same manner as are intact antibodies.
- antibody also include immunoglobulins of any isotype, fragments of antibodies which retain specific binding to antigen, including, but not limited to, Fab, Fab′, F(ab) 2 , Fv, scFv, dsFv, Fd fragments, dAb, VH, VL, VhH, and V-NAR domains; minibodies, diabodies, triabodies, tetrabodies and kappa bodies; multispecific antibody fragments formed from antibody fragments and one or more isolated.
- CDR complementarity determining region
- a heavy chain or light chain variable region which is also referred to herein as a variable domain
- a heavy chain or light chain constant region which is also referred to herein as a constant domain
- FR framework
- any portion of a binding protein chimeric antibodies, humanized antibodies, single-chain antibodies, and fusion proteins comprising an antigen-binding portion of an antibody and a non-antibody protein.
- the variable regions of the heavy and light chains of the immunoglobulin molecule contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues.
- anti-IHF refers to an antibody that binds to the IHF protein.
- the specific antibody may have affinity or bind to proteins other than the protein it was raised against.
- CDRs Complementarity determining regions
- B-cell s and T-cells are part of the variable region of an antibody or a T cell receptor generated by B-cell s and T-cells respectively, wherein these molecules bind to their specific antigen (also called epitope).
- specific antigen also called epitope
- the terms “variable region” and “variable domain” are used interchangeably, referring to the polypeptide of a light or heavy chain of an antibody that varies greatly in its sequence of amino acid residues from one antibody to another, and that determines the conformation of the combining site which confers the specificity of the antibody for a particular antigen.
- variable region is about 90 amino acids long to about 200 amino acids long, including but not limited to about 100 amino acids long, or alternatively about 110 amino acids long, or alternatively about 120 amino acids long, or alternatively about 130 amino acids long, or alternatively about 140 amino acids long, or alternatively about 150 amino acids long, or alternatively about 160 amino acids long, or alternatively about 170 amino acids long, or alternatively about 180 amino acids long, or alternatively about 190 amino acids long.
- variable region of an amino acid sequence refers to that the first about 100 amino acids, or alternatively about 110 amino acids, or alternatively about 120 amino acids, or alternatively about 130 amino acids, or alternatively about 140 amino acids, or alternatively about 150 amino acids of the amino acid sequence (including or excluding a signal peptide if applicable) is the variable region.
- a set of CDRs constitutes a paratope also called an antigen-binding site, which is a part of an antibody that recognizes and binds to an antigen.
- CDRn refers to a CDRn in an immunoglobulin chain or derived from an immunoglobulin chain, wherein the number n is selected from 1-3.
- CDRLn refers to a CDRn in a light chain or derived from a light chain, wherein the number n is selected from 1-3; while CDRHn refers to a CDRn in a heavy chain or derived from a heavy chain, wherein the number n is selected from 1-3.
- framework region (FR) refers to the part of a variable region which is not a CDR.
- FRn refers to a FR in a heavy chain or a light chain or derived from a heavy chain or a light chain, and wherein the number n is selected from 1-4.
- variable region comprises or consists essentially of, or yet further consists of the following (optionally following the order as provided, and further optionally from the amino terminus to the carboxyl terminus): FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
- Variable regions and/or CDRs of an antibody or a fragment thereof can be determined by one of skill in the art, for example, using publically or commercially available tools.
- Non- limiting examples of such tools include, IgBlast (accessible at www.ncbi.nlm.nih.gov/igblast/), Scaligner (available from drugdesigntech at www.scaligner.com/), IMGT rules and/or tools (see, for example, www.imgt.org/IMGTScientificChart/Nomenclature/IMGT-FRCDRdefinition.html, also accessible at www.imgt.org/), Chothia Canonical Assignment (accessible at www.bioinf.org.uk/abs/chothia.html), Antigen receptor Numbering And Receptor Classification (ANARCI, accessible at opig.stats.ox.ac.uk/webapps/newsabdab/sabpred/anarci/), the Kabat numbering method/scheme (e.g., Kabat, E.A., et al., (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S.
- the antibodies can be polyclonal, monoclonal, multispecific (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity.
- Antibodies can be isolated from any suitable biological source, e.g., murine, rat, sheep and canine.
- the term “antibody” includes biologically active fragments thereof, polyclonal, monoclonal, human, humanized, variant, derivatized, chimeric or other known modifications thereof.
- the terms “polyclonal antibody” or “polyclonal antibody composition” as used herein refer to a preparation of antibodies that are derived from different B-cell lines. They are a mixture of immunoglobulin molecules secreted against a specific antigen, each recognizing a different epitope.
- “monoclonal antibody” refers to an antibody obtained from a substantially homogeneous antibody population. Monoclonal antibodies are highly specific, as each monoclonal antibody is directed against a single determinant on the antigen.
- the antibodies may be detectably labeled, e.g., with a radioisotope, an enzyme which generates a detectable product, a fluorescent protein, and the like.
- the antibodies may be further conjugated to other moieties, such as members of specific binding pairs, e.g., biotin (member of biotin-avidin specific binding pair), and the like.
- the antibodies may also be bound to a solid support, including, but not limited to, polystyrene plates or beads, and the like.
- Monoclonal antibodies may be generated using hybridoma techniques or recombinant DNA methods known in the art.
- a hybridoma is a cell that is produced in the laboratory from the fusion of an antibody-producing lymphocyte and a non-antibody producing cancer cell, usually a myeloma or lymphoma.
- a hybridoma proliferates and produces a continuous sample of a specific monoclonal antibody.
- Alternative techniques for generating or selecting antibodies include in vitro exposure of lymphocytes to antigens of interest, and screening of antibody display libraries in cells, phage, or similar systems.
- human antibody as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
- the human antibodies disclosed herein may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- the term “human antibody” as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- human antibody refers to an antibody in which substantially every part of the protein (e.g., CDR, framework, CL, CH domains (e.g., CHI, CH2, Cm), hinge, (VL, VH)) is substantially non-immunogenic in humans, with only minor sequence changes or variations.
- antibodies designated primate monkey, baboon, chimpanzee, etc.
- rodent mouse, rat, rabbit, guinea pig, hamster, and the like
- other mammals designate such species, sub-genus, genus, sub-family, family specific antibodies.
- chimeric antibodies include any combination of the above.
- a human antibody is distinct from a chimeric or humanized antibody. It is pointed out that a human antibody can be produced by a non- human animal or prokaryotic or eukaryotic cell that is capable of expressing functionally rearranged human immunoglobulin (e.g., heavy chain and/or light chain) genes. Further, when a human antibody is a single chain antibody, it can comprise a linker peptide that is not found in native human antibodies.
- an Fv can comprise a linker peptide, such as two to about eight glycine or other amino acid residues, which connects the variable region of the heavy chain and the variable region of the light chain.
- linker peptides are considered to be of human origin.
- a human antibody is “derived from” a particular germline sequence if the antibody is obtained from a system using human immunoglobulin sequences, e.g., by immunizing a transgenic mouse carrying human immunoglobulin genes or by screening a human immunoglobulin gene library.
- a human antibody that is “derived from” a human germline immunoglobulin sequence can be identified as such by comparing the amino acid sequence of the human antibody to the amino acid sequence of human germline immunoglobulins.
- a selected human antibody typically is at least 90% identical in amino acids sequence to an amino acid sequence encoded by a human germline immunoglobulin gene and contains amino acid residues that identify the human antibody as being human when compared to the germline immunoglobulin amino acid sequences of other species (e.g., murine germline sequences).
- a human antibody may be at least 95%, or even at least 96%, 97%, 98%, or 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene.
- a human antibody derived from a particular human germline sequence will display no more than 10 amino acid differences from the amino acid sequence encoded by the human germline immunoglobulin gene. In certain cases, the human antibody may display no more than 5, or even no more than 4, 3, 2, or 1 amino acid difference from the amino acid sequence encoded by the germline immunoglobulin gene.
- the term “humanized antibody” or “humanized immunoglobulin” refers to a human/non-human chimeric antibody that contains a minimal sequence derived from non-human immunoglobulin.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a variable region or a fragment thereof (for example, 1, 2, 3, 4, 5, or all 6 CDRs) of the recipient are replaced by residues from a variable region or a fragment thereof (for example, 1, 2, 3, 4, 5, or all 6 CDRs) of a non-human species (donor antibody) such as mouse, rat, rabbit, or non-human primate having the desired specificity, affinity and capacity.
- donor antibody such as mouse, rat, rabbit, or non-human primate having the desired specificity, affinity and capacity.
- Humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody.
- the humanized antibody can optionally also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin, a non-human antibody containing one or more amino acids in a framework region, a constant region or a CDR, that have been substituted with a correspondingly positioned amino acid from a human antibody.
- Fc immunoglobulin constant region
- humanized antibodies produce a reduced immune response in a human host, as compared to a non-humanized version of the same antibody.
- the humanized antibodies may have conservative amino acid substitutions which have substantially no effect on antigen binding or other antibody functions.
- Conservative substitutions groupings include: glycine-alanine, valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine- valine, serine-threonine and asparagine-glutamine.
- the humanized antibodies as disclosed herein specifically binds to a DNABII polypeptide or a fragment thereof (such as the tip chimeric peptide or the tail chimeric peptide) with certain range(s) of one or more of the following: EC50, Kon, Koff, KA and/or KD, and inhibits or releases certain cytokine(s) upon treating a subject.
- the humanized antibody specifically binding to the tip region of a DNABII polypeptide disrupts biofilm both in vivo and in vitro.
- the process of humanization while a rational design process, may produce unexpected changes (positive or negative) in e.g. binding affinity, antigen specificity, or physical properties such as solubility or aggregability; hence, properties of humanized antibodies are not inherently predictable from the properties of the starting non-human antibody.
- an antibody as used herein may be a recombinant antibody.
- recombinant antibody includes all antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for immunoglobulin genes or a hybridoma prepared therefrom, antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, antibodies isolated from a recombinant, combinatorial antibody library, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of immunoglobulin (Ig) gene sequences to other DNA sequences.
- an animal e.g., a mouse
- transgenic or transchromosomal for immunoglobulin genes or a hybridoma prepared therefrom antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma
- antibodies isolated from a recombinant e.g., combinatorial antibody library
- an antibody as used herein may be a chimeric antibody.
- chimeric antibodies are antibodies whose light and heavy chain genes have been constructed, typically by genetic engineering, from antibody variable and constant region genes belonging to different species.
- An antibody as used herein may be an “antibody derivative”.
- an antibody derivative comprises a full-length antibody or a fragment of an antibody, wherein one or more of the amino acids are chemically modified by alkylation, pegylation, acylation, ester formation or amide formation or the like, e.g., for linking the antibody to a second molecule.
- the term “antibody derivative” is intended to encompass molecules that bind an epitope as defined above and which are modifications or derivatives of a native monoclonal antibody of this disclosure.
- Derivatives include, but are not limited to, for example, bispecific, multispecific, heterospecific, trispecific, tetraspecific, multispecific antibodies, diabodies, chimeric, recombinant and humanized.
- An antibody as used herein may be an “antibody variant”, which intends to include antibodies produced in a species other than a mouse. It also includes antibodies containing post-translational modifications to the linear polypeptide sequence of the antibody or fragment. It further encompasses fully human antibodies.
- the terms “antigen” and “antigenic” refer to molecules with the capacity to be recognized by an antibody or otherwise act as a member of an antibody-ligand pair.
- Specific binding refers to the interaction of an antigen with the variable regions of immunoglobulin heavy and light chains. Antibody-antigen binding may occur in vivo or in vitro.
- macromolecules including proteins, nucleic acids, fatty acids, lipids, lipopolysaccharides and polysaccharides have the potential to act as an antigen.
- nucleic acids encoding a protein with the potential to act as an antibody ligand necessarily encode an antigen.
- antigens are not limited to full-length molecules, but can also include partial molecules.
- antigenic is an adjectival reference to molecules having the properties of an antigen.
- the term encompasses substances which are immunogenic, i.e., immunogens, as well as substances which induce immunological unresponsiveness, or anergy, i.e., anergens.
- the term “specifically binding,” refers to the interaction between binding pairs (e.g., an antibody and an antigen, or a receptor and a ligand). In various instances, specifically binding can be embodied by an affinity constant of about 10 ⁇ 6 moles/liter, about 10 ⁇ 7 moles/liter, or about 10 ⁇ 8 moles/liter, or less.
- An immunodominant antigen intends a region of the protein that is recognized and binds with high affinity to an antibody.
- an immunoprotective antigen intends a region of the protein that is recognized and binds with high affinity to an antibody to interfere with protein function; the antibodies generated against an immunoprotective antigen are characterized by enhanced or optimal effect against a target indication as a result to the interference with protein function – in some embodiments, an improve capability to clear biofilms.
- An “altered antigen” is one having a primary sequence that is different from that of the corresponding wild-type antigen.
- Altered antigens can be made by synthetic or recombinant methods and include, but are not limited to, antigenic peptides that are differentially modified during or after translation, e.g., by phosphorylation, glycosylation, cross-linking, acylation, proteolytic cleavage, linkage to an antibody molecule, membrane molecule or other ligand. See, e.g., Ferguson et al. (1988) Ann. Rev. Biochem.57:285-320. A synthetic or altered antigen disclosed herein is intended to bind to the same CDR sets and/or TCR as the natural epitope. [0098] “Immune response” broadly refers to the antigen-specific responses of lymphocytes to foreign substances.
- immunogen and “immunogenic” refer to molecules with the capacity to elicit an immune response. All immunogens are antigens, however, not all antigens are immunogenic. An immune response disclosed herein can be humoral (via antibody activity) or cell-mediated (via T cell activation). The response may occur in vivo or in vitro.
- An immune response disclosed herein can be humoral (via antibody activity) or cell-mediated (via T cell activation). The response may occur in vivo or in vitro.
- macromolecules including proteins, nucleic acids, fatty acids, lipids, lipopolysaccharides and polysaccharides have the potential to be immunogenic.
- nucleic acids encoding a molecule capable of eliciting an immune response necessarily encode an immunogen.
- immunogens are not limited to full- length molecules, but may include partial molecules.
- Passive immunity refers to the transfer of immunity from one subject to another through the transfer of antibodies. Passive immunity may occur naturally, as when maternal antibodies are transferred to a fetus. Passive immunity may also occur artificially as when antibody compositions are administered to non-immune subjects. Antibody donors and recipients may be human or non-human subjects. Antibodies may be polyclonal or monoclonal, may be generated in vitro or in vivo, and may be purified, partially purified, or unpurified depending on the embodiment. In some embodiments described herein, passive immunity is conferred on a subject in need thereof through the administration of antibodies or antigen binding fragments that specifically recognize or bind to a particular antigen. In some embodiments, passive immunity is conferred through the administration of an isolated or recombinant polynucleotide encoding an antibody or antigen binding fragment that specifically recognizes or binds to a particular antigen.
- the term “propagate” means to grow a cell or population of cells.
- the term “growing” also refers to the proliferation of cells in the presence of supporting media, nutrients, growth factors, support cells, or any chemical or biological compound necessary for obtaining the desired number of cells or cell type.
- the term “culturing” refers to the in vitro propagation of cells or organisms on or in media of various kinds. It is understood that the descendants of a cell grown in culture may not be completely identical (i.e., morphologically, genetically, or phenotypically) to the parent cell.
- a “cell” or “host cell” refers not only to the particular subject cell but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
- the cell is a eukaryotic cell.
- the cell is a prokaryotic cell.
- a population of cells intends a collection of more than one cell that is identical (clonal) or non-identical in phenotype and/or genotype. The population can be purified, highly purified, substantially homogenous or heterogeneous as described herein.
- a “gene delivery vehicle” is defined as any molecule that can carry inserted polynucleotides into a host cell.
- gene delivery vehicles are liposomes, micelles biocompatible polymers, including natural polymers and synthetic polymers; lipoproteins; polypeptides; polysaccharides; lipopolysaccharides; artificial viral envelopes; metal particles; and bacteria, or viruses, such as baculovirus, adenovirus and retrovirus, bacteriophage, cosmid, plasmid, fungal vectors and other recombination vehicles typically used in the art which have been described for expression in a variety of eukaryotic and prokaryotic hosts, and may be used for gene therapy as well as for simple protein expression.
- a polynucleotide disclosed herein can be delivered to a cell or tissue or a subject using a gene delivery vehicle.
- Gene delivery are terms referring to the introduction of an exogenous polynucleotide (sometimes referred to as a “transgene”) into a host cell, irrespective of the method used for the introduction.
- exogenous polynucleotide sometimes referred to as a “transgene”
- transgene an exogenous polynucleotide
- Such methods include a variety of well-known techniques such as vector- mediated gene transfer (by, e.g., viral infection/transfection, or various other protein-based or lipid-based gene delivery complexes) as well as techniques facilitating the delivery of “naked” polynucleotides (such as electroporation, “gene gun” delivery and various other techniques used for the introduction of polynucleotides).
- the introduced polynucleotide may be stably or transiently maintained in the host cell. Stable maintenance typically requires that the introduced polynucleotide either contains an origin of replication compatible with the host cell or integrates into a replicon of the host cell such as an extrachromosomal replicon (e.g., a plasmid) or a nuclear or mitochondrial chromosome.
- an extrachromosomal replicon e.g., a plasmid
- a number of vectors are known to be capable of mediating transfer of genes to mammalian cells, as is known in the art and described herein.
- a “plasmid” is an extra-chromosomal DNA molecule separate from the chromosomal DNA which is capable of replicating independently of the chromosomal DNA.
- Plasmids provide a mechanism for horizontal gene transfer within a population of microbes and typically provide a selective advantage under a given environmental state. Plasmids may carry genes that provide resistance to naturally occurring antibiotics in a competitive environmental niche, or alternatively the proteins produced may act as toxins under similar circumstances. [0107] “Plasmids” used in genetic engineering are called “plasmid vectors”. Many plasmids are commercially available for such uses.
- the gene to be replicated is inserted into copies of a plasmid containing genes that make cells resistant to particular antibiotics and a multiple cloning site (MCS, or polylinker), which is a short region containing several commonly used restriction sites allowing the easy insertion of DNA fragments at this location.
- MCS multiple cloning site
- Another major use of plasmids is to make large amounts of proteins. In this case, researchers grow bacteria containing a plasmid harboring the gene of interest. Just as the bacterium produces proteins to confer its antibiotic resistance, it can also be induced to produce large amounts of proteins from the inserted gene. This is a cheap and easy way of mass-producing a gene or the protein it then codes for.
- a “yeast artificial chromosome” or “YAC” refers to a vector used to clone large DNA fragments (larger than 100 kb and up to 3000 kb). It is an artificially constructed chromosome and contains the telomeric, centromeric, and replication origin sequences needed for replication and preservation in yeast cells. Built using an initial circular plasmid, they are linearized by using restriction enzymes, and then DNA ligase can add a sequence or gene of interest within the linear molecule by the use of cohesive ends.
- Yeast expression vectors such as YACs, YIps (yeast integrating plasmid), and YEps (yeast episomal plasmid), are extremely useful as one can get eukaryotic protein products with posttranslational modifications as yeasts are themselves eukaryotic cells, however YACs have been found to be more unstable than BACs, producing chimeric effects.
- a “viral vector” is defined as a recombinantly produced virus or viral particle that comprises a polynucleotide to be delivered into a host cell, either in vivo, ex vivo or in vitro.
- viral vectors examples include retroviral vectors, lentiviral vectors, adenovirus vectors, adeno-associated virus vectors, alphavirus vectors and the like.
- Infectious tobacco mosaic virus (TMV)-based vectors can be used to manufacturer proteins and have been reported to express Griffithsin in tobacco leaves (O'Keefe et al. (2009) Proc. Nat. Acad. Sci. USA 106(15):6099-6104).
- Alphavirus vectors such as Semliki Forest virus-based vectors and Sindbis virus-based vectors, have also been developed for use in gene therapy and immunotherapy. See, Schlesinger & Dubensky (1999) Curr. Opin. Biotechnol.
- a vector construct refers to the polynucleotide comprising the retroviral genome or part thereof, and a therapeutic gene.
- retroviral mediated gene transfer or “retroviral transduction” carries the same meaning and refers to the process by which a gene or nucleic acid sequences are stably transferred into the host cell by virtue of the virus entering the cell and integrating its genome into the host cell genome.
- the virus can enter the host cell via its normal mechanism of infection or be modified such that it binds to a different host cell surface receptor or ligand to enter the cell.
- retroviral vector refers to a viral particle capable of introducing exogenous nucleic acid into a cell through a viral or viral-like entry mechanism.
- Retroviruses carry their genetic information in the form of RNA; however, once the virus infects a cell, the RNA is reverse-transcribed into the DNA form which integrates into the genomic DNA of the infected cell.
- the integrated DNA form is called a provirus.
- a vector construct refers to the polynucleotide comprising the viral genome or part thereof, and a transgene.
- Ads adenoviruses
- Ads are a relatively well characterized, homogenous group of viruses, including over 50 serotypes. See, e.g., PCT International Application Publication No. WO 95/27071. Ads do not require integration into the host cell genome. Recombinant Ad derived vectors, particularly those that reduce the potential for recombination and generation of wild-type virus, have also been constructed. See, PCT International Application Publication Nos.
- WO 95/00655 and WO 95/11984 Wild-type AAV has high infectivity and specificity integrating into the host cell's genome. See, Hermonat & Muzyczka (1984) Proc. Natl. Acad. Sci. USA 81:6466-6470 and Lebkowski et al. (1988) Mol. Cell. Biol.8:3988-3996. [0113] Vectors that contain both a promoter and a cloning site into which a polynucleotide can be operatively linked are well known in the art.
- Gene delivery vehicles also include DNA/liposome complexes, micelles and targeted viral protein-DNA complexes.
- Liposomes that also comprise a targeting antibody or fragment thereof can be used in the methods disclosed herein.
- direct introduction of the proteins described herein to the cell or cell population can be done by the non-limiting technique of protein transfection, alternatively culturing conditions that can enhance the expression and/or promote the activity of the proteins disclosed herein are other non-limiting techniques [0115]
- a vector construct refers to the polynucleotide comprising the lentiviral genome or part thereof, and a therapeutic gene.
- lentiviral mediated gene transfer or “lentiviral transduction” carries the same meaning and refers to the process by which a gene or nucleic acid sequences are stably transferred into the host cell by virtue of the virus entering the cell and integrating its genome into the host cell genome.
- the virus can enter the host cell via its normal mechanism of infection or be modified such that it binds to a different host cell surface receptor or ligand to enter the cell.
- Retroviruses carry their genetic information in the form of RNA; however, once the virus infects a cell, the RNA is reverse-transcribed into the DNA form which integrates into the genomic DNA of the infected cell.
- the integrated DNA form is called a provirus.
- lentiviral vector refers to a viral particle capable of introducing exogenous nucleic acid into a cell through a viral or viral-like entry mechanism. advantages in transducing nondividing cells as compared to other retroviral vectors. See, Trono D. (2002) Lentiviral vectors, New York: Spring-Verlag Berlin Heidelberg. [0116] Lentiviral vectors of this disclosure are based on or derived from oncoretroviruses (the sub-group of retroviruses containing MLV), and lentiviruses (the sub-group of retroviruses containing HIV). Examples include ASLV, SNV and RSV all of which have been split into packaging and vector components for lentiviral vector particle production systems.
- the lentiviral vector particle according to the disclosure may be based on a genetically or otherwise (e.g. by specific choice of packaging cell system) altered version of a particular retrovirus.
- That the vector particle according to the disclosure is "based on" a particular retrovirus means that the vector is derived from that particular retrovirus.
- the genome of the vector particle comprises components from that retrovirus as a backbone.
- the vector particle contains essential vector components compatible with the RNA genome, including reverse transcription and integration systems. Usually these will include gag and pol proteins derived from the particular retrovirus. Thus, the majority of the structural components of the vector particle will normally be derived from that retrovirus, although they may have been altered genetically or otherwise so as to provide desired useful properties.
- AAV adeno-associated virus
- AAV adeno-associated virus
- the vector host range and cell types infected or transduced can be altered by using different env genes in the vector particle production system to give the vector particle a different specificity.
- AAV adeno-associated virus
- the term “adeno-associated virus” or “AAV” as used herein refers to a member of the class of viruses associated with this name and belonging to the genus dependoparvovirus, family Parvoviridae. Multiple serotypes of this virus are known to be suitable for gene delivery; all known serotypes can infect cells from various tissue types. At least 11 sequentially numbered, AAV serotypes are known in the art.
- Non-limiting exemplary serotypes useful in the methods disclosed herein include any of the 11 serotypes, e.g., AAV2, AAV8, AAV9, or variant or synthetic serotypes, e.g., AAV-DJ and AAV PHP.B.
- the AAV particle comprises, alternatively consists essentially of, or yet further consists of three major viral proteins: VP1, VP2 and VP3.
- the AAV refers to of the serotype AAV1 AAV2 AAV4 AAV5 AAV6 AAV7 AAV8 AAV9 AAV10 AAV11 AAV12 AAV13, AAV PHP.B, or AAV rh74. These vectors are commercially available or have been described in the patent or technical literature.
- Detectable label “label”, “detectable marker” or “marker” are used interchangeably, including, but not limited to radioisotopes, fluorochromes, chemiluminescent compounds, dyes, and proteins, including enzymes. Detectable labels can also be attached to a polynucleotide, polypeptide, antibody or composition described herein.
- label or a detectable label intends a directly or indirectly detectable compound or composition that is conjugated directly or indirectly to the composition to be detected, e.g., N-terminal histidine tags (N-His), magnetically active isotopes, e.g., 115 Sn, 117 Sn and 119 Sn, a non-radioactive isotopes such as 13 C and 15 N, polynucleotide or protein such as an antibody so as to generate a “labeled” composition.
- N-terminal histidine tags N-His
- magnetically active isotopes e.g., 115 Sn, 117 Sn and 119 Sn
- a non-radioactive isotopes such as 13 C and 15 N
- polynucleotide or protein such as an antibody so as to generate a “labeled” composition.
- the term also includes sequences conjugated to the polynucleotide that will provide a signal upon expression of the inserted sequence
- the label may be detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
- the labels can be suitable for small scale detection or more suitable for high-throughput screening.
- suitable labels include, but are not limited to magnetically active isotopes, non-radioactive isotopes, radioisotopes, fluorochromes, chemiluminescent compounds, dyes, and proteins, including enzymes.
- the label may be simply detected or it may be quantified.
- a response that is simply detected generally comprises a response whose existence merely is confirmed
- a response that is quantified generally comprises a response having a quantifiable (e.g., numerically reportable) value such as an intensity, polarization, and/or other property.
- the detectable response may be generated directly using a luminophore or fluorophore associated with an assay component actually involved in binding, or indirectly using a luminophore or fluorophore associated with another (e.g., reporter or indicator) component.
- luminescent labels that produce signals include, but are not limited to bioluminescence and chemiluminescence.
- Detectable luminescence response generally comprises a change in, or an occurrence of a luminescence signal.
- Suitable methods and luminophores for luminescently labeling assay components are known in the art and described for example in Haugland, Richard P. (1996) Handbook of Fluorescent Probes and Research Chemicals (6th ed).
- Examples of luminescent probes include, but are not limited to, aequorin and luciferases.
- the term “immunoconjugate” comprises an antibody or an antibody derivative associated with or linked to a second agent, such as a cytotoxic agent, a detectable agent, a radioactive agent, a targeting agent, a human antibody, a humanized antibody, a chimeric antibody, a synthetic antibody, a semisynthetic antibody, or a multispecific antibody.
- a second agent such as a cytotoxic agent, a detectable agent, a radioactive agent, a targeting agent, a human antibody, a humanized antibody, a chimeric antibody, a synthetic antibody, a semisynthetic antibody, or a multispecific antibody.
- suitable fluorescent labels include, but are not limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malacite green, stilbene, Lucifer Yellow, Cascade BlueTM, and Texas Red.
- the fluorescent label is functionalized to facilitate covalent attachment to a cellular component present in or on the surface of the cell or tissue such as a cell surface marker.
- Suitable functional groups include, but are not limited to, isothiocyanate groups, amino groups, haloacetyl groups, maleimides, succinimidyl esters, and sulfonyl halides, all of which may be used to attach the fluorescent label to a second molecule.
- a purification label or maker refers to a label that may be used in purifying the molecule or component that the label is conjugated to, such as an epitope tag (including but not limited to a Myc tag, a human influenza hemagglutinin (HA) tag, a FLAG tag), an affinity tag (including but not limited to a glutathione-S transferase (GST), a poly- Histidine (His) tag, Calmodulin Binding Protein (CBP), or Maltose-binding protein (MBP)), or a fluorescent tag.
- an epitope tag including but not limited to a Myc tag, a human influenza hemagglutinin (HA) tag, a FLAG tag
- an affinity tag including but not limited to a glutathione-S transferase (GST), a poly- Histidine (His) tag, Calmodulin Binding Protein (CBP), or Maltose-binding protein (MBP)
- fluorescent tag including but not limited to
- a “ligand” is a polypeptide.
- the term “ligand” as used herein refers to any molecule that binds to a specific site on another molecule.
- the ligand confers the specificity of the protein in a reaction with an immune effector cell or an antibody to a protein or DNA to a protein.
- it is the ligand site within the protein that combines directly with the complementary binding site on the immune effector cell.
- the terms “treating,” “treatment” and the like are used herein to mean obtaining a beneficial or desired pharmacologic and/or physiologic effect, and/or desired results, including clinical results.
- the effect and/or results can be prophylactic in terms of one or more of: completely or partially preventing a disorder or sign or symptom thereof, and/or can be therapeutic in terms of a partial or complete cure for a disorder and/or adverse effect attributable to the disorder, and/or alleviation or amelioration of one or more symptoms, diminishment of extent of a condition (including a disease), stabilized (i.e., not worsening) state of a condition (including disease), delay or slowing of condition (including disease), progression, amelioration or palliation of the condition (including disease), states and remission (whether partial or total), whether detectable or undetectable.
- treatment examples include but are not limited to: preventing a disorder from occurring in a subject that may be predisposed to a disorder, but has not yet been diagnosed as having it; inhibiting a disorder, i.e., arresting its development; and/or relieving or ameliorating the symptoms of disorder.
- treatment is the arrestment of the development of symptoms of the disease or disorder.
- they refer to (1) preventing the symptoms or disease from occurring in a subject that is predisposed or does not yet display symptoms of the disease; (2) inhibiting the disease or arresting its development; or (3) ameliorating or causing regression of the disease or the symptoms of the disease.
- treatment excludes prophylaxis or prevention.
- another beneficial or desired pharmacologic and/or physiologic effect achieved by the treatment may comprise, or consist essentially of, or yet further consist of one or more of the following: reducing dose of an antibiotic compared to a treatment using the antibiotic only, shorter course of using an antibiotic compared to a treatment using the antibiotic only, less frequent of using an antibiotic compared to a treatment using the antibiotic only, or less side effects (such as a milder side effect, free of the side effect, or less frequency of suffering from a side effect, shorter duration of suffering from a side effect) due to use of an antibiotic compared to a treatment using the antibiotic only.
- Such side effects may comprise, or consist essentially of, or yet further consist of one or more of: skin rashes, diarrhea and life-long disruption of the gut microbiome.
- To prevent intends to prevent a disease or disorder or effect in vitro or in vivo in a system or subject that is predisposed to the disorder or effect.
- An example of such is preventing the formation of a biofilm in a system that is infected with a microorganism known to produce one.
- “treating a biofilm” or a grammatical variation thereof refers to breaking down the biofilm (such as via dispersal and/or disruption). Additionally or alternatively, “treating a biofilm” may also refer to reduction and/or elimination of microbial load (e.g., shown as numbers and/or concentrations) of a microbe forming the biofilm. In some embodiments, the microbial load is calculated based on microbes in any one or two or all three of the following forms: planktonic, biofilm or newly released. In some embodiments, the microbial load is calculated only based on microbes in the biofilm.
- the term “disease” or “disorder” as used herein refers to a disease such as those caused by and/or related to a polymicrobial biofilm, a status of being diagnosed with such disease, a status of being suspect of having such disease, or a status of at high risk of having such disease.
- the disease is selected from: pneumonia, sinusitis, septicemia, endocarditis, epiglottitis, Septic arthritis, meningitis, postpartum and neonatal infections, postpartum and neonatal sepsis, acute and chronic salpingitis, pericardis, cellulitis, osteomyelitis, endocarditis, cholecystitis, intraabdominal infections, urinary tract infection, mastoiditis, aortic graft infection, conjunctitivitis, Brazilian pur puric fever, occult bacteremia and exacerbation of underlying lung diseases such as chronic bronchitis, bronchietasis and cystic fibrosis.
- the disease is selected from: cystic fibrosis (CF), lung CF, chronic obstructive pulmonary disease (COPD), chronic rhinosinusitis (CRS), periodontitis, periimplantitis, middle ear infection, otitis media, (OM), acute otitis media (AOM), otitis media with effusion (OME), post-tympanostomy tube otorrhea (PTTO), ventilator-associated pneumonia (VAP), community-acquired pneumonia (CAP), chest tube/catheter/indwelling device biofilm infections, tonsillitis, pharyngitis, laryngitis, epiglottitis, sinusitis, pneumonia, bronchitis, or other respiratory tract infection (RTI).
- CF cystic fibrosis
- COPD chronic obstructive pulmonary disease
- CRS chronic rhinosinusitis
- periodontitis periimplantitis
- middle ear infection otitis media
- OM middle
- the disease is any pathological condition involving H. influenzae (typeable and nontypeable strains) such as OM, pneumonia, sinusitis, septicemia, endocarditis, epiglottitis, septic arthritis, meningitis, postpartum and neonatal infections, postpartum and neonatal sepsis, acute and chromic salpingitis, epiglottis, pericardis, cellulitis, osteomyelitis, endocarditis, cholecystitis, intraabdominal infections, urinary tract infection, mastoiditis, aortic graft infection, conjunctitivitis, Brazilian purpuric fever, occult bacteremia, chronic obstructive pulmonary disease and exacerbation of underlying lung diseases such as chronic bronchitis, bronchietasis and cystic fibrosis.
- H. influenzae typeable and nontypeable strains
- the disease is any disorder of a subject caused directly or indirectly by a bacterium biofilm as disclosed herein, such as NTHI.
- the biofilm is a polymicrobial biofilm.
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- “Administration” or “delivery” of an antibody, vaccine, peptide, cell or vector or other agent and compositions containing same can be effected in one dose, continuously or intermittently throughout the course of treatment.
- Methods of determining the most effective means and dosage of administration are known to those of skill in the art and will vary with the composition used for therapy, the purpose of the therapy, the target infection or biofilm being treated, and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician or in the case of animals, by the treating veterinarian. Suitable dosage formulations and methods of administering the agents are known in the art. Route of administration can also be determined and method of determining the most effective route of administration are known to those of skill in the art and will vary with the composition used for treatment, the purpose of the treatment, the health condition or disease stage of the subject being treated, and target cell or tissue.
- Non-limiting examples of route of administration include oral administration, intraperitoneal, infusion, nasal administration, inhalation, injection, and topical application.
- administration shall include without limitation, administration by oral, parenteral (e.g., intramuscular, intraperitoneal, intravenous, intracerebroventricular (ICV), intrathecal, intracisternal injection or infusion, subcutaneous injection, or implant), by inhalation spray nasal, vaginal, rectal, sublingual, urethral (e.g., urethral suppository) or topical routes of administration (e.g., gel, ointment, cream, aerosol, etc.) and can be formulated, alone or together, in suitable dosage unit formulations containing conventional non-toxic pharmaceutically acceptable carriers, adjuvants, excipients, and vehicles appropriate for each route of administration.
- parenteral e.g., intramuscular, intraperitoneal, intravenous, intracerebroventricular (ICV), intrathecal, intracisternal injection or infusion
- administering can be effected in one dose, continuously or intermittently throughout the course of treatment. Methods of determining the most effective means and dosage of administration are known to those of skill in the art and will vary with the composition used for therapy, the purpose of the therapy, the target cell being treated, and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician. Suitable dosage formulations and methods of administering the agents are known in the art.
- An agent of the present disclosure can be administered for therapy by any suitable route of administration. It will also be appreciated that the optimal route will vary with the condition and age of the recipient, and the disease being treated.
- contacting means direct or indirect binding or interaction between two or more molecules.
- a particular example of direct interaction is binding.
- a particular example of an indirect interaction is where one entity acts upon an intermediary molecule, which in turn acts upon the second referenced entity.
- Contacting as used herein includes in solution, in solid phase, in vitro, ex vivo, in a cell and in vivo. Contacting in vivo can be referred to as administering, or administration.
- composition is intended to mean a combination of active agent and another compound or composition, inert (for example, a detectable agent or label) or active, such as an adjuvant, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like and include pharmaceutically acceptable carriers.
- inert for example, a detectable agent or label
- active such as an adjuvant, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like and include pharmaceutically acceptable carriers.
- Carriers also include pharmaceutical excipients and additives proteins, peptides, amino acids, lipids, and carbohydrates (e.g., sugars, including monosaccharides, di-, tri, tetra-oligosaccharides, and oligosaccharides; derivatized sugars such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in combination 1-99.99% by weight or volume.
- Exemplary protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, and the like.
- amino acid/antibody components which can also function in a buffering capacity, include alanine, arginine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like.
- Carbohydrate excipients are also intended within the scope of this technology, examples of which include but are not limited to monosaccharides such as fructose, maltose, galactose, glucose, D- mannose, sorbose, and the like; disaccharides, such as lactose, sucrose, trehalose, cellobiose, and the like; polysaccharides, such as raffinose, melezitose, maltodextrins, dextrans, starches, and the like; and alditols, such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol) and myoinositol.
- monosaccharides such as fructose, maltose, galactose, glucose, D- mannose, sorbose, and the like
- disaccharides such as lactose, sucrose
- a “pharmaceutical composition” is intended to include the combination of an active polypeptide, polynucleotide or antibody with a carrier, inert or active such as a solid support, making the composition suitable for diagnostic or therapeutic use in vitro, in vivo or ex vivo.
- a pharmaceutical carrier encompasses any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, and emulsions, such as an oil/water or water/oil emulsion, and various types of wetting agents.
- the compositions also can include stabilizers and preservatives.
- “pharmaceutically acceptable carriers” refer to any diluents, excipients, or carriers that may be used in the compositions disclosed herein.
- Pharmaceutically acceptable carriers include ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances, such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene- polyoxypropylene-block polymers, polyethylene glycol and wool fat.
- buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen
- Suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences, Mack Publishing Company, a standard reference text in this field. They may be selected with respect to the intended form of administration, that is, oral tablets, capsules, elixirs, syrups and the like, and consistent with conventional pharmaceutical practices.
- pharmaceutically acceptable carrier or medium
- compositions suitable for use in the present disclosure include liquids, semi-solid (e.g., gels) and solid materials (e.g., cell scaffolds and matrices, tubes sheets and other such materials as known in the art and described in greater detail herein).
- semi-solid and solid materials may be designed to resist degradation within the body (non-biodegradable) or they may be designed to degrade within the body (biodegradable, bioerodable).
- a biodegradable material may further be bioresorbable or bioabsorbable, i.e., it may be dissolved and absorbed into bodily fluids (water-soluble implants are one example), or degraded and ultimately eliminated from the body, either by conversion into other materials or breakdown and elimination through natural pathways.
- solid phase support or “solid support”, used interchangeably, is not limited to a specific type of support. Rather a large number of supports are available and are known to one of ordinary skill in the art.
- Solid phase supports include silica gels, resins, derivatized plastic films, glass beads, cotton, plastic beads, alumina gels.
- solid support also includes synthetic antigen-presenting matrices, cells, and liposomes. A suitable solid phase support may be selected on the basis of desired end use and suitability for various protocols.
- solid phase support may refer to resins such as polystyrene (e.g., PAM-resin obtained from Bachem Inc., Peninsula Laboratories, etc.), POLYHIPE® resin (obtained from Aminotech, Canada), polyamide resin (obtained from Peninsula Laboratories), polystyrene resin grafted with polyethylene glycol (TentaGel®, Rapp Polymere, Tubingen, Germany) or polydimethylacrylamide resin (obtained from Milligen/Biosearch, Calif.).
- polystyrene e.g., PAM-resin obtained from Bachem Inc., Peninsula Laboratories, etc.
- POLYHIPE® resin obtained from Aminotech, Canada
- polyamide resin obtained from Peninsula Laboratories
- polystyrene resin grafted with polyethylene glycol TeentaGel®, Rapp Polymere, Tubingen, Germany
- polydimethylacrylamide resin obtained from Milligen/Biosearch, Calif.
- An example of a solid phase support include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite.
- the nature of the carrier can be either soluble to some extent or insoluble.
- the support material may have virtually any possible structural configuration so long as the coupled molecule is capable of binding to a polynucleotide, polypeptide or antibody.
- the support configuration may be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod.
- the surface may be flat such as a sheet, test strip, etc. or alternatively polystyrene beads.
- compositions used in accordance with the disclosure can be packaged in dosage unit form for ease of administration and uniformity of dosage.
- unit dose or “dosage” refers to physically discrete units suitable for use in a subject, each unit containing a predetermined quantity of the composition calculated to produce the desired responses in association with its administration, i.e., the appropriate route and regimen.
- the quantity to be administered, both according to number of treatments and unit dose, depends on the result and/or protection desired. Precise amounts of the composition also depend on the judgment of the practitioner and are peculiar to each individual.
- Factors affecting dose include physical and clinical state of the subject, route of administration, intended goal of treatment (alleviation of symptoms versus cure), and potency, stability, and toxicity of the particular composition.
- solutions are administered in a manner compatible with the dosage formulation and in such amount as is therapeutically or prophylactically effective.
- the formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described herein.
- a “subject” (which is used herein interchangeably with “individual” or “patient”) of diagnosis or treatment is a cell or an animal such as a mammal, or a human.
- Non-human animals subject to diagnosis or treatment are those subject to infections or animal models, for example, simians, murines, such as, rats, mice, chinchilla, canine, such as dogs, leporids, such as rabbits, livestock, sport animals, and pets.
- the term “subject,” “host,” “individual,” and “patient” are as used interchangeably herein to refer to animals, typically mammalian animals.
- Non-limiting examples of mammals include humans, non-human primates (e.g., apes, gibbons, chimpanzees, orangutans, monkeys, macaques, and the like), domestic animals (e.g., dogs and cats), farm animals (e.g., horses, cows, goats, sheep, pigs) and experimental animals (e.g., mouse, rat, rabbit, guinea pig).
- a mammal is a human.
- a mammal can be any age or at any stage of development (e.g., an adult, a pediatric patient, an adolescent, teen, a pre-pubescent subject, child, infant, a fetus or a mammal in utero).
- a mammal can be male or female.
- a subject is a human.
- the subject is a pre-symptomatic subject.
- the subject has minimal clinical symptoms of the disease.
- the subject can be a male or a female, adult, an infant or a pediatric subject.
- the subject is an adult.
- the adult is an adult human, e.g., an adult human greater than 18 years of age.
- a biological sample, or a sample can be obtained from a subject, cell line or cultured cell or tissue.
- Exemplary samples include, but are not limited to, cell sample, tissue sample, liquid samples such as blood and other liquid samples of biological origin (including, but not limited to, ocular fluids (aqueous and vitreous humor), peripheral blood, sera, plasma, ascites, urine, cerebrospinal fluid (CSF), sputum, saliva, bone marrow, synovial fluid, aqueous humor, amniotic fluid, cerumen, breast milk, broncheoalveolar lavage fluid, semen, prostatic fluid, cowper’s fluid or pre-ejaculatory fluid, female ejaculate, sweat, tears, cyst fluid, pleural and peritoneal fluid, pericardial fluid, ascites, lymph, chyme, chyle, bile, interstitial fluid, menses, pus, sebum, vomit, vaginal secretions/flushing, synovial fluid, mucosal secretion, stool water, pancreatic juice, lavage fluids from sinus cavities, bronchopulmonary aspirates,
- the biological sample is suspect of having a biofilm.
- the biological sample comprise a biofilm.
- the sample is from a subject’s airway, such as mucus.
- An “effective amount” is an amount sufficient to effect beneficial or desired results.
- An effective amount can be administered in one or more administrations, applications or dosages. Such delivery is dependent on a number of variables including the time period for which the individual dosage unit is to be used, the bioavailability of the therapeutic agent, the route of administration, etc.
- the effective amount is the amount sufficient to result in a protective response against a pathogen. In other embodiments, the effective amount of an immunogenic composition is the amount sufficient to result in antibody generation against the antigen. In some embodiments, the effective amount is the amount required to confer passive immunity on a subject in need thereof. With respect to immunogenic compositions, in some embodiments the effective amount will depend on the intended use, the degree of immunogenicity of a particular antigenic compound, and the health/responsiveness of the subject's immune system, in addition to the factors described above. The skilled artisan will be able to determine appropriate amounts depending on these and other factors.
- An "immunogenic dose" of a composition is one that generates, after administration, a detectable humoral (antibody) and/or cellular (T cell) immune response in comparison to the immune response detectable before administration or in comparison to a standard immune response before administration.
- the immune response results from the methods may be protective and/or therapeutic.
- the antibody and/or T cell immune response protects the individual from a biofilm infection as disclosed herein, particularly infection of the middle ear and/or the nasopharynx or lower airway.
- Humoral immune response may be measured by many well known methods, such as Single Radial Immunodiffusion Assay (SRID), Enzyme Immunoassay (EIA) and Hemagglutination Inhibition Assay (HAI).
- SRID utilizes a layer of a gel, such as agarose, containing the immunogen being tested. A well is cut in the gel and the serum being tested is placed in the well.
- EIA Enzyme Linked Immunoassay
- ELISA Enzyme Linked Immunoassay
- IgG enzyme linked immunoglobulin
- HAI utilizes the capability of an immunogen such as viral proteins to agglutinate chicken red blood cells (or the like).
- the assay detects neutralizing antibodies, i.e., those antibodies able to inhibit hemagglutination. Dilutions of the test serum are incubated with a standard concentration of immunogen, followed by the addition of the red blood cells. The presence of neutralizing antibodies will inhibit the agglutination of the red blood cells by the immunogen.
- Tests to measure cellular immune response include determination of delayed-type hypersensitivity or measuring the proliferative response of lymphocytes to target immunogen.
- the effective amount will depend on the size and nature of the application in question. It will also depend on the nature and sensitivity of the in vitro target and the methods in use. The skilled artisan will be able to determine the effective amount based on these and other considerations.
- the effective amount may comprise one or more administrations of a composition depending on the embodiment.
- a method for one or more of: preventing, inhibiting, disrupting, dispersing or treating a polymicrobial biofilm that was caused by, will be caused by, or comprises a Haemophilus bacteria in a subject in need thereof.
- the method comprises, or consists essentially of, or yet further consists of administering to the subject: (i) an anti- DNABII antibody or a biologically active fragment thereof and an anti-PilA antibody or biologically active fragment thereof; or (ii) an anti-DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof.
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti-DNABII antibody comprises one or more of an anti-DNABII antibody, an anti-DNABII tip antibody, an anti-DNABII tip chimer antibody or biologically active fragment of each thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises an anti-DNABII tip antibody or an anti-tip chimer antibody or biologically active fragment or each thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp—003864351.1).
- the antibodies can be detectably labeled.
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- the polymicrobial biofilm also is caused by a gram- positive or a gram-negative bacteria, e.g., an ESKAPE bacteria.
- the method further comprises administering to the subject an antibiotic.
- the antibiotic comprises, or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic or a sulfonamide antibiotic.
- the subject is a mammal or a human patient.
- a method for one or more of: preventing, inhibiting, disrupting, dispersing or treating a disease related to a polymicrobial biofilm infection that was caused by, will be caused by, or comprises a Haemophilus bacteria in a subject in need thereof.
- the method comprises, or consists essentially of, or yet further consists of administering to the subject: (i) an anti-DNABII antibody or a biologically active fragment thereof and an anti-PilA antibody or biologically active fragment thereof; or (ii) an anti- DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof.
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti-DNABII antibody comprises one or more of an anti-DNABII antibody, an anti-DNABII tip antibody, an anti-DNABII tip chimer antibody or biologically active fragment of each thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip or tip chimer antibody or biologically active fragment of each thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp— 003864351.1).
- the antibodies can be detectably labeled.
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- the polymicrobial biofilm also is caused by a gram-positive or a gram-negative bacteria, e.g., an ESKAPE bacteria.
- the method further comprises administering to the subject an antibiotic.
- the antibiotic comprises, or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic or a sulfonamide antibiotic.
- the disease is as disclosed herein, for example, selected from: cystic fibrosis (CF), lung CF, chronic obstructive pulmonary disease (COPD), chronic rhinosinusitis (CRS), periodontitis, periimplantitis, middle ear infection, otitis media, (OM), acute otitis media (AOM), otitis media with effusion (OME), post-tympanostomy tube otorrhea (PTTO), ventilator-associated pneumonia (VAP), community-acquired pneumonia (CAP), chest tube/catheter/indwelling device biofilm infections, tonsillitis, pharyngitis, laryngitis, epiglottitis, sinusitis, pneumonia, bronchitis, or other respiratory tract infection (RTI).
- CF cystic fibrosis
- COPD chronic obstructive pulmonary disease
- CRS chronic rhinosinusitis
- periodontitis periimplantitis
- middle ear infection otiti
- the subject is a mammal or a human patient.
- a method for sensitizing a polyclonal microbial biofilm that was caused by, will be caused by, or comprises a Haemophilus bacteria in a subject in need thereof for an antibiotic therapy or inducing bacteria of the polymicrobial biofilm in a subject in need thereof to a newly released (NRel) state.
- the method comprises, or consists essentially of, or yet further consists of administering to the subject: (i) an anti-DNABII antibody or a biologically active fragment thereof and an anti-PilA antibody or biologically active fragment thereof; or (ii) an anti-DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof.
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti-DNABII antibody comprises one or more of an anti-DNABII antibody, an anti-DNABII tip antibody, an anti-DNABII tip chimer antibody or biologically active fragment of each thereof.
- the anti-DNABII antibody comprises an anti- DNABII tip chimer antibody or biologically active fragment thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp — 003864351.1).
- the antibodies can be detectably labeled.
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- the polymicrobial biofilm also is caused by a gram- positive or a gram-negative bacteria, e.g., an ESKAPE bacteria.
- the method further comprises administering to the subject an antibiotic.
- the antibiotic comprises, or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic or a sulfonamide antibiotic.
- the subject is a mammal or a human patient.
- the method comprises, or consists essentially of, or yet further consists of administering to the subject: (i) an anti-DNABII antibody or a biologically active fragment thereof and an anti-PilA antibody or biologically active fragment thereof; or (ii) an anti-DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof.
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti- DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof. In one aspect, the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof. In a further aspect, the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein. In another aspect, the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp—003864351.1).
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- the polymicrobial biofilm also is caused by a gram- positive or a gram-negative bacteria, e.g., an ESKAPE bacteria.
- the method further comprises contacting the biofilm with an antibiotic.
- the antibiotic comprises, or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic or a sulfonamide antibiotic.
- the contacting is in vitro or in vivo.
- a method for sensitizing a polymicrobial biofilm for an antibiotic therapy or inducing bacteria that forms the polymicrobial biofilm that was caused by, will be caused by, or comprises a Haemophilus bacteria to a newly released (NRel) state.
- the method comprises, or consists essentially of, or yet further consists of administering to the subject: (i) an anti-DNABII antibody or a biologically active fragment thereof and an anti-PilA antibody or biologically active fragment thereof; or (ii) an anti-DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof.
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp— 003864351.1).
- the antibodies can be detectably labeled.
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- the polymicrobial biofilm also is caused by a gram-positive or a gram-negative bacteria, e.g., an ESKAPE bacteria.
- the method further comprises contacting the biofilm with an antibiotic.
- the antibiotic comprises, or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic or a sulfonamide antibiotic.
- the contacting is in vitro or in vivo.
- the antibiotic is contacted with the biofilm or administrated to the subject concurrently with or after (i) an anti-DNABII antibody or a biologically active fragment thereof and an anti-PilA antibody or biologically active fragment thereof; or (ii) an anti-DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof.
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp—003864351.1).
- the method further comprises identifying the bacteria in a sample of the subject or the polymicrobial biofilm prior to the contacting or administering step.
- the polymicrobial biofilm also is caused by a gram-positive or a gram-negative bacteria, e.g., an ESKAPE bacteria.
- the bacteria is Haemophilus, e.g.
- the polymicrobial biofilm that was caused by, will be caused by, or comprises a Haemophilus bacteria is one or more of: prevented, inhibited, disrupted, dispersed or treated, in a synergistic manner compared to contacting or administering one of (i) an anti-DNABII antibody or a biologically active fragment thereof and an anti-PilA antibody or biologically active fragment thereof; or (ii) an anti-DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof, or an antibiotic alone.
- the polymicrobial biofilm is caused by Haemophilus, e.g. NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- the polymicrobial biofilm also is caused by a gram-positive or a gram-negative bacteria, e.g., an ESKAPE bacteria.
- the newly released (NRel) state of the bacteria released from the biofilm is different from the same bacteria but grown planktonically.
- the NRel bacteria comprises one or more of the following: an altered gene expression of one or more of the following genes: deaD, artM, fis, folA, folP, emrA, emrB, or acrR; an altered level of one or more of the following proteins: AsnC, CyaA, GlpC, NrfA, TehB, TrpB, TrpC, TrpD, TruA, or TrxA; a low level of one or more of the following proteins: AbgA, AroE, AroK, ArtP, AtpH, BioB, BioF, CcmA, CitD, CitT, CmK, CoaD, DcD, DjlA, DksA, DnaE, DnaQ, DsbE, FabG, FdhX, FtnB, FtsE, FtsI, FumC, Fur, GlpA, GlpB, GmK, Gps
- the high also referred to herein as increased
- low also referred to herein as decreased
- altered expression or level is compared to the same bacteria but grown planktonically.
- the method comprises, or alternatively consists essentially of, or yet further consists of (a) contacting the polymicrobial biofilm, or a polymicrobial biofilm isolated and grown therefrom, with one or both of (i) an anti-DNABII antibody or a biologically active fragment thereof and an anti-PilA antibody or biologically active fragment thereof; or (ii) an anti-DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof, as disclosed herein; and (b) assaying released bacteria from the biofilm of (a) for expression of one or more of a gene as disclosed herein and/or a protein as disclosed herein.
- the gene is selected from one or more of the following: deaD, artM, fis, folA, folP, emrA, emrB, or acrR.
- the protein is selected from one or more of the following: AsnC, CyaA, GlpC, NrfA, TehB, TrpB, TrpC, TrpD, TruA, TrxA; AbgA, AroE, AroK, ArtP, AtpH, BioB, BioF, CcmA, CitD, CitT, CmK, CoaD, DcD, DjlA, DksA, DnaE, DnaQ, DsbE, FabG, FdhX, FtnB, FtsE, FtsI, FumC, Fur, GlpA, GlpB, GmK, GpsA, GreA, Hfq, HisI, HugZ, InfA, InfB, I
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti-DNABII antibody comprises an anti- DNABII tip chimer antibody or biologically active fragment thereof.
- the anti- DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp— 003864351.1).
- the antibodies can be detectably labeled.
- the method further comprises contacting the selected biofilm with (i) an anti-DNABII antibody or a biologically active fragment thereof and an anti-PilA antibody or biologically active fragment thereof; or (ii) an anti-DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof; and (iii) an optional antibiotic optionally comprising a ⁇ -lactam antibiotic or a sulfonamide antibiotic.
- the selected polymicrobial biofilm is in a subject.
- the method further comprises administering the subject with: (i) an anti-DNABII antibody or a biologically active fragment thereof, (ii) a PilA polypeptide or a biologically active fragment thereof, and (iii) an optional antibiotic optionally comprising a ⁇ -lactam antibiotic or a sulfonamide antibiotic.
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp — 003864351.1).
- the antibodies can be detectably labeled.
- one or more of the following indicates the biofilm is suitable for a method as disclosed herein, and thus is selected: an altered gene expression of one or more of the following genes: deaD, artM, fis, folA, folP, emrA, emrB, or acrR; an altered level of one or more of the following proteins: AsnC, CyaA, GlpC, NrfA, TehB, TrpB, TrpC, TrpD, TruA, or TrxA; a low level of one or more of the following proteins: AbgA, AroE, AroK, ArtP, AtpH, BioB, BioF, CcmA, CitD, CitT, CmK, CoaD, DcD, DjlA, DksA, DnaE, DnaQ, DsbE, FabG, FdhX, FtnB, FtsE, FtsI,
- an altered expression refers to both increased and decreased expression.
- a high expression refers to the expression increased by about 10%, or about 20%, or about 30%, or about 40%, or about 50%, or about 60%, or about 70%, or about 80%, or about 90%, or about 1 fold, or about 2 folds, or about 3 folds, or about 4 folds, or about 5 folds, or about 6 folds, or about 7 folds, or about 8 folds, or about 9 folds, or about 10 folds, or about 20 folds, or about 30 folds, or about 40 folds, or about 50 folds, or about 60 folds, or about 70 folds, or about 80 folds, or about 90 folds, or about 100 folds or more higher than the reference.
- a low expression refers to the expression decreased by about 1%, or about 2%, or about 3%, or about 4%, or about 5%, or about 6%, or about 7%, or about 8%, or about 0%, or about 10%, or about 20%, or about 30%, or about 40%, or about 50%, or about 60%, or about 70%, or about 75%, or about 80%, or about 85%, or about 90%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% of the reference.
- the reference is the corresponding expression of the same bacteria but grown planktonically.
- kits such as for use in a method as disclosed herein.
- the kit comprises, or alternatively consists essentially of, or yet further consists of one or more of the following: (i) an anti-DNABII antibody or a biologically active fragment thereof and an anti-PilA antibody or biologically active fragment thereof; or (ii) an anti-DNABII antibody or a biologically active fragment thereof and a PilA polypeptide or a biologically active fragment thereof, a polynucleotide encoding each element thereof, a vector comprising the polynucleotide or a host cell comprising the polynucleotide and/or the vector and optionally expressing the antibody or fragment thereof, or (iii) an antibiotic optionally comprising a ⁇ -lactam antibiotic or a sulfonamide antibiotic, and optionally instructions for use.
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp— 003864351.1).
- the antibodies can be detectably labeled.
- composition comprising, or alternatively consisting essentially of, or yet further consisting of one or more of: (i) an anti-DNABII antibody, a biologically active fragment thereof, a polynucleotide encoding the same, a vector comprising the polynucleotide or a host cell comprising the polynucleotide and/or the vector and optionally expressing the antibody or fragment thereof, (ii) an anti-PilA antibody or a biologically active fragment thereof, a PilA polypeptide or a biologically active fragment thereof, a polynucleotide encoding the same, a vector comprising the polynucleotide or a host cell comprising the polynucleotide and/or the vector and optionally expressing the antibody or fragment thereof, or (iii) an antibiotic optionally comprising a P-lactam antibiotic or a sulfonamide antibiotic, and a carrier optionally a pharmaceutically acceptable carrier.
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises an anti- DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp— 003864351.1).
- kits and compositions such as those for use in a method as disclosed herein.
- a kit comprising, or consisting essentially of, or yet further consisting of at least two of: (i) an anti-DNABII antibody or a biologically active fragment thereof, (ii) one or both of: an anti-PilA antibody or a biologically active fragment thereof, or a PilA polypeptide or a biologically active fragment thereof, or (iii) an antibiotic; and optionally instructions for use.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII antibody comprises an anti-tip chimer antibody.
- the antibiotic comprises or consists essentially of, or yet further consists of a P-lactam antibiotic and/or a sulfonamide antibiotic.
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti- DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp— 003864351.1).
- the antibodies can be detectably labeled.
- composition comprising, or consisting essentially of, or yet further consisting of at least two of the following: (i) an anti-DNABII antibody or a biologically active fragment thereof, (ii) one or both of: an anti-PilA antibody or a biologically active fragment thereof, or a PilA polypeptide or a biologically active fragment thereof, or (iii) an antibiotic; and a carrier optionally a pharmaceutically acceptable carrier.
- the antibody can be a polyclonal antibody or monoclonal antibody, derivative, variant fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the antibody can be a polyclonal antibody or a monoclonal antibody.
- the anti-DNABII antibody comprises an anti-DNABII tip chimer antibody or biologically active fragment thereof.
- the anti-DNABII tip chimer antibody is a monoclonal antibody, a chimeric or a humanized antibody, e.g., as disclosed herein.
- the anti-PilA antibody specifically recognizes and binds the PilA peptide, examples of such include PilA surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp— 003864351.1).
- the antibodies can be detectably labeled.
- the antibiotic comprises or consists essentially of, or yet further consists of a ⁇ -lactam antibiotic and/or a sulfonamide antibiotic.
- the antibody, polypeptide, biologically active fragment of each thereof, or any combination thereof may be administered to a subject in a composition as disclosed herein.
- the antibody, polypeptide, biologically active fragment of each thereof, or any combination thereof may be administered to a subject as a polynucleotide encoding such antibody, polypeptide, biologically active fragment or a polynucleotide complementary thereto.
- such polynucleotide may be suitable for expressing the antibody, polypeptide, biologically active fragment in the subject, for example via further comprising a regulatory sequence directing the expression.
- a vector such as a gene delivery vehicle, comprising a polynucleotide as disclosed herein may also be used for administration.
- the vector may be a viral or a non-viral vector as disclosed herein.
- a host cell comprising one or more of the polynucleotides and/or the vectors as disclosed herein. Accordingly, provided are kits and compositions comprising one or more of such polynucleotides and/or vectors and/or host cells in addition to or in replacement of the corresponding antibody, peptide or biological active fragment thereof expressed. Further provided are methods and compositions suitable for producing such polypeptides, antibodies, biologically active fragments, polynucleotides, vectors and host cells.
- Biofilms intends an organized community of microorganisms that at times adhere to the surface of a structure, which may be organic or inorganic, together with the polymers such as DNA that they secrete, release and/or become available in the extracellular milieu due to bacterial lysis.
- the biofilms are very resistant to microbiotics and antimicrobial agents. They live on gingival tissues, teeth and restorations, causing caries and periodontal disease, also known as periodontal plaque disease. They also cause chronic middle ear infections. Biofilms can also form on the surface of dental implants, stents, catheter lines and contact lenses. They grow on pacemakers, heart valve replacements, artificial joints and other surgical implants.
- biofilms The Centers for Disease Control estimate that over 65% of nosocomial (hospital-acquired) infections are caused by biofilms. They cause chronic vaginal infections and lead to life-threatening systemic infections in people with hobbled immune systems. Biofilms also are involved in numerous diseases.
- the biofilm comprises a DNABII polypeptide or protein.
- the biofilm comprises an IHF and/or an HU.
- the biofilm comprises an IHFA and/or an IHFB.
- a bacterium may also present planktonically, i.e., floating as single cells and/or adhering to a surface but not forming a biofilm.
- planktonic bacteria are generated artificially, for example, in a laboratory via sonication.
- planktonic bacteria do not comprise those bacteria released from a biofilm due to treatment of a composition as disclosed herein, since Applicant discovered that such newly released (NRel) bacteria perform differently compared to a planktonic bacteria generated by sonication. More characterizations of the NRel bacteria and their differences compared to a planktonic one are disclosed herein, for example, in Tables 2 and 3.
- Biofilms also are involved in numerous diseases, including but not limited to those caused by Aggregatibacter actinomycetemcomitans, Borrelia burgdorferi (e.g., B31), Bordetella pertussis (e.g., Tohama I), Burkholderia pseudomallei (e.g., 668), Burkholderia cenocepacia (e.g., HI2424), Escherichia coli (e.g., K12 MG1655), Enterococcus faecalis (e.g., V583), Haemophilus influenzae (e.g., Rd KW20), Helicobacter pylori (e.g., 26695), Klebsiella pneumoniae, Moraxella catarrhalis (e.g., RH4), Mycobacterium smegmatis (e.g., MC2), Mycobacterium tuberculosis (e.g., CDC155
- Additional organisms known to associate with and/or form biofilms include but are not limited to Campylobacter spp., Candida spp., Legionella pneumophila, and Listeria monocytogenes.
- cystic fibrosis patients have Pseudomonas infections that often result in antibiotic resistant biofilms.
- Other diseases associated with biofilms include, but are not limited to, lung infections of cystic fibrosis patients, otitis media, post-tympanostomy tube ottorhea, chronic suppurative otitis media, native valve infectious endocarditis, osteomyelitis, rhinosinositis, prostatitis, urinary tract infection, wounds, dental caries and periodontitis.
- Foodborne pathogens such as but not limited to some of the above listed organisms (e.g., Listeria monocytogenes, Escherichia coli, Salmonella enterica) may also form biofilms on the food which they contaminate.
- Disease causing biofilms in animals e.g., Escherichia coli, Salmonella, and Shigella species
- biofilms need not be of one homogeneous microbial population and may incorporate other pathogens and even host cells.
- biofilms are often causes of industrial contamination, most notably in relation to process waters and surfaces in contact therewith.
- biofilms Complications involving organisms that form biofilm as industrial contaminants include but are not limited to biocorrosion, biofouling, and equipment damage as a result of biofilm formation.
- Non- limiting exemplary organisms associated with biofilms in industrial settings include those disclosed in Ferrera et al. (2015) Biofouling 31(2):173-180 and Desulfovibrio species. Additional details regarding biofilms may be found in, for example, Donlan (2002) Emerging Infectious Diseases 8(9):881-890.
- Haemophilus is a genus of Gram-negative, pleomorphic, coccobacilli bacteria belonging to the family Pasteurellaceae. These organisms inhabit the mucous membranes of the upper respiratory tract, mouth, vagina, and intestinal tract.
- the genus includes commensal organisms along with some significant pathogenic species such as Haemophilus influenza and Haemophilus ducreyi, the causative agent of chancroid. All members are either aerobic or facultatively anaerobic.
- Haemophilus influenzae refers to pathogenic bacteria that can cause many different infections such as, for example, ear infections, eye infections, OM and sinusitis.
- Clinical isolates of H. influenza are classified either as serotypes “a” through “f” or as non- typeable (NTHI) depending on the presence or absence, respectively, of type-specific polysaccharide capsules on the bacteria.
- a prototype NTHi isolate is the low passage isolate 86-028NP which was recovered from a child with chronic OM.86-028NP was deposited with the American Type Culture Collection, 10801 University Boulevard., Manassas, Va. 20110, on Oct. 16, 2001 and assigned accession no. PTA-4764.
- a biofilm as discussed herein is a polymicrobial biofilm, i.e., comprising, or alternatively consisting essentially of, or yet further consisting of more than one bacteria.
- the biofilm comprises a Haemophilus bacterium.
- the polymicrobial biofilm comprises, or alternatively consists essentially of, or yet further consists of more than one Haemophilus bacteria.
- the polymicrobial biofilm comprises, or alternatively consists essentially of, or yet further consists of one or more than one Haemophilus bacteria and a bacteria which is not Haemophilus (i.e., a non-Haemophihis bacterium).
- a Haemophilus bacterium comprises or alternatively consists essentially of, or yet further consists of Haemophilus influenza (e.g., one or more of Nontypeable Haemophilus influenzae (NTHI), Rd KW20, 86-028NP, R2866, PittGG, PittEE, R2846, and 2019).
- the polymicrobial biofilm is caused by Haemophilus and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, ox Moraxella catarrhalis.
- a Haemophilus bacterium comprises or alternatively consists essentially of, or yet further consists of Nontypeable Haemophilus influenzae (NTHI).
- NTHI Nontypeable Haemophilus influenzae
- a Haemophilus bacterium comprises or alternatively consists essentially of, or yet further consists of one strain of Nontypeable Haemophilus influenzae (NTHI), such as 86- 028NP, and optionally one or more bacteria other than NTHI (i.e., non-NTHI bacteria).
- NTHI Nontypeable Haemophilus influenzae
- Other NTHI strains can be identified by one of skill in the art, such as HI1716 or NTHI 2019. See for example, Greiner et al. 2004.
- a Haemophilus bacterium comprises or alternatively consists essentially of, or yet further consists of more than one strains of Nontypeable Haemophilus influenzae (NTHI), and optionally one or more bacteria other than NTHI.
- NTHI Nontypeable Haemophilus influenzae
- the polymicrobial biofilm is caused by NTHI and one or more of Burkholderia cenocepacia, Staphylococcus aureus, Streptococcus pneumonia, or Moraxella catarrhalis.
- the non-Haemophihis bacterium and/or the non-NTHI bacterium is selected from one or more of the following: Moraxella catarrhalis, Staphylococcus aureus, Pseudomonas aeruginosa, Streptococcus pneumoniae, Burkholderia cenocepacia, an ESKAPEE pathogen (selected from Enterococcus faecium, Klebsiella pneumoniae, Acinetobacter baumannii, Pseudomonas aeruginosa, and Enterobacter spp), Aggregatibacter actinomycetemcomitans, Borrelia burgdorferi (e.g., B31), Bordetella pertussis (e.g., Tohama I), Burkholderia pseudomallei (e.g., 668), Burkholderia cenocepacia (e.g., HI
- the polymicrobial biofilm comprises, or alternatively consists essentially of, or yet further consists of NTHI, Streptococcus pneumonia, Staphylococcus aureus, or Moraxella catarrhalis.
- the polymicrobial biofilm is recurrent, or recalcitrant to an antibiotic monotherapy.
- a biofilm recalcitrant to an antibiotic monotherapy refers to that an antibiotic monotherapy, i.e., only using an antibiotic in treating the biofilm, does not result in a desirable effects and/or does not prevent the biofilm from recurring.
- Biofilms contribute significantly to the chronicity and recurrence of bacterial diseases due to the fact that biofilm-resident bacteria are highly recalcitrant to killing by host immune effectors and antibiotics.
- antibody -mediated release of bacteria from biofilm residence into the surrounding milieu supports a powerful strategy to resolve otherwise difficult-to-treat biofilm-associated diseases.
- Applicant revealed that antibodies directed against two unique determinants of nontypeable Haemophilus influenzae (NTHI) (e.g. the Type IV pilus (T4P) of NTHI or a bacterial DNABII DNA-binding protein, a species- independent target that provides structural integrity to bacterial biofilms) release biofilm- resident bacteria via discrete mechanisms.
- NTHI nontypeable Haemophilus influenzae
- T4P Type IV pilus
- NTHI e.g. the Type IV pilus (T4P) of NTHI or a bacterial DNABII DNA-binding protein, a species- independent target that provides structural integrity to bacterial biofilms
- Applicant showed that the phenotype of the resultant newly released (or NRel) NTHI is dependent upon the specific mechanism of release. Applicant used flow cytometry, proteomic profiles, and targeted transcriptomics to show that the two NRel populations were significantly different not only from planktonically grown NTHI, but importantly, from each other despite genetic identity. Moreover, each NRel population had a distinct, significantly increased susceptibility to killing by either a sulfonamide or ⁇ -lactam antibiotic compared to planktonic NTHI, an observation consistent with their individual proteomes and further supported by relative differences in targeted gene expression.
- anti-rsPilA specifically targets an NTHI antigen that is not expressed by Moraxella catarrhalis but unexpectedly, that whereas anti-rsPilA has no effect on a pure M. catarrhalis biofilm, when M. catarrhalis is allowed to build a biofilm with NTHI a unique structure forms whereby M.
- the biofilm is derived from a gram negative or a gram positive biofilm producing bacteria.
- Non-limiting examples of conditions are selected from the group of: chronic non-healing wounds, including venous ulcers and diabetic foot ulcers, ear infections, sinus infections, urinary tract infections, gastrointestinal tract ailments, pulmonary infections, respiratory tract infections, cystic fibrosis, chronic obstructive pulmonary disease, catheter-associated infections, indwelling devices associated infections, infections associated with implanted prostheses, osteomyelitis, cellulitis, abscesses, and periodontal disease.
- PilA and Vaccines [0183] In Applicant’s long-standing efforts to develop a vaccine for diseases of the respiratory tract caused by NTHI, Applicant focused on two unique, biofilm-associated determinants.
- the first target is the NTHI T4P, a critical adhesin with multiple roles in adherence, colonization, biofilm formation, twitching motility and competence (Bakaletz et al., 2005; Carruthers et al., 2012; Das et al., 2017; Jurcisek et al., 2007; Mokrzan et al., 2019; Mokrzan et al., 2016; Toone et al., 2020).
- Antibodies against the majority subunit of NTHI T4P (PilA), and specifically a recombinant and soluble form of PilA (‘rsPilA’), induce dispersal of pre-existing NTHI as well as polymicrobial biofilms in vitro, and also those present within the middle ear in a chinchilla model of NTHI-induced OM wherein biofilm dispersal leads to rapid disease resolution (Mokrzan et al., 2018; Novotny et al., 2009; Novotny et al., 2013b; Novotny et al., 2016; Novotny et al., 2015; Ysebaert et al., 2019).
- NTHI are released in a ‘top down’ process, with maximal dispersal into the supernatant within 6 h of incubation (Mokrzan et al., 2018; Novotny et al., 2015). Armbruster et al. also showed that Moraxella catarrhalis, which does not express AI-2, nonetheless “eavesdrops” on the AI-2 signal produced by NTHI within a polymicrobial biofilm formed by these two species, which leads to increased M. catarrhalis biofilm formation (Armbruster et al., 2010). Intriguingly, when Applicant incubated a pre-formed dual-species NTHI plus M.
- Type IV pili are typically 5-7 nm in diameter, several micrometers in length and comprised of a single protein Sub perturn (Bardy et al., Microbiology, 149,295-304, 2003; Wall and Kaiser, Mol. Microbiol., 32, 1-10, 1999).
- Type IV pilin Subunits are usually 145-160 amino acids in length and may be glycosylated or phosphorylated.
- Type IVa pili are distinguished by the presence of a highly conserved, hydrophobic N-terminal methylated phenylala 1C.
- a biologically active fragment of a PilA has at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99%, or at least about 100%, or at least 1.5 folds, or at least 2 folds, or at least 3 folds, or at least 4 folds, or at least 5 folds, or at least 6 folds, or at least 7 folds, or at least 8 folds, or at least 9 folds, or at least 10 folds, or at least 20 folds, or at least 50 folds, or at least 100 folds, or more of the biological activity of the wild type PilA.
- a biologically active fragment of PilA comprises, or consists essentially of, or yet further consists of a fragment of PilA.
- the biological activity comprises, or consists essentially of, or yet further consists of inducing an antibody or other immune response in a subject against PilA.
- Such biological activity can be measured by one of skill in the art via, for example, quantifying concentration and/or PilA affinity of antibodies in a sample of the subject immunized with the biologically active fragment.
- the biological activity here comprises, or consists essentially of, or yet further consists of one or more of: preventing, inhibiting, disrupting, dispersing or treating a biofilm in a subject.
- the PilA is a chimeric protein as disclosed herein.
- the PilA or a biologically active fragment thereof comprises, or alternatively consists essentially of, or yet further consists of a chimeric proteins comprising a fragment of the Type IV pilus major subunit protein (PilA) of nontypeable H. influenzae (NTHI) and a fragment of NTHI OMP P5 protein (also called P5-fimbrin, fimbrin or OMP P5-homologous adhesin).
- the PilA or a biologically active fragment thereof comprises, or alternatively consists essentially of, or yet further consists of a chimeric proteins comprising PilA modified to present the B-cell epitope of the LB1 peptide.
- vaccine compositions comprising one or more chimeric proteins as disclosed herein and methods of eliciting an immune response using the chimeric proteins as disclosed herein.
- Such chimeric protein is disclosed in US Patent No. US7811591, which is incorporated herein by reference in its entirety.
- the PilA or a biologically active fragment thereof comprises, or consists essentially of, or yet further consists of a chimeric protein as described herein.
- the LB1 peptide is a 40 amino acid synthetic chimeric P5-fimbrin derived peptide (Arg Ser Asp Tyr Lys Phe Tyr Glu Asp Ala Asn Gly Thir Arg Asp His Lys Lys Gly Pro Ser Leu Lys Leu Leu Ser Leu He Lys Gly Vai He Vai His Arg Leu Glu Gly Vai Glu, SEQ HD NO: ) that induces an immunogenic response to NTHI and is advantageous because it does not require tedious purification techniques.
- the LB1 peptide comprises an N-terminal 19 amino acid peptide that is a B-cell epitope (Arg Ser Asp Tyr Lys Phe Tyr Glu Asp Ala Asn Gly Thr Arg Asp His Lys Lys Gly, SEQ ID NO: ).
- the B-cell epitope was derived from the predicted surface-exposed loop 3 of an outer membrane protein (fimbrin) of NTHi denoted as OMP P5 (also called P5-fimbrin or OMP PS-homologous adhesin).
- OMP P5 also called P5-fimbrin or OMP PS-homologous adhesin
- the LB1 peptide further comprises a short 5-mer linker peptide and a 16-residue T cell promiscuous epitope.
- the T cell epitope was derived from a fusion protein of the measles virus.
- the T cell promiscuous epitope induces a very strong T cell response in individuals
- the PilA or a biologically active fragment thereof comprises, or consists essentially of, or yet further consists of a fragment of the LB1 peptide inserted into a safer and selective carrier protein that does not reduce the effectiveness of inducing a B-cell response.
- the fragment of the LB1 peptide is inserted into a carrier that itself also confers protection against NTHi-induced diseases.
- NTHi Type IV pilus also known as PilA protein (comprising, or alternatively consisting essentially of, or yet further consisting of a sequence of Met Lys Leu Thr Thr Gln Gln Thr Leu Lys Lys Gly Phe Thr Leu Ile Glu Leu Met Ile Val Ile Ala Ile Ile Ala Ile Leu Ala Thr Ile Ala Ile Pro Ser Tyr Gln Asn Tyr Thr Lys Lys Ala Ala Val Ser Glu Leu Leu Gln Ala Ser Ala Pro Tyr Lys Ala Asp Val Glu Leu Cys Val Tyr Ser Thr Asn Glu Thr Thr Asn Cys Thr Gly Gly Lys Asn Gly Ile Ala Ala Asp Ile Thr Thr Ala Lys Gly Tyr Val Lys Ser Val Thr Thr Ser Asn Gly Ala Ile Thr Val Lys Ser Val Thr Thr Ser Asn Gly Ala Ile Thr Val Lys Ser Val Thr Thr Ser As
- the PilA protein is encoded by the pilA gene (comprising, or alternatively consisting essentially of, or yet further consisting of a sequence of atg aaa cta aca aca cag caa acc ttg aaa aaa ggg ttt aca tta ata gag cta atg att gtg att gca att att gct att tta gcc act atc gca att ccc tct tat caa aat tat act aaa aaa gca gcg gta tct gaa tta ctg caa gcg tca gcg ct tat aag gct gat gtg gaa tta tgt gta tat agc aca aat gaa aca aca
- the PilA or a biologically active fragment thereof comprises, or consists essentially of, or yet further consists of a fragment of the LB1 peptide in order to present the peptide to induce an immunogenic response.
- Such fragment of the LB1 peptide can be 12 to 35 amino acids, or 15 to 30 amino acids, or 18 to 19 amino acids long and is a subunit of the fimbrin protein.
- the fragment of the LB1 peptide comprises, or consists essentially of, or yet further consists of the N-terminal amino acid sequence RSDYKFYEDANGTRDHKKG (SEQ ID NO: ).
- the PilA or a biologically active fragment thereof comprises, or consists essentially of, or yet further consists of a PilA protein modified to present a 24 amino acid peptide.
- the 24 amino acid peptide may comprise the B-cell epitope of the LB1 peptide modified as set out in the amino acid sequence of LVRSDYKFYEDANGTRDHKKGRHT (SEQ ID NO: ) in which a leucine and valine are added to the N terminus of the B-cell epitope of LB1 and an arginine, histidine and threonine are at the C terminus of the B-cell epitope of LB1.
- SEQ ID NO: amino acid sequence of LVRSDYKFYEDANGTRDHKKGRHT
- the amino acid sequence of the surface exposed loop 3 of NTHi OMP P5 can vary between NTHi strains.
- the PilA or a biologically active fragment thereof comprises, or consists essentially of, or yet further consists of a fragment of the PilA protein modified to present the B cell epitope of any variant amino acid sequence of loop 3 of the NTHi OMP P5.
- the PilA or a biologically active fragment thereof comprises, or consists essentially of, or yet further consists of a PilA protein modified to present one of the following variant NTHi OMP P5 amino acids sequences: RSDYKLYNKNSSSNSTLKNLGE (SEQ ID NO: ), RSDYKLYNKNSSTLKDLGE (SEQ ID NO: ) and RSDYKFYDNKRID (SEQ ID NO: ).
- the variant peptides also may be presented with a leucine and valine added to the N terminus and an arginine, histidine and threonine added to the C terminus or any other modification to assist in protein folding and/or antigen presentation.
- the chimeric proteins of the invention comprise the modified PilA amino acids wherein the native PilA amino acids have been substituted with a portion of the LB1 peptide.
- the chimeric proteins of the invention comprise a modified PilA amino acid sequence wherein a portion of the LB1 peptide is inserted within and in addition to the native PilA amino acids.
- the chimeric proteins of the invention have the ability to induce the formation of antibodies directed against two proteins and therefore are more effective and more specific vaccine candidates.
- the chimeric proteins comprise the mature amino acid sequence (residues 13-149) of the NTHi PilA protein (SEQ ID NO: 51) wherein a portion of the LB1 peptide is inserted between the cysteine residues at positions 62 and 72 of SEQ ID NO: 51 and may substitute the native amino acids, such as the chimeric protein having the amino acid sequence of Gly Ser His Met Thr Lys Lys Ala Ala Vai Ser Glu Leu Leu Gin Ala Ser Ala Pro Tyr Lys Ala Asp Vai Glu Leu Cys Leu Vai Arg Ser Asp Tyr Lys Phe Tyr Glu Asp Ala Asn Gly Thr Arg Asp His Lys Lys Gly Arg His Thr Cys Thr Gly Gly Lys Asn Gly He Ala Ala Asp Ile Thr Thr Ala Lys Gly Tyr Val Lys Ser Val Thr Thr Ser Asn Gly Ala Ile Thr Val Lys Gly Asp Gly Asp Gly Asp Gly
- This chimeric protein comprises residues 40-149 of SEQ ID NO: and has the B-cell epitope of LB1 (Leu Val Arg Ser Asp Tyr Lys Phe Tyr Glu Asp Ala Asn Gly Thr Arg Asp His Lys Lys Gly Arg His Thr, SEQ ID NO: 52) inserted between residues 62 and 72 of SEQ ID NO: 51.
- the portion of the LB1 peptide is inserted between the cysteine residues at positions 131 and 144 of SEQ ID NO: 51 and may substitute the native amino acids such as the protein having the amino acid sequence of Gly Ser His Met Thr Lys Lys Ala Ala Val Ser Glu Leu Leu Gln Ala Ser Ala Pro Tyr Lys Ala Asp Val Glu Leu Cys Val Tyr Ser Thr Asn Glu Thr Thr Asn Cys Thr Gly Gly Lys Asn Gly Ile Ala Ala Asp Ile Thr Thr Ala Lys Gly Tyr Val Lys Ser Val Thr Thr Ser Asn Gly Ala Ile Thr Val Lys Gly Asp Gly Thr Leu Ala Asn Met Glu Tyr Ile Leu Gln Ala Thr Gly Asn Ala Ala Thr Gly Val Thr Trp Thr Thr Thr Cys Leu Val Arg Ser Asp Tyr Lys Phe Tyr Glu Asp Ala Asn Gly Thr Thr Thr
- This chimeric protein comprises residues 40-149 of SEQ ID NO: 51 and has the B-cell epitope of LB1 (SEQ ID NO: 52) inserted between residues 131 and 144 of SEQ ID NO: 51.
- the chimeric proteins comprise the mature amino acid sequence (residues 13-149) of the NTHi PilA protein (SEQ ID NO: 51) wherein the portion of the LB1 peptide is inserted at the C-terminus of the PilA protein.
- the chimeric proteins comprise the mature amino acid sequence (residues 13-149) of NTHi PilA protein (SEQ ID NO: 51) wherein the portion of the LB1 peptide is inserted at the N-terminus of the PilA protein.
- chimeric proteins comprises a portion of the NTHi PilA protein and one or more of the LB1 peptides described herein.
- the chimeric proteins of the invention include those which present the same LB1 peptide more than once within a portion of the NTHi PilA protein and those which present two or more different LB1 peptides within a portion of the NTHi PilA protein.
- the disclosure further provides for chimeric proteins comprising a portion of the NTHi PilA protein and any antigenic protein that will elicit an immune response.
- the chimeric proteins may comprise the full length or a portion of the major subunit of the NTHi Type IV Pilus which is encoded by the gene pilA.
- the PilA protein of the NTHi isolate 86-028NP (for example, SEQ ID NO: 51) is encoded by the nucleic acid sequences described in U.S. Patent No. 7,501,131, incorporated by reference herein in its entirety. Also provided are polynucleotides encoding PilA polypeptides from NTHi clinical isolates 1728MEE, 1729MEE, 3224A, 10548MEE, 1060MEE, 1885MEE, 1714MEE, 1236MEE, 1128MEE and 214NP.
- PilA polypeptides are set out in Met Lys Leu Thr Thr Gin Gin Thr Leu Lys Lys Gly Phe Thr Leu lie Glu Leu Met lie Vai lie Ala lie lie Ala lie Leu Ala Thr lie Ala lie Pro Ser Tyr Gin Asn Tyr Thr Lys Lys Ala Ala Vai Ser Glu Leu Leu Gin Ala Ser Ala Pro Tyr Lys Ala Asp Vai Glu Leu Cys Vai Tyr Ser Thr Asn Glu Thr Thr Asn Cys Thr Gly Gly Lys Asn Gly lie Ala Ala Asp lie Thr Thr Ala Lys Gly Tyr Vai Lys Ser Vai Thr Thr Ser Asn Gly Ala lie Thr Vai Lys Gly Asp Gly Thr Leu Ala Asn Met Glu Tyr lie Leu Gin Ala Thr Gly Asn Ala Ala Thr Gly Vai Thr Trp Thr Thr Thr Cys Lys Gly Thr Asp Ala
- polypeptides are respectively encoded by the nucleotide sequences set out in the SEQ ID NOS: 33, 35, 37, 39, 41, 43, 45, 47, 49 and 51 as disclosed in US Patent No.7,811,591 (each of the sequences is incorporated herein by reference in its entirety).
- a chimeric protein comprises a portion of NTHi PilA protein.
- the polypeptides comprise the NTHi 86-028NP amino acid sequences respectively set out in SEQ ID NO: 51.
- Polypeptides of the invention also include PilA polypeptides set out in SEQ ID NOS: 54, 55, 56, 57, 58, 59, 60, 61, 62 and 63.
- the PilA polypeptides of the invention are those of other non-typeable H. influenzae strains and from H. influenzae strains a, b, c, e and f.
- Polypeptides of PilA specifically include peptide fragments (i.e., peptides) or fragments of the PilA polypeptide that retain one or more biological or immunogenic properties of a full length polypeptide of the invention.
- PilA peptide fragments provided by the invention are designated TfpQ2, TfpQ3, TfpQ4 and OLP3 and respectively comprise amino acids 35 through 68 of SEQ ID NO: 51, amino acids 69 through 102 of SEQ ID NO: 51, amino acids 103 through 137 of SEQ ID NO: 51, and amino acids 21 through 35 of SEQ ID NO: 51.
- Another PilA peptide fragment provided by the disclosure comprises amino acids 40 through 149 of SEQ ID NO: 51.
- a chimeric protein comprises a portion of a PilA polypeptide with one or more conservative amino acid substitutions that do not affect the biological and/or immunogenic activity of the PilA polypeptide.
- a chimeric protein comprises a portion of a variants of the NTHi PilA polypeptides of the present invention (e.g., a polypeptide exhibiting at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, 86%, 87%, 88%, 89%, at least about 90%, 91%, 92%, 93%, 94%, typically at least about 95%, 96%, 97%, more typically at least about 98%, or most typically at least about 99% amino acid identity to a polypeptide of SEQ ID NOS: 51, 54, 55, 56, 57, 58, 59, 60, 61, 62 and 63 that retain biological and/or immunogenic activity.
- the PilA is a recombinant and soluble PilA (rsPilA).
- Recombinant PilA protein (rPilA) may be generated to serve as a more readily renewable product. To do this, the published protocol of Keizer et al. (J. Biol.
- the chimeric proteins may be synthesize, purified and sequenced using standard techniques.
- the chimeric proteins may be assembled semi-manually by stepwise Fmoc-tert-butyl solid-phase synthesis and purified by HPLC.
- the composition and amino acid sequence of recombinant and synthetic chimeric proteins may be confirmed by amino acid analysis and/or mass spectral analysis.
- Anti-PilA Antibodies a polyclonal antibody or a monoclonal antibody.
- the polyclonal antibody is in a sera isolated from a subject immunized with a PilA polypeptide or a biologically active fragment thereof. In some embodiments, such sera may be purified and processed, such as digested to produce Fab fragments of the antibodies.
- the antibody specifically recognizes and bind the PilA peptide, examples of such include surface antigens or recombinant soluble PilA (Genbank Accession No.: EFU96734.1) and Type IV Pilin (Genbank Accession No.: Yp — 003864351.1).
- the antibody is a polyclonal antibody.
- the antibody is a monoclonal antibody or a biologically active fragment thereof. Methods to generate monoclonal antibodies, derivatives, fragments and variants thereof are known in the art.
- a biologically active fragment of an anti-PilA antibody has at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99%, or at least about 100%, or at least 1.5 folds, or at least 2 folds, or at least 3 folds, or at least 4 folds, or at least 5 folds, or at least 6 folds, or at least 7 folds, or at least 8 folds, or at least 9 folds, or at least 10 folds, or at least 20 folds, or at least 50 folds, or at least 100 folds, or more of the biological activity of a reference anti-PilA antibody.
- the biological activity comprises, or consists essentially of, or yet further consists of specifically recognizing and binding a PilA.
- Such biological activity can be measured by one of skill in the art via, for example, quantifying PilA affinity and/or specificity of the antibody and/or competitive binding a PilA compared to a reference antibody.
- the biological activity here comprises, or consists essentially of, or yet further consists of one or more of: preventing, inhibiting, disrupting, dispersing or treating a biofilm in a subject.
- the biological activity comprises or consists essentially of, or yet further consists of the ability to kill H. influenzae bacteria.
- Suitable activity may be selected from the following: reducing the virulence, inhibiting adherence, inhibiting twitching motility, inhibiting cell division, and/or inhibiting penetration into the epithelium of H. influenzae bacteria and/or enhance phagocytosis of the H. influenzae bacteria.
- the anti-PilA antibody or a biologically active fragment thereof specifically binds and recognizes a PilA polypeptide or a biologically active fragment thereof.
- IHF Integration Host Factor
- HU a histone-like protein
- Genes that encode IHF and/or HU are present in the genome of every member of Eubacteria (Goodman et al., 2011).
- this target is not unique to NTHI but is instead species-independent due to its presence in all tested pathogen- formed biofilms to date, including each of the high priority ESKAPE pathogens (Enterococcus faecium, Staphylococcus aureus, Klebsiella pneumoniae, Acinetobacter baumannii, Pseudomonas aeruginosa and Enterobacter spp.) (Devaraj et al., 2018; Devaraj et al., 2015; Novotny et al., 2013a).
- ESKAPE pathogens Enterococcus faecium, Staphylococcus aureus, Klebsiella pneumoniae, Acinetobacter baumannii, Pseudomonas aeruginosa and Enterobacter spp.
- Extracellular DNA (eDNA) and associated DNABII proteins are essential to the underlying architecture and structural integrity of these biofilms (Flemming and Wingender, 2010; Goodman et al., 2011; Jurcisek and Bakaletz, 2007; Whitchurch et al., 2002).
- eDNA Extracellular DNA
- HU Jurcisek and Bakaletz, 2007; Whitchurch et al., 2002.
- IHF and HU crossed strands of eDNA
- the result is a lattice-like eDNA scaffold that supports and maintains the biofilm architecture.
- Exposure of bacterial biofilms to antibody against DNABII proteins destabilizes the eDNA matrix and causes collapse of the biofilm structure (Goodman et al., 2011).
- Vaccination-induced antibodies against DNABII proteins disrupt pre- existing biofilms in a chinchilla model of NTHI-induced OM which permits clearance by host immune effectors (Goodman et al., 2011; Novotny et al., 2019; Novotny et al., 2016).
- therapeutic treatment with anti-DNABII antibodies resolves osteolytic peri- implantitis in a rat model of pre-existing Aggregatibacter actinomycetemcomitans biofilms (Freire et al., 2017), and also eradicates aggregate biofilms of P. aeruginosa from the murine lung (Novotny et al., 2016).
- nucleoid associated protein refers to a class of proteins that affect the dynamic spatial organization of nucleic acids in the nucleoid of prokaryotic cells. These proteins organize the genome through effecting DNA bending, binding and aggregation. Certain NAPs are DNA binding proteins and may be associated with the biofilm including, DNABII proteins, DPS (Genbank Accession No.: CAA49169), H- NS (Genbank Accession No.: CAA47740), Hfq (Genbank Accession No.: ACE63256), CbpA (Genbank Accession No.: BAA03950) and CbpB (Genbank Accession No.: NP—418813).
- DNABII proteins are distinct and generally have strong sequence identity with alpha helical dimerization domains and may comprise anti-parallel beta ribbons, which often have NPXT (wherein X is any amino acid or may be selected from amino acids Q, R, K, S, or T) comprising tips that bind and intercalate into the minor groove of DNA and kink it.
- the functional protomer is a dimer of identical or homologous subunits.
- the DNABII family is a member of a class of proteins referred to as nucleoid associated proteins (NAPs), bacterial proteins that, in part, shape the intracellular bacterial nucleoid (Browning et al. (2010) Curr. Opin.
- Microbiol.13:773-780 this family is ubiquitous, expressed by virtually all eubacteria. All characterized family members to date function as either a homodimer or heterodimer of subunits. The family is divided into two types, HU (histone-like protein) and IHF (integration host factor) with B. cenocepacia capable of expressing both (strain J2315 genes: BCAL3530, hupA; BCAL1585, hupB; BCAL1487, ihfA and BCAL2949, ihfb).
- a “DNABII polypeptide or protein” intends a DNA-binding protein or polypeptide that is composed of DNA-binding domains and thus have a specific or general affinity for microbial DNA. In one aspect, they bind DNA in the minor grove.
- Non-limiting examples of DNABII proteins are an integration host factor (IHF) protein and a histone-like protein from E. coli strain U93 (HU).
- An “integration host factor” or “IHF” protein is a bacterial protein that is used by bacteriophages to incorporate their DNA into the host bacteria. They also bind extracellular microbial DNA. The genes that encode the IHF protein subunits in E.
- IHF integration host factor subunit alpha
- IHFB integration host factor subunit beta
- coli HU was reported by Laine et al. (1980) Eur. J. Biochem 103(3)447-481. Antibodies to the HU protein are commercially available from Abeam.
- the genes that encode the HU protein subunits in E. coli are hupA and hupB corresponding to SEQ ID NOs: 29 and 30, respectively. Homologs for these genes are found in other organisms, and peptides corresponding to these genes from other organisms can be found in Table 10 of WO 2011/123396.
- the term “surface antigens” or “surface proteins” refers to proteins or peptides on the surface of cells such as bacterial cells.
- the DNABII is selected from an integration host factor (IHF) or a histone-like protein (HU) protein.
- DNABII comprises, or consists essentially of, or yet further consists of a wild type DNABII or a biologically active fragment thereof.
- a biologically active fragment of a DNABII comprises, or consists essentially of, or yet further consists of a chimer as disclosed herein.
- a DNABII comprises, or consists essentially of, or yet further consists of SEQ ID NO.1 through 348 of WO2014/201305 (each of the sequences is incorporated herein by reference in its entirety), or a fragment or an equivalent of each thereof.
- DNABII or a biologically active fragment thereof produce by gram(+) and gram(-) bacteria can be found in Table 8 in US Patent No.8,999,291, incorporated herein by reference and WO2014/201305, WO2017/023863, WO2017/066719, WO2018/129092, WO2018/129078, PCT Patent Application No. PCT/US2020/041082 and PCT/US2021/040576.
- Antibodies that bind these proteins and fragments thereof are referenced as anti-DNABII antibodies.
- a sequence alignment of relevant portions of the DNA binding proteins of various embodiments is published as Table 9 in US Patent No.8,999,291, incorporated herein by reference.
- Non-limiting examples of such include isolated or recombinant polypeptides comprising the amino acid sequences listed in the table below or fragments or equivalents thereof, and equivalents of each thereof. Further non-limiting examples include an isolated or recombinant polypeptide comprising, or alternatively consisting essentially of, or yet further amino acids AARKGINPKTKKSISIPARKVVRF (SEQ ID NO: ). In yet a further aspect, this disclosure provides mutated or recombinant HU antigenic polypeptides having the corresponding amino acid(s) to the P. gingivalis amino acids at positions 61 and/or 64 modified to I (or alternatively another hydrophobic amino acid such as V or F) and/or K. Biological equivalents of these polypeptides are further included in this disclosure with the proviso that the sequences do not include whole, isolated wildtype sequences. A listing of non-limiting exemplary HU protein sequences from a variety of species.
- Non-limiting examples of suitable polypeptide fragments include but are not limited to: (a) FLEEIRLSLESGQDVKLSGF; (b) RPGRNPKTGDVVPVSARRVV; (c) RTGRNPQTGAEIQIAASKVP; (d) TLSAKEIENMVKDILEFISQ; (e) RGFGSFSLHHRQPRLGRNPK; (f) FSLHHRQPRLGRNPKTGDSV; (g) KKQAKAALEATLDAITASLKEG; (h) VNERAARTGRNPQTGAEIQIAA; (i) a polypeptide comprising the amino acid sequence NPXT; or (j) an equivalent of (a) through (i), wherein an equivalent comprises an amino acid sequence having at least about 80 % homology or amino acid identity thereto, or an amino acid encoded by polynucleotide that hybridizes under conditions of high stringency to a polynucleotide encoding the amino acid sequence or its complement, wherein
- chimer or “chimeric peptide” refers to a recombinant polypeptide comprising or alternatively consisting essentially of, or yet further consisting of, two or more fragments or domains of a DNABII polypeptide conjugated directly or indirectly (such as via a linker) with each other.
- the domains are conformational tip domains and/or conformational tail domains.
- the two or more fragments or domains is derived from the same or different DNABII polypeptide(s).
- the chimeric peptide comprises or alternatively consists essentially of, or yet further consists of, a tip domain of IhfA and a tip domain of IhfB conjugated directly or indirectly (such as via a linker) with each other. See, e.g., US Patent No.11,104,723, incorporated herein by reference.
- the chimeric peptide comprises or alternatively consists essentially of, or yet further consists of, a tail domain of IhfA and a tail domain of IhfB conjugated directly or indirectly (such as via a linker) with each other.
- a conformational tip domain of a polypeptide refers to a polypeptide that comprises a primary amino acid sequence wherein the structure has an anti-parallel beta ribbon with a sharp turn that is typically mediated by a proline residue.
- the “tip” of an IHF polypeptide is shown in Figure 1 of WO2018/129078.
- a conformational tip domain” of a polypeptide refers to a polypeptide that comprises a primary amino acid sequence wherein the structure has an anti-parallel beta ribbon with a sharp turn that is typically mediated by a proline residue.
- Table below shows examples of conformational tip domain polypeptides.
- a “tip fragment” of a DNABII polypeptide intends a DNABII polypeptide that, using IHFalpha and IHFbeta as examples, forms the two arms of the proteins.
- Non-limiting examples of such include the tip fragment of IhfA (also referred to herein as A tip fragment): NFELRDKSSRPGRNPKTGDVV, SEQ ID NO: , and the tip fragment of IhfB (also referred to herein as B tip fragment): SLHHRQPRLGRNPKTGDSVNL (SEQ ID NO: ) or FSLHHRQPRLGRNPKTGDSV (SEQ ID NO: ).
- a “tail fragment” of a DNABII polypeptide intends a region of the protein that is both exposed to the bulk medium and not occluded by DNA or other polypeptides.
- the tip-chimeric peptide IhfA5-mIhfB4NTHI comprises, or consists essentially of, or yet further consists of: a polypeptide sequence of RPGRNPX 1 TGDVVPVSARRVV-X-FSLHHRQPRLGRNPX 1 TGDSV (SEQ ID NO: ), wherein “X” is an optional amino acid linker sequence, optionally comprising, or consisting essentially of, or yet further consisting of between 1 to 20 amino acids; and wherein “X 1 ” is any amino acid or alternatively “X1” is selected from the amino acids Q, R, K, S, or T.
- X1 is a K or Q.
- the tip-chimeric peptide IhfA5- mIhfB4 NTHI comprises, or consists essentially of, or yet further consists of: a polypeptide sequence of RPGRNPKTGDVVPVSARRVV-X-FSLHHRQPRLGRNPKTGDSV (SEQ ID NO: ), wherein “X” is an optional amino acid linker sequence optionally comprising, or consisting essentially of, or yet further consisting of between 1 to 20 amino acids.
- the tip-chimeric peptide IhfA5-mIhfB4 NTHI comprises or consists essentially of, or yet further consists of: a polypeptide sequence of RPGRNPKTGDVVPVSARRVVGPSLFSLHHRQPRLGRNPKTGDSV (SEQ ID NO: , in some embodiments, which is referred to herein as the tip chimer).
- the tail-chimeric peptide IhfA3-IhfB2NTHI comprises, or consists essentially of, or yet further consists of: a polypeptide sequence of FLEEIRLSLESGQDVKLSGF-X- TLSAKEIENMVKDILEFISQ (SEQ ID NO: ), wherein “X” is an optional amino acid linker sequence optionally comprising, or consisting essentially of, or yet further consisting of between 1 to 20 amino acids.
- the linker is selected from any one or more those as disclosed herein.
- the tail-chimeric peptide IhfA3-IhfB2NTHI comprises, or consists essentially of, or yet further consists of FLEEIRLSLESGQDVKLSGFGPSLTLSAKEIENMVKDILEFISQ (SEQ ID NO: ).
- polypeptides are those disclosed as A1 to A4 and A6 and B1 to B6, disclosed below, which do not contain the conformation tip domain, and equivalents of these polypeptides from different organisms identified herein that produce a DNABII polypeptide.
- the sequences comprise: MATITKLDIIEYLSDKYHLS (also referred to herein as A1; (SEQ ID NO.
- KYHLSKQDTKNVVENFLEEI also referred to herein as A2; (SEQ ID NO. ); FLEEIRLSLESGQDVKLSGF (also referred to herein as A3; (SEQ ID NO. ); KLSGFGNFELRDKSSRPGRN (also referred to herein as A4; (SEQ ID NO. ); ARRVVTFKPGQKLRARVEKTK (also referred to herein as A6; (SEQ ID NO. ); MTKSELMEKLSAKQPTLSAK (also referred to herein as B1 (SEQ ID NO. ); TLSAKEIENMVKDILEFISQ (also referred to herein as B2 (SEQ ID NO.
- Non-limiting examples of DNABII polypeptides include an IHF or HU alpha or beta polypeptide; an IHF alpha polypeptide; Moraxella catarrhalis HU; E.
- polypeptides that comprise, or alternatively consist essentially of, or yet further consist of, between 3 and 5 conformational tip domains that can be produced by the same or different bacterial species, the amino acids sequences of which can be the same (e.g., all A5 amino acid sequences) or at least 2 or at least 3 or at least 4 or all 5 having different amino acid sequences (e.g., various combinations of A5 and mB4 and equivalents and NPX 1 T containing fragments of each thereof), wherein X1 is any amino acid, or in one aspect, an amino selected from the amino acids Q, R, K, S, or T.
- the conformational tip domains in the recombinant polypeptides can be in a linear or branched conformation. They can further comprise a detectable and/or a purification label linked thereto.
- the structural orientation of the tip domains can be “head” to tail; tail to head wherein the polypeptide comprises 3 or more tip domains, any combination of head to tails, e.g., head-head-head; tail-head-heard; tail-head-tail, wherein the amine terminus of the wild- type sequence is the “head” and the carboxy terminus of the wild-type sequence is the “tail” of the polypeptide.
- the polypeptides in sum can be between 41 and 120 amino acids in length.
- Non-limiting examples of equivalent polypeptides include a polypeptide having at least 60%, or alternatively at least 65%, or alternatively at least 70%, or alternatively at least 75%, or alternatively 80%, or alternatively at least 85%, or alternatively at least 90%, or alternatively at least 95% identity thereto or for polypeptide sequences, or a polypeptide which is encoded by a polynucleotide or its complement that hybridizes under conditions of high stringency to a polynucleotide encoding such polypeptide sequences. Conditions of high stringency are described herein and incorporated herein by reference.
- equivalent polypeptides include, for example DKSSRPGRNPX 1 TGDVVAASARR (SEQ ID NO.: ), wherein “X1” is any amino acid or alternatively “X1” is selected from the amino acids Q, R, K, S, or T.
- Equivalent polypeptides, one kind of biologically active fragment also include a polypeptide consisting of, or comprising the above noted polypeptides with the addition of up to 25, or alternatively 20, or alternatively 15, or alternatively up to 10, or alternatively up to 5 random amino acids on either the amine or carboxy termini (or on both).
- polypeptide in another aspect, includes a polypeptide consisting of, or comprising the above noted polypeptides with the addition of up to 25, or alternatively 20, or alternatively 15, or alternatively up to 10, or alternatively up to 5 amino acids on either the amine or carboxy termini (or on both) selected from the adjacent amino acids of the corresponding wild-type sequence and equivalents of the wild-type adjacent amino acids.
- the anti-DNABII antibody or biologically active fragment thereof recognizes and binds to a DNABII or a biologically active fragment thereof, optionally selected from one or more of: a DNABII A5 peptide, a DNABII mB4 peptide, or a recombinant polypeptide comprising the A5 and the mB4 peptides (i.e., the tip chimer).
- a biologically active fragment of the DNABII has at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99%, or at least about 100%, or at least 1.5 folds, or at least 2 folds, or at least 3 folds, or at least 4 folds, or at least 5 folds, or at least 6 folds, or at least 7 folds, or at least 8 folds, or at least 9 folds, or at least 10 folds, or at least 20 folds, or at least 50 folds, or at least 100 folds, or more of the biological activity of a reference anti-DNABII antibody.
- the biological activity comprises, or consists essentially of, or yet further consists of specifically recognizing and binding a DNABII or a biologically active fragment thereof.
- Such biological activity can be measured by one of skill in the art via, for example, quantifying DNABII affinity and/or specificity of the antibody and/or competitive binding a DNABII or a biologically active fragment compared to a reference antibody.
- the biological activity here comprises, or consists essentially of, or yet further consists of one or more of: preventing, inhibiting, disrupting, dispersing or treating a biofilm in a subject.
- Suitable anti-DNABII antibodies or biologically active fragments thereof can be found in US Patent No.11,104,723, WO2014/201305, WO2017/023863, WO2017/066719, WO2018/129092, WO2018/129078, and PCT Publication No. WO 2021/007260, each of which is enclosed herein by reference in its entirety.
- Non-limiting examples of anti-IHF antibodies are described herein, and in one aspect, is one or more of an antibody that specifically recognizes and binds a polypeptide identified herein, or the Arm fragment identified therein (identified above) , or an equivalent of such polypeptide or a polynucleotide or polypeptide comprising one or more of the sequences: : TCTCAACGATTTA (SEQ ID NO. ); WATCAANNNNTTR (where W is A or T, N is any nucleotide and R is a A or G; (SEQ ID NO. ); MATITKLDIIEYLSDKYHLS (also referred to herein as hIFA1; (SEQ ID NO.
- KYHLSKQDTKNVVENFLEEI also referred to herein as hIFA2; (SEQ ID NO. ); FLEEIRLSLESGQDVKLSGF (also referred to herein as hIFA3; (SEQ ID NO. ); KLSGFGNFELRDKSSRPGRN (also referred to herein as hIFA4; (SEQ ID NO. ); RPGRNPKTGDVVPVSARRVV (also referred to herein as hIFA5; (SEQ ID NO. ); ARRVVTFKPGQKLRARVEKTK (also referred to herein as hIFA6; (SEQ ID NO.
- polypeptide sequences which is encoded by a polynucleotide or its complement that hybridizes under conditions of high stringency to a polynucleotide encoding such polypeptide sequences.
- Conditions of high stringency are described above and incorporated herein by reference. Applicants have determined that the bolded and underlined amino acids are heavily conserved and therefore in one aspect, are not modified or altered in designing an equivalent polypeptide.
- polypeptides include, for example a polypeptide consisting of or comprising the above noted polypeptides with the addition of up to 25, or alternatively 20, or alternatively 15, or alternatively up to 10, or alternatively up to 5 random amino acids on either the amine or carboxy termini (or on both).
- the disclosure relates to an antibody or antigen binding fragment that specifically recognizes or binds an isolated or recombinant polypeptide consisting essentially of an amino acid sequence selected from: Phe Leu Glu Glu Ile Arg Leu Ser Leu Glu Ser Gly Gln Asp Val Lys Leu Ser Gly Phe (SEQ ID NO: 64), FSLHHRQPRLGRNPKTGDSV (SEQ ID NO: 65), VNERAARTGRNPQTGAEIQIAA (SEQ ID NO: 66), Lys Lys Gln Ala Lys Ala Ala Leu Glu Ala Thr Leu Asp Ala Ile Thr Ala Ser Leu Lys Glu Gly (SEQ ID NO.67), a polypeptide comprising the amino acid sequence NPXT, or an equivalent of each thereof.
- the isolated or recombinant polypeptide comprises at least 15, or alternatively at least 18, or alternatively at least 20 amino acids in total.
- the NPXT sequence is not the terminal amino acids of the polypeptide.
- the antibody or antigen binding fragment is not a polyclonal antibody.
- antibodies can be generated against the “tip” region of a DNABII protein, that in one aspect contains or is altered to contain turn of the antiparallel beta ribbon and/or the sequence NPXT, wherein “X” refers to any amino acid.
- X is selected from the amino acids Q, R, K, S, or T.
- Such antibodies may be generated using a fragment of the DNABII protein comprising the NPXT sequence, optionally flanked by between about 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16 amino acids on one or both sides of said sequence. Non-limiting examples of such are disclosed herein with the consensus amino acid sequence NPXT, in underlined and bolded text.
- antibodies may be generated against the tip region of a DNABII protein providing the consensus sequence NPXT, wherein “X” is any amino acid or alternatively X is selected from the amino acids Q, R, K, S, or T.
- the residue in the X position may be substituted with any amino acid – e.g., Q, R, K, S, or T.
- Examples include: SEQ ID NO.68: Haemophilus influenzae IhfA, A5 fragment: RPGRNPKTGDVVPVSARRVV. SEQ ID NO.69: Haemophilus influenzae HU, A5 fragment: RTGRNPQTGAEIQIAASKVP. SEQ ID NO.65: Haemophilus influenzae IhfB, modified B4 (mB4) fragment: FSLHHRQPRLGRNPKTGDSV.
- SEQ ID NO.70 Haemophilus influenzae IhfA, A tip fragment: NFELRDKSSRPGRNPKTGDVV.
- SEQ ID NO. 71 Haemophilus influenzae IhfB, B tip fragment: SLHHRQPRLGRNPKTGDSVNL.
- the polypeptide comprising NPXT is at least about 20 amino acids long and the NPXT is centrally in the sequence.
- Non-limiting examples of such sequences include SEQ ID NOs. 68, 69, and 66.
- the polypeptides having the NPXT motif e.g., as noted above
- Applicants have determined that antibodies raised against DNABII polypeptides lacking the NPXT motif are useful in diagnostic methods to image and monitor biofilm formation and/or disruption.
- kits comprising an antibody raised against or that binds a DNABII having the NPXT motif and an antibody raised against or binds a DNABII (e.g. a modified or naturally occurring polypeptide) that lacks the NPXT motif.
- a kit can comprise an antibody that recognizes and bind the polypeptide A5, B4, or mB4 (therapeutic) can be combined in a kit with an antibody that recognizes and bind the polypeptide A3 or B2 (diagnostic). The kit is useful for diagnosis, treatment and monitoring biofilm treatment.
- the disclosure relates to an antibody or antigen binding fragment that specifically recognizes or binds an isolated or recombinant polypeptide that comprises or consisting essentially of an amino acid sequence selected from: SEQ ID NOs. 64 to 65, SEQ ID NO. 66, SEQ ID NO. 67, a polypeptide comprising the amino acid sequence NEXT, or an equivalent each thereof.
- the antibody or antigen binding fragment is not a polyclonal antibody.
- Non-limiting exemplary antibodies produced by the disclosed hybridomas are disclosed in Table below. The hybridoma cell lines that produce monoclonal antibodies that specifically recognize and bind Haemophilus influenzae IhfA fragment A5 (SEQ ID NO.
- IhfB fragment B4 Arg Gly Phe Gly Ser Phe Ser Leu His His Arg Gin Pro Arg Leu Gly Arg Asn Pro Lys, SEQ ID NO. 72
- IhfB fragment mB4 SEQ ID NO. 65
- Non-limiting exemplary antibodies include those that specifically recognize and bind Haemophilus influenzae IhfA fragment A3 (SEQ ID NO.64) or IhfB fragment B2 (Thr Leu Ser Ala Lys Glu Ile Glu Asn Met Val Lys Asp Ile Leu Glu Phe Ile Ser Gln SEQ ID NO.73) produced by hybridoma cell lines IhfA3 NTHI 9B10.F2.H3, IhfB2 NTHI 7A4.E4.G4, and IhfB2 NTHI 7A4.E4.G11 (these hybridomas were deposited with American Type Culture Collection (ATCC) under the Accession Numbers listed in Table below and pursuant to the provisions of the Budapest Treaty on August 1, 2016); and an antibody that specifically recognizes or binds a polypeptide comprising SEQ ID NO.66, SEQ ID NO.67, a polypeptide comprising the amino acid sequence NPXT, or an equivalent of each thereof.
- ATCC American Type Culture Collection
- the present disclosure provides an isolated antibody that is at least 85% identical to an antibody selected from the group consisting of (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- the present disclosure provides an isolated antibody comprising the CDRs of (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, or (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- the present disclosure provides an isolated antibody that has CDR that are at least 85% identical to (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, or (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- the HC variable domain sequence comprises the HC variable domain sequence of (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, or (iii) the antibody produced by hybridoma cell line MIhfB4 NTHI 12E6.F8.D12.D5; and/or the LC variable domain sequence comprises the LC variable domain sequence of (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, or (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- the HC variable domain sequence comprises a HC variable domain sequence at least 85% identical to a HC variable domain sequence of (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5; and/or the LC variable domain sequence comprises a LC variable domain sequence at least 85% identical to the of LC variable domain sequence (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6
- the present disclosure provides an isolated antibody comprising a heavy chain (HC) variable domain sequence and a light chain (LC) variable domain sequence, wherein the heavy chain and light chain immunoglobulin variable domain sequences form an antigen binding site that binds to an epitope of a DNABII protein.
- HC heavy chain
- LC light chain
- the heavy chain variable region comprises a CDRH1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRH1 of any one of the following antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- the heavy chain variable region comprises a CDRH2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRH2 of any one of the following antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- the heavy chain variable region comprises a CDRH3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRH3 of any one of the following antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence comprising the heavy chain variable region sequence of any one of the following antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- the light chain variable region comprises a CDRL1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRL1 of any one of the following antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- the light chain variable region comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRL2 of any one of the following antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- the light chain variable region comprises a CDRL3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising the CDRL3 of any one of the following antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5 [0253]
- the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the polynucleotide sequence comprising the light chain variable region sequence of any one of the following antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybrid
- the heavy chain variable region of the antibody or fragment thereof of comprises a CDRH1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising FSLTSYS (SEQ ID NO.), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of FSLTSYSV (SEQ ID NO.), FSLTSYSVH (SEQ ID NO. ), GFSLTSYS (SEQ ID NO.), or a biological equivalent each thereof.
- FSLTSYS SEQ ID NO.
- the heavy chain variable region of the antibody or fragment thereof comprises a CDRH1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising FNIKDYY (SEQ ID NO. 110), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of FNIKDYYM (SEQ ID NO.), FNIKDYYMH (SEQ ID NO.), GFNIKDYY (SEQ ID NO.), or a biological equivalent each thereof.
- the heavy chain variable region of the antibody or a fragment thereof comprises a CDRH2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising IWAGGST (SEQ ID NO. ), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of VIWAGGST (SEQ ID NO. ), GVIWAGGST (SEQ ID NO. ), LGVIWAGGST (SEQ ID NO. ), WLGVIWAGGST (SEQ ID NO. ), IWAGGSTN (SEQ ID NO. ), VIWAGGSTN (SEQ ID NO. ), GVIWAGGSTN (SEQ ID NO. ), GVIWAGGSTN (SEQ ID NO. ), GVIWAGGSTN (SEQ ID NO. ),
- LGVIWAGGSTN SEQ ID NO.
- WLGVIWAGGSTN SEQ ID NO.
- IWAGGSTNY SEQ ID NO.
- VIWAGGSTNY SEQ ID NO.
- GVIWAGGSTNY SEQ ID NO.
- LGVIWAGGSTNY SEQ ID NO.
- WLGVIWAGGSTNY SEQ ID NO.
- the heavy chain variable region of the antibody or a fragment thereof comprises a CDRH2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising IDPENDDT (SEQ ID NO.), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of WIDPENDDT (SEQ ID NO.
- GWIDPENDDT SEQ ID NO.
- IGWIDPENDDT SEQ ID NO.
- WIGWIDPENDDT SEQ ID NO.
- IDPENDDTE SEQ ID NO.
- WIDPENDDTE SEQ ID NO.
- GWIDPENDDTE SEQ ID NO.
- IGWIDPENDDTE SEQ ID NO.
- WIGWIDPENDDTE SEQ ID NO.
- IDPENDDTEY SEQ ID NO.
- WIDPENDDTEY SEQ ID NO.
- GWIDPENDDTEY SEQ ID NO.
- IGWIDPENDDTEY SEQ ID NO.
- WIGWIDPENDDTEY SEQ ID NO.
- the heavy chain variable region of the antibody or a fragment thereof comprises a CDRH3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising REDS (SEQ ID NO. ), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of AREDS (SEQ ID NO. ) or a biological equivalent thereof.
- the heavy chain variable region of the antibody or a fragment thereof comprises a CDRH3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising TELGAY (SEQ ID NO. ) or a biological equivalent thereof.
- the heavy chain variable region of the antibody or a fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below noted polynucleotide sequences: Gaggtgcagctgcaggagtctggacctggcctggtgacgccctcacagagcctgtccatgacttgcactgtctctgggttttcattaac cagctatagtgtacactgggttcgccagcctccaggaaagagtctggagtggctgggagtaatatgggctggtggaagcacaaattat aattcggctctcatgtccagactgagcatcagcaaagacaactccaagagccaagttttcttaaaatggacagtctgcaaactgatgac acagccatatact
- the heavy chain variable region of the antibody or a fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence: EVQLQESGPGLVTPSQSLSMTCTVSGFSLTSYSVHWVRQPPGKSLEWLGVIWAGGST NYNSALMSRLSISKDNSKSQVFLKMDSLQTDDTAIYYCAREDSWGQGTSVTVSS (SEQ ID NO. ) or a biological equivalent thereof.
- the heavy chain variable region of the antibody or a fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below noted polynucleotide sequences: Gaggtgcagctgcaggagtctggggcagagcttgtgaggtcaggggcctcagtcaagttgtcctgcacagcttctggcttcaacatta aagactactatatgcactgggtgaagcagaggcctgaacagggcctggagtggattggatggattgatcctgaaaatgatgatactga atatgtcccgaagttccagggcaaggccagtatgactgcagacacatcctccaacacagcctacctgcagctcagcagcctgacatct gaggacactgccgtcgtc
- the heavy chain variable region of the antibody or a fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence: EVQLQESGAELVRSGASVKLSCTASGFNIKDYYMHWVKQRPEQGLEWIGWIDPEND DTEYVPKFQGKASMTADTSSNTAYLQLSSLTSEDTAVYYCTELGAYWGQGTLV (SEQ ID NO. ) or a biological equivalent thereof.
- the light chain variable region of the antibody or a fragment thereof comprises a CDRL1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising QNVGTN (SEQ ID NO. ), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of QNVGTNV (SEQ ID NO. ), QNVGTNVA (SEQ ID NO. ), or a biological equivalent each thereof.
- QNVGTN SEQ ID NO.
- the light chain variable region of the antibody or a fragment thereof comprises a CDRL1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising QSLLDSNGKTY (SEQ ID NO.), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of QSLLDSNGKTYL (SEQ ID NO.), QSLLDSNGKTYLN (SEQ ID NO.), or a biological equivalent each thereof.
- the light chain variable region of the antibody or a fragment thereof comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising SAS (SEQ ID NO.), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of YSAS (SEQ ID NO.), IYSAS (SEQ ID NO.), LIYSAS (SEQ ID NO.), ALIYSAS (SEQ ID NO.), SASY (SEQ ID NO.), YSASY (SEQ ID NO.), IYSASY (SEQ ID NO.), LIYSASY (SEQ ID NO.), ALIYSASY (SEQ ID NO.), SASYR (SEQ ID NO.), YSASYR (SEQ ID NO.), IYSASYR (SEQ ID NO.), LIYSASYR (SEQ ID NO.), ALIYSASYR (SEQ ID NO.), SASYRY (SEQ ID NO.), SEQ ID
- the light chain variable region of the antibody or a fragment thereof comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising LVS (SEQ ID NO.), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of YLVS (SEQ ID NO.), IYLVS (SEQ ID NO.), LIYLVS (SEQ ID NO.), RLIYLVS (SEQ ID NO.), LVSK (SEQ ID NO.), YLVSK (SEQ ID NO.), IYLVSK (SEQ ID NO.), LIYLVSK (SEQ ID NO.), RLIYLVSK (SEQ ID NO.), LVSKL (SEQ ID NO.), YLVSKL (SEQ ID NO.), IYLVSKL (SEQ ID NO.), LIYLVSKL (SEQ ID NO.), RLIYLVSK (SEQ ID NO.), LVSKL (SEQ ID NO.), YLVSKL (SEQ
- the light chain variable region of the antibody or a fragment thereof comprises a CDRL3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising QQYNSYP (SEQ ID NO.), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of QQYNSYPT (SEQ ID NO.), or a biological equivalent thereof.
- the light chain variable region of the antibody or a fragment thereof comprises a CDRL3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence comprising WQSTHFPH (SEQ ID NO.), such as but not limited to an amino acid sequence beginning with, ending with, or consisting essentially of WQSTHFPHT (SEQ ID NO.) or a biological equivalent thereof.
- the light chain variable region of the antibody or fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the polynucleotide sequence: gacattgtgatgacccagtctcaaaaattcatgtccacatcagtaggagacagggtcagcgtcacctgcaaggccagtcagaatgtgg gtactaatgtagcctggtatcaacagaaaccagggcaatctcctaaagcactgatttactcggcatcctaccggtacagtggagtccctg atcgcttcacaggcagtggatctgggacagatttcactctcaccatcagcaatgtgcagtctgaagacttggcagagtatttctgtcagc aatataacagctatcccacgttcggagggggggggggggggggga
- the light chain variable region of the antibody or fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence: DIVMTQSQKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYSASYRYS GVPDRFTGSGSGTDFTLTISNVQSEDLAEYFCQQYNSYPTFGGGTKLEIK (SEQ ID NO.) or a biological equivalent thereof.
- the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the polynucleotide sequence: Gatgttgtgatgacccagattccactcacttttgtcggttaccattggacaaccagcctccatctcttgcaagtcaagtcagagcctcttag atagtaatggaaagacatatttgaattggttgtttcagaggccaggccagtctccaaagcgcctaatctatctggtgtctaaactggactct ggagtccctgacaggttcactggcagtggatcagggacagatttcacactgaaaatcagcagagttgaggctgaggatttgggaattta ttggcaaagttggcacagagttgaggct
- the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence: DVVMTQIPLTLSVTIGQPASISCKSSQSLLDSNGKTYLNWLFQRPGQSPKRLIYLVSKL DSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQSTHFPHTFGGGTKLEIK (SEQ ID NO.) or a biological equivalent thereof.
- SEQ ID NO. amino acid sequence: DVVMTQIPLTLSVTIGQPASISCKSSQSLLDSNGKTYLNWLFQRPGQSPKRLIYLVSKL DSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQSTHFPHTFGGGTKLEIK
- Alternate CDR predictions may be made based on the heavy and/or light chain sequences – e.g., based on the Kabat, Clothia, AbM, or contact definitions of CDR specificity; details of these CDR prediction methods are known in the art (see, e.g., bioinf.org.uk/abs/#cdrid) and/or commercially available. Those disclosed in Table are the result of utilizing the CDR prediction algorithms provided by the Ofran Lab (Paratome available at ofranservices.biu.ac.il/site/services/paratome/index.html) and Green Mountain Antibodies’ CDR prediction program.
- the present disclosure provides an isolated antibody that is at least 85%, or alternatively at least 90%, or alternatively at least 95 %, identical to an antibody selected from the group consisting of Ihf A5, Ihf mB4, or a biological equivalent each thereof.
- the present disclosure provides an isolated antibody comprising the CDRs of Ihf A5.
- the present disclosure provides an isolated antibody that is at least 85%, or alternatively at least 90%, or alternatively at least 95 %, identical to Ihf A5 or a biological equivalent thereof.
- the present disclosure provides an isolated antibody comprising the CDRs of Ihf mB4.
- the present disclosure provides an isolated antibody that is at least 85%, or alternatively at least 90%, or alternatively at least 95 %, identical to Ihf mB4 or a biological equivalent thereof.
- the HC variable domain sequence comprises a variable domain sequence of Ihf A5 and the LC variable domain sequence comprises a variable domain sequence of Ihf A5.
- the HC variable domain sequence comprises a variable domain sequence of Ihf mB4 and the LC variable domain sequence comprises a variable domain sequence of Ihf mB4.
- the isolated antibody includes one or more of the following characteristics: (a) the light chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85%, or alternatively at least 90%, or alternatively at least 95 % identical to a CDR of a light chain variable domain of any of the disclosed light chain sequences; (b) the heavy chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% , or alternatively at least 90%, or alternatively at least 95 % identical to a CDR of a heavy chain variable domain of any of the disclosed heavy chain sequences; (c) the light chain immunoglobulin variable domain sequence is at least 85% , or alternatively at least 90%, or alternatively at least 95 % identical to a light chain variable domain of any of the disclosed light chain sequences; (d) the HC immunoglobulin variable domain sequence is at least 85% , or alternatively at least 90%, or alternatively at least 95 % identical to a heavy chain variable domain of any of the disclosed light chain sequences; (d) the
- the antibodies comprise a heavy chain constant region that is at least 80% identical to the heavy chain constant region sequence of any one of the following antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- the antibodies comprise a light chain constant region that is at least 80% identical to the light chain constant region sequence of any one of the following antibodies: (i) the antibody produced by hybridoma cell line IhfA5 NTHI 14G8.F5.G6, (ii) the antibody produced by hybridoma cell line IhfB4 NTHI 4E11.E5.G2, and (iii) the antibody produced by hybridoma cell line mIhfB4 NTHI 12E6.F8.D12.D5.
- Non-limiting exemplary antibodies include those disclosed herein, for example those generated against the disclosed polypeptide fragments, including but not limited to:
- This disclosure provides an antibody fragment (e.g., a Fab fragment or an antigen binding fragment).
- This disclosure also provides an isolated polypeptide that comprises, or alternatively consists essentially of, or yet further consists of the amino acid sequence of the Fab fragment or antigen binding fragment (e.g., a Fab fragment) wherein the fragment or the polypeptide binds and/or specifically recognizes a DNABII polypeptide and/or biofilm component comprising a DNABII protein or polypeptide.
- the present disclosure provides an isolated antibody comprising a heavy chain (HC) variable domain sequence and a light chain (LC) variable domain sequence, wherein the heavy chain and light chain immunoglobulin variable domain sequences form an antigen binding site that binds to an epitope of a DNABII protein.
- the antibody or fragment thereof binds to a DNABII peptide (such as the tip region of the DNABII peptide including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, and/or the tip-chimeric peptide IhfA5-mIhfB4NTHI; and/or the tail region of the DNABII peptide, including but not limited to: a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3-IhfB2 NTHI ).
- a DNABII peptide such as the tip region of the DNABII peptide including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3-IhfB2 NTHI.
- the antibody or fragment thereof binds to the tip-chimeric peptide IhfA5-mIhfB4NTHI. In another embodiment, the antibody or fragment thereof binds to the tail-chimeric peptide IhfA3- IhfB2 NTHI .
- antibodies and antigen binding fragments thereof that comprise, or consist essentially of or yet consist of, a heavy chain (HC) immunoglobulin variable domain sequence comprising, consisting essentially of, or consisting of, a sequence selected from the group of amino acid (aa) 25 to aa 144 of SEQ ID NOs: 1-6, 13, 24 or 26 or an equivalent of each thereof; and/or a light chain (LC) immunoglobulin variable domain sequence comprising, consisting essentially of, or consisting of, a sequence selected from the group of aa 21 to aa 132 of SEQ ID NOs: 7-9, 14 or 25, aa 21 to aa 126 of SEQ ID NOs: 10- 12 or 27, or an equivalent of each thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or consist essentially of or yet consist of, a heavy chain (HC) comprising, consisting essentially of, or consisting of, a sequence selected from the group of aa 25 to aa 473 of SEQ ID NOs: 1-6, 13, 24 or 26 or an equivalent of each thereof; and/or a light chain (LC) comprising, consisting essentially of, or consisting of, a sequence selected from the group of aa 21 to aa 239 of SEQ ID NOs: 7-9, 14, or 25, aa 21 to aa 233 of SEQ ID NOs: 10- 12 or 27, or an equivalent of each thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or consist essentially of or yet consist of, a heavy chain (HC) comprising, consisting essentially of, or consisting of, a sequence selected from the group of SEQ ID NOs: 1-6, 13, 24 or 26 or an equivalent of each thereof; and/or a light chain (EC) comprising, consisting essentially of, or consisting of, a sequence selected from the group of SEQ ID NOs: 7-12, 14, 25, or 27, or an equivalent of each thereof.
- HC heavy chain
- EC light chain
- antibodies and antigen binding fragments thereof that comprise, or consist essentially of or yet consist of, a heavy chain (HC) immunoglobulin variable domain sequence comprising, consisting essentially of, or consisting of, a sequence selected from the group of amino acid (aa) 25 to 144 of SEQ ID NO: 1-6, 13, 24 or 26, or an equivalent thereof; and/or a light chain (EC) immunoglobulin variable domain sequence comprising, consisting essentially of, or consisting of, a sequence selected from the group of aa 21 to aa 132 of SEQ ID NO: 6-9, 14 or 25, aa 21 to aa 126 of SEQ ID NOs: 10-12, or 27, or an equivalent of each thereof.
- HC heavy chain
- EC light chain
- an antibody or a fragment thereof that comprises or consists essentially of, or yet further consists of: any one or any two or all three CDRs of a sequence selected from the group of: SEQ ID NOs: 1-6, 13, 24 or 26, or an equivalent of each thereof; and/or any one or any two or all three CDRs of a sequence selected from the group of: SEQ ID NOs: 7-12, 14, 25 or 27, or an equivalent of each thereof.
- antibodies and antigen binding fragments thereof that comprise, or consist essentially of or yet consist of, a heavy chain (HC) immunoglobulin variable domain sequence comprising, consisting essentially of, or consisting of a sequence selected from the group of aa 25 to aa 144 of SEQ ID NO: 13, 24 or 26, or an equivalent thereof; and a light chain (EC) immunoglobulin variable domain sequence comprising, consisting essentially of, or consisting of, a sequence selected from the group of aa 21 to aa 132 of SEQ ID NOs: 14 or 25, aa 21 to aa 126 of SEQ ID NO: 27, or an equivalent thereof.
- HC heavy chain
- EC light chain
- antibodies and antigen binding fragments thereof that comprise, or consist essentially of or yet consist of, a heavy chain (HC) immunoglobulin variable domain sequence comprising, consisting essentially of, or consisting of a sequence selected from the group of aa 25 to aa 144 of SEQ ID NOs: 1-6, 13, 24 or 26, or an equivalent of each thereof; and/or a light chain (EC) immunoglobulin variable domain sequence comprising, consisting essentially of, or consisting of a sequence selected from the group of aa 21 to aa 132 of SEQ ID NOs: 7-9, 14 or 25, aa 21 to aa 126 of SEQ ID NOs: 10-12 or 27, or an equivalent of each thereof.
- HC heavy chain
- EC light chain
- antibodies and antigen binding fragments thereof that comprise, or consist essentially of, or yet consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 1 or an equivalent thereof and a light chain (LC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of any one of aa 21 to aa 132 of SEQ ID NOs: 7-9, 14 or 25, aa 21 to aa 126 of SEQ ID NOs: 10-12 or 27,or an equivalent of each thereof.
- HC heavy chain
- LC light chain
- antibodies or fragments thereof comprising, or alternatively consisting essentially, or consisting of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 2 or an equivalent thereof and a light chain (LC) immunoglobulin variable domain sequence that comprises, consists essentially of, or alternatively consists of, an amino acid sequence of any one of aa 21 to aa 132 of SEQ ID NOs: 7-9, 14 or 25, aa 21 to aa 126 of SEQ ID NOs: 10-12 or 27, or an equivalent of each thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or consist essentially of, or yet consist of, a heavy chain (HC) immunoglobulin variable domain sequence comprises, consisting essentially of, or consisting of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 3 or an equivalent thereof and a light chain (LC) immunoglobulin variable domain sequence comprises, consisting essentially of, or consisting of, an amino acid sequence of any one of aa 21 to aa 132 of SEQ ID NOs: 7-9, 14 or 25, aa 21 to aa 126 of SEQ ID NOs: 10-12 or 27, or an equivalent of each thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or consist essentially of, or yet consist of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 4 or an equivalent thereof and a light chain (LC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of any one of aa 21 to aa 132 of SEQ ID NOs: 7-9, 14 or 25, aa 21 to aa 126 of SEQ ID NOs: 10-12 or 27, or an equivalent of each thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof comprising, or alternatively consisting essentially of, or yet consisting of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 5 or an equivalent thereof and a light chain (LC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of any one of aa 21 to aa 132 of SEQ ID NOs: 7-9, 14 or 25, aa 21 to aa 126 of SEQ ID NOs: 10-12 or 27, or an equivalent of each thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof comprising, or alternatively consisting essentially or consisting of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 6 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of any one of aa 21 to aa 132 of SEQ ID NOs: 7-9, 14 or 25, aa 21 to aa 126 of SEQ ID NOs: 10-12 or 27, or an equivalent of each thereof.
- HC heavy chain
- LC light chain
- antibodies or antigen binding fragments thereof that comprise, or consisting essentially of, or consisting of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of an amino acid sequence of aa 25 to aa 144 of any one of SEQ ID NOs: 1-6, 13, 24 or 26, or an equivalent of each thereof, and a light chain (LC) immunoglobulin variable domain sequence comprises, consisting essentially of, or consisting of, an amino acid sequence of aa 21 to aa 132 of SEQ ID NO 7, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies or antigen binding fragments thereof comprising, or consisting essentially of, or yet further consisting of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of aa 25 to aa 144 of any one of SEQ ID NOs: 1-6, 13, 24 or 26 or an equivalent of each thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 8, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies or antigen binding fragments thereof that comprise, or consist essentially of, or yet further consist of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of aa 25 to aa 144 of any one of SEQ ID NOs: 1- 6, 13, 24 or 26, or an equivalent of each thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, consisting essentially of, or consisting of, an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 9, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies or antigen binding fragments thereof that comprise, or consist essentially of, or yet further consist of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or alternatively consists essentially of, or yet further consists of, an amino acid sequence of aa 25 to aa 144 of any one of SEQ ID NOs: 1-6, 13, 24 or 26, or an equivalent of each thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, or consists essentially of, or yet further consists of, an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 10, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or consist essentially of, or yet further consist of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consist essentially of, or yet further consists of, an amino acid sequence of aa 25 to aa 144 of any one of f SEQ ID NOs: 1-6, 13, 24 or 26, or an equivalent of each thereof, and a light chain (LC) immunoglobulin variable domain that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 11, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof comprising, or consisting essentially of, or yet further consisting of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consisting of, an amino acid sequence of aa 25 to aa 144 of any one of SEQ ID NOs: 1-6, 13, 24 or 26, or an equivalent of each thereof, and the light chain (LC) immunoglobulin variable domain sequence comprises an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 12, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof are provided, that comprise or alternatively consist essentially of, or yet further consist of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or alternatively consists essentially of, or yet further consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 1 or an equivalent thereof and a light chain (LC) immunoglobulin variable domain sequence that comprises, or alternatively consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 7, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof are provided, that comprise or alternatively consist essentially of, or yet further consist of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or alternatively consists essentially of, or yet further consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 1 or an equivalent thereof and a light chain (LC) immunoglobulin variable domain sequence that comprises, or alternatively consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 8, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of, a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 1 or an equivalent thereof and a light chain (LC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 9, or an equivalent thereof.
- the antibodies or antigen binding fragments are anti tip chimer (i.e., specifically binding and recognizing the tip chimer).
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or alternatively consists essentially thereof, or consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 2 or an equivalent thereof and a light chain (LC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, of consists of, an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 7, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence comprises an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 2 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or yet further consists of, an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 8, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consisting essentially thereof, or consisting of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 2 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, consisting essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 9, or an equivalent thereof.
- the antibodies or antigen binding fragments are anti tip chimer (i.e., specifically binding and recognizing the tip chimer).
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 3 or an equivalent thereof and a light chain (LC) immunoglobulin variable domain sequence comprises, or consists of an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 7, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially of, or yet further consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 3 or an equivalent thereof, and the light chain (LC) immunoglobulin variable domain sequence comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 8, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 3 or an equivalent thereof and the light chain (LC) immunoglobulin variable domain sequence comprises an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 9, or an equivalent thereof.
- the antibodies or antigen binding fragments are anti tip chimer (i.e., specifically binding and recognizing the tip chimer).
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 4 or an equivalent thereof and a light chain (LC) immunoglobulin variable domain sequence comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 10, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 4 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 11, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 4 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists thereof, an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 12, or an equivalent thereof.
- the antibodies or antigen binding fragments are anti tail chimer (i.e., specifically binding and recognizing the tail chimer).
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 5 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 10, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 5 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 11, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 5 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 12, or an equivalent thereof.
- the antibodies or antigen binding fragments are anti tail chimer (i.e., specifically binding and recognizing the tail chimer).
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 6 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 10, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, or consisting essentially thereof, or consists thereof, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 6 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, or consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 11, or an equivalent thereof.
- HC heavy chain
- LC light chain
- antibodies and antigen binding fragments thereof that comprise, or alternatively consist essentially thereof, or consist of a heavy chain (HC) immunoglobulin variable domain sequence that comprises, consisting essentially thereof, or consisting of, an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 6 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence that comprises, consists essentially thereof, or consists of, an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 12, or an equivalent thereof.
- the antibodies or antigen binding fragments are anti tail chimer (i.e., specifically binding and recognizing the tail chimer).
- an antibody or a fragment thereof that comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 24 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 25 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof binds to a tip region of a DNABII peptide (including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, and/or the tip-chimeric peptide IhfA5- mIhfB4 NTHI ). In one embodiment, the antibody or fragment thereof binds to the tip-chimeric peptide IhfA5-mIhfB4NTHI. In yet a further embodiment, the fragment is an antigen binding fragment. In some embodiments, the antibodies or antigen binding fragments are anti tip chimer (i.e., specifically binding and recognizing the tip chimer).
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 1 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 7 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 1 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 8 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 1 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 9 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 2 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 132 of SEQ ID of NO: 7 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 2 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 8 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a the heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 2 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 9 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 3 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 7 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 3 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 8 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 3 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 132 of SEQ ID NO: 9 or an equivalent thereof.
- HC heavy chain
- LC light chain
- an antibody or a fragment thereof that comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 26 or an equivalent thereof, and a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 27 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof binds to a tail region of a DNABII peptide (including but not limited to: a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3- IhfB2 NTHI ).
- the antibody of fragment thereof binds to the tail-chimeric peptide IhfA3-IhfB2NTHI.
- the fragment is an antigen binding fragment.
- the antibodies or antigen binding fragments are anti tail chimer (i.e., specifically binding and recognizing the tail chimer).
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 4 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 10 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 4 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 11 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 4 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 12 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 5 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 10 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 5 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 11 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 5 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 12 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 6 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 10 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 6 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 11 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 144 of SEQ ID NO: 6 or an equivalent thereof, and/or a light chain (LC) immunoglobulin variable domain sequence comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 126 of SEQ ID NO: 12 or an equivalent thereof.
- HC heavy chain
- LC light chain
- an antibody or a fragment thereof that comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 24 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 25 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof binds to a tip region of a DNABII peptide (including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, and/or the tip-chimeric peptide IhfA5-mIhfB4NTHI). In one embodiment, the antibody or fragment thereof binds to the tip-chimeric peptide IhfA5-mIhfB4 NTHI . In some embodiments, the antibodies or antigen binding fragments are anti tip chimer (i.e., specifically binding and recognizing the tip chimer). In yet a further embodiment, the fragment is an antigen binding fragment.
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 1 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 7 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 1 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 8 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 1 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 9 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 2 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID of NO: 7 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 2 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 8 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a the heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 2 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 9 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 3 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 7 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 3 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 8 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 3 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 9 or an equivalent thereof.
- HC heavy chain
- LC light chain
- an antibody or a fragment thereof that comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 26 or an equivalent thereof, and a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 27 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof binds to a tail region of a DNABII peptide (including but not limited to: a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3-IhfB2NTHI).
- the antibody of fragment thereof binds to the tail-chimeric peptide IhfA3-IhfB2 NTHI .
- the antibodies or antigen binding fragments are anti tail chimer (i.e., specifically binding and recognizing the tail chimer).
- the fragment is an antigen binding fragment.
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 4 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 10 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 4 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 11 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 4 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 12 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 5 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 10 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 5 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 11 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 5 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 12 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 6 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 10 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 6 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 11 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 6 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of SEQ ID NO: 12 or an equivalent thereof.
- HC heavy chain
- LC light chain
- an antibody or a fragment thereof that comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 24 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 239 of SEQ ID NO: 25 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof binds to a tip region of a DNABII peptide (including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, and/or the tip-chimeric peptide IhfA5- mIhfB4NTHI). In one embodiment, the antibody or fragment thereof binds to the tip-chimeric peptide IhfA5-mIhfB4 NTHI . In some embodiments, the antibodies or antigen binding fragments are anti tip chimer (i.e., specifically binding and recognizing the tip chimer). In yet a further embodiment, the fragment is an antigen binding fragment.
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 1 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 239 of SEQ ID NO: 7 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 1 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 239 of SEQ ID NO: 8 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 1 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 239 of SEQ ID NO: 9 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 2 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 239 of SEQ ID of NO: 7 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 2 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 239 of SEQ ID NO: 8 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a the heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 2 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 239 of SEQ ID NO: 9 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 3 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 239 of SEQ ID NO: 7 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 3 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 239 of SEQ ID NO: 8 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 3 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 239 of SEQ ID NO: 9 or an equivalent thereof.
- HC heavy chain
- LC light chain
- an antibody or a fragment thereof that comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 26 or an equivalent thereof, and a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 233 of SEQ ID NO: 27 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof binds to a tail region of a DNABII peptide (including but not limited to: a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3-IhfB2 NTHI ).
- the antibody of fragment thereof binds to the tail- chimeric peptide IhfA3-IhfB2NTHI.
- the antibodies or antigen binding fragments are anti tail chimer (i.e., specifically binding and recognizing the tail chimer).
- the fragment is an antigen binding fragment.
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 4 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 233 of SEQ ID NO: 10 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 4 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 233 of SEQ ID NO: 11 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 4 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 233 of SEQ ID NO: 12 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 5 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 233 of SEQ ID NO: 10 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 5 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 233 of SEQ ID NO: 11 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 5 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 233 of SEQ ID NO: 12 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 6 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 233 of SEQ ID NO: 10 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 6 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 233 of SEQ ID NO: 11 or an equivalent thereof.
- HC heavy chain
- LC light chain
- the antibody or fragment thereof comprises or consists essentially of, or yet further consists of: a heavy chain (HC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 25 to aa 473 of SEQ ID NO: 6 or an equivalent thereof, and/or a light chain (LC) comprising, or consisting essentially of, or yet further consisting of an amino acid sequence of aa 21 to aa 233 of SEQ ID NO: 12 or an equivalent thereof.
- HC heavy chain
- LC light chain
- an antibody or a fragment thereof that comprises or consists essentially of, or yet further consists of: any one or any two or all three CDRs of a sequence selected from the group of: SEQ ID NOs: 1-3 or 24, or an equivalent of each thereof; and/or any one or any two or all three CDRs of a sequence selected from the group of: SEQ ID NOs: 7-9 or 25, or an equivalent of each thereof.
- the antibody or fragment thereof binds to a tip region of a DNABII peptide (including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, and/or the tip-chimeric peptide IhfA5- mIhfB4 NTHI ). In one embodiment, the antibody or fragment thereof binds to the tip-chimeric peptide IhfA5-mIhfB4 NTHI . In some embodiments, the antibodies or antigen binding fragments are anti tip chimer (i.e., specifically binding and recognizing the tip chimer). In yet a further embodiment, the fragment is an antigen binding fragment.
- an antibody or a fragment thereof that comprises or consists essentially of, or yet further consists of: all three CDRs of a sequence selected from the group of: SEQ ID NOs: 1- 3 or 24, or an equivalent of each thereof; and/or all three CDRs of a sequence selected from the group of: SEQ ID NOs: 7-9 or 25, or an equivalent of each thereof.
- an antibody or a fragment thereof that comprises or consists essentially of, or yet further consists of: any one or any two or all three CDRs of a sequence selected from the group of: SEQ ID NOs: 4-6 or 26, or an equivalent of each thereof; and/or any one or any two or all three CDRs of a sequence selected from the group of: SEQ ID NOs: 10-12 or 27, or an equivalent of each thereof.
- the antibody or fragment thereof binds to a tail region of a DNABII peptide (including but not limited to: a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3-IhfB2NTHI).
- the antibody of fragment thereof binds to the tail-chimeric peptide IhfA3-IhfB2NTHI.
- the antibodies or antigen binding fragments are anti tail chimer (i.e., specifically binding and recognizing the tail chimer).
- the fragment is an antigen binding fragment.
- an antibody or a fragment thereof that comprises or consists essentially of, or yet further consists of: all three CDRs of a sequence selected from the group of: SEQ ID NOs: 4-6 or 26, or an equivalent of each thereof; and/or all three CDRs of a sequence selected from the group of: SEQ ID NOs: 10-12 or 27, or an equivalent of each thereof.
- the antibody or fragment thereof as provided herein further comprises one or more signal peptide(s).
- the signal peptide comprises or consists essentially of, or yet further consists of amino acid (aa) 1 to aa 24 of any one of SEQ ID NOs: 1-6, 13, 24 or 26.
- the signal peptide comprises or consists essentially of, or yet further consists of aa 1 to aa 20 of any one of SEQ ID NOs: 7-12, 14, 25 and 27.
- the signal peptide is located at the amino terminus of the light chain variable region. Additionally or alternatively, the same signal peptide or a different signal peptide is located at the amino terminus of the heavy chain variable region.
- the antibody or fragment thereof as provided herein may be monospecific or bispecific. In one embodiment, the antibody or fragment thereof is trispecific, or tetraspecific, or pentaspecific.
- the antibody is selected from the group of an IgA (such as an IgA1 or an IgA2), an IgD, an IgE, an IgG (such as an IgG1, an IgG2, an IgG3, or an IgG4), or an IgM antibody.
- the antibody further comprises a constant region selected from the group of: an IgA constant region (such as an IgA1 constant region or an IgA2 constant region), an IgD constant region, an IgE constant region, an IgG constant region (such as an IgG1 constant region, an IgG2 constant region, an IgG3 constant region, or an IgG4 constant region) or an IgM constant region.
- an equivalent to an amino acid sequence comprises or consists essentially of, or yet further consists of a polypeptide having at least about 80% (including about 80% to 100%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%) amino acid identity to the amino acid sequence.
- an equivalent to the amino acid sequence comprises or consists essentially of, or yet further consists of a polypeptide that is encoded by a polynucleotide that hybridizes under conditions of high stringency to the complement of the polynucleotide encoding the amino acid sequence.
- an equivalent to an amino acid sequence comprises or consists essentially of, or yet further consists of a polypeptide at least 80% (including about 80% to 100%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%) identity to the amino acid sequence.
- an equivalent to an amino acid sequence (such as an antibody or a fragment thereof, or any one or more of SEQ ID NOs: 1- 14 and 24-26 or a fragment thereof as disclosed herein, including but not limited to: 25 to aa 144 of SEQ ID NOs: 13, 24 or 26, aa 21 to aa 132 of SEQ ID NOs: 14 or 25, aa 21 to aa 126 of SEQ ID NO: 27, aa 25 to aa 473 of SEQ ID NOs: 13, 24 or 26, aa 21 to aa 239 of SEQ ID NOs: 14 or 25, aa 21 to aa 233 of SEQ ID NO: 27) comprises, or consists essentially of, or yet further consists of a polypeptide comprises one or more or all CDRs of the amino acid sequence.
- the polypeptide is at least about 80% (including about 80% to 100%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%) amino acid identity to the amino acid sequence.
- the equivalent to an amino acid sequence such as an antibody, a fragment thereof, a complementarity-determining region (CDR) thereof, or a CDR-containing polypeptide, lacks an amino acid difference to the amino acid sequence in the CDR(s).
- the equivalent to an amino acid sequence such as an antibody, a fragment thereof, a CDR thereof, or a CDR-containing polypeptide, may comprises one or more of (for example but not limited to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25) amino acid differences compared to the amino acid sequence in the non-CDR region(s) with the proviso that the three-dimensional arrangement of the CDR(s) and/or the CDRs is/are retained.
- the equivalent polypeptide to an amino acid sequence is at least about 80% (including about 80% to 100%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%) amino acid identity to the amino acid sequence with the proviso that the three-dimensional arrangement of the CDR(s) and/or the CDR(s) is/are retained.
- Non-limiting examples of such non-CDR regions includes a framework region (FR), a constant region, an Fc region, a pFc’ region, a constant heavy chain (CH) domain (such as CHI, CH2, CH3 or CH4), a constant light chain (CL) domain, or a hinge region.
- such amino acid differences may be a conservative amino acid substitution and/or does not change the three-dimensional arrangement of the antibody, fragment thereof, CDR thereof, or the CDR-containing polypeptide.
- the equivalent may comprises a conservative amino acid substitution in the boundaries of a CDR, such as one or two amino acid(s) at the amino termini, the carboxyl termini or both of the CDR.
- a set of CDRs comprising or alternatively consisting essentially of, or yet further consisting of one or more of CDRs (such as any 1, or 2, or 3, or 4, or 5, or 6 CDR(s)) of an antibody or fragment thereof as disclosed herein.
- a set of CDRs comprising, or alternatively consisting essentially of, or yet further consisting of CDRL1, CDRL2, and CDRL3 of a variable region as disclosed herein.
- a set of CDRs comprising, or alternatively consisting essentially of, or yet further consisting of CDRH1, CDRH2, and CDRH3 of a variable region as disclosed herein.
- a set of CDRs comprising, or alternatively consisting essentially of, or yet further consisting of CDRL1, CDRL2, and CDRL3 of a variable region as disclosed herein and CDRH1, CDRH2, CDRH3 of another variable region as disclosed herein.
- the CDR set constitutes a paratope.
- the CDR set specifically binds to a DNABII peptide (such as the tip region and/or the tail region, including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, the tip-chimeric peptide IhfA5-mIhfB4NTHI, a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3-IhfB2 NTHI ).
- a DNABII peptide such as the tip region and/or the tail region, including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, the tip-chimeric peptide IhfA5-mIhfB4NTHI, a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3-IhfB
- an antibody, a fragment thereof, or an equivalent of each thereof comprising, or alternatively consisting essentially of, or yet further consisting of a CDR set as disclosed herein.
- CDRs of an anti-tip chimer antibody are shown in SEQ ID NOs: 1-3, 7-9, 13 and 14 are illustrated in the following table.
- the CDRs of an anti tail chimer are shown in SEQ ID NOs: 4-6 and 10-12.
- CDRH1 of any one of SEQ ID NOs: 1-6, 13, 24 or 26 comprises or consists essentially of, or yet further consists of amino acid (aa) 50 to aa 57 of SEQ ID NO: 1-6, 13, 24 or 26, respectively.
- CDRH2 of any one of SEQ ID NOs: 1-6, 13, 24 or 26 comprises or consists essentially of, or yet further consists of amino acid (aa) 75 to aa 82 of SEQ ID NO: 1-6, 13, 24 or 26, respectively.
- CDRH3 of any one of SEQ ID NOs: 1-6, 13, 24 or 26 comprises or consists essentially of, or yet further consists of amino acid (aa) 121 to aa 133 of SEQ ID NO: 1-6, 13, 24 or 26, respectively.
- CDRL1 of any one of SEQ ID NOs: 7-9, 14 or 25 comprises or consists essentially of, or yet further consists of amino acid (aa) 47 to aa 57 of SEQ ID NO: 7-9, 14 or 25, respectively.
- CDRL2 of any one of SEQ ID NOs: 7-9, 14 or 25 comprises or consists essentially of, or yet further consists of amino acid (aa) 75 to aa 77 of SEQ ID NO: 7-9, 14 or 25, respectively.
- CDRL3 of any one of SEQ ID NOs: 7-9, 14 or 25 comprises or consists essentially of, or yet further consists of amino acid (aa) 114 to aa 122 of SEQ ID NO: 7-9, 14 or 25, respectively.
- CDRL1 of any one of SEQ ID NOs: 10-12 or 27 comprises or consists essentially of, or yet further consists of amino acid (aa) 47 to aa 52 of SEQ ID NO: 10-12 or 27, respectively.
- CDRL2 of any one of SEQ ID NOs: 10-12 or 27 comprises or consists essentially of, or yet further consists of amino acid (aa) 70 to aa 72 of SEQ ID NO: 10-12 or 27, respectively.
- CDRL3 of any one of SEQ ID NOs: 10-12 or 27 comprises or consists essentially of, or yet further consists of amino acid (aa) 109 to aa 116 of SEQ ID NO: 10-12 or 27, respectively.
- CDRs as identified in the following two Tables below.
- an alternative CDR that is a CDR as identified herein further comprising an additional 1 amino acid, or alternatively 2 amino acids, or alternatively 3 amino acids, or alternatively 4 amino acids, or alternatively 5 amino acids, or alternatively 6 amino acids, or alternatively 7 amino acids, or alternatively 8 amino acids at its amino terminus, or carboxyl terminus or both in the corresponding variable region sequence.
- CDR that is a CDR as identified herein having 1 amino acid, or alternatively 2 amino acids, or alternatively 3 amino acids, or alternatively 4 amino acids, or alternatively 5 amino acids, or alternatively 6 amino acids, or alternatively 7 amino acids, or alternatively 8 amino acids truncated at its amino terminus, or carboxyl terminus or both in the corresponding variable region sequence.
- CDR1 of SEQ ID NO: 1 may be amino acid 50 to amino acid 57 of SEQ ID NO: 1.
- the CDR1 of SEQ ID NO: 1 can also start from amino acid 42, or 43, or 44, or 45, 46 47 48 49 50 51 52 53 54 55 56 57 58 f SEQ ID NO: 1.
- CDR1 of SEQ ID NO: 1 can end at amino acid 49, or 50, or 51, or 52, or 53, or 54, or 55, or 56, or 57, or 58, or 59, or 60, or 61, or 62, or 63, or 64, or 65 of SEQ ID NO: 1 with proviso that the CDR1 ends after its start. Additionally or alternatively, the CDR is about 1, or alternatively about 2, or alternatively about 3, or alternatively about 4, or alternatively about 5, or alternatively about 6, or alternatively about 7, or alternatively about 8, or alternatively about 9, or alternatively about 10, or alternatively about 11, or alternatively about 12, or alternatively about 13, or alternatively about 14, or alternatively about 15 amino acids long.
- CDR2 of any one of SEQ ID NOs: 1-6 comprises or consists essentially of, or yet further consists of amino acid 71 to amino acid 85 of each of SEQ ID NOs: 1-6, respectively.
- CDR3 of any one of SEQ ID NOs: 1-6 comprises or consists essentially of, or yet further consists of amino acid 121 to amino acid 133 of each of SEQ ID NOs: 1-6, respectively.
- CDR2 of any one of SEQ ID NOs: 7-9 comprises or consists essentially of, or yet further consists of amino acid 71 to amino acid 81 of each of SEQ ID NOs: 7-9, respectively.
- CDR3 of any one of SEQ ID NOs: 7-9 comprises or consists essentially of, or yet further consists of amino acid 114 to amino acid 121 of each of SEQ ID NOs: 7-9, respectively.
- CDR2 of any one of SEQ ID NOs: 10-12 comprises or consists essentially of, or yet further consists of amino acid 66 to amino acid 76 of each of SEQ ID NOs: 10-12, respectively.
- CDR3 of any one of SEQ ID NOs: 10-12 comprises or consists essentially of, or yet further consists of amino acid 109 to amino acid 115 of each of SEQ ID NOs: 10-12, respectively.
- CDR1 of any one of SEQ ID NOs: 1-6 comprises or consists essentially of, or yet further consists of amino acid 50 to amino acid 57 of each of SEQ ID NOs: 1-6, respectively.
- CDR2 of any one of SEQ ID NOs: 1-6 comprises or consists essentially of, or yet further consists of amino acid 75 to amino acid 82 of each of SEQ ID NOs: 1-6, respectively.
- CDR3 of any one of SEQ ID NOs: 1-6 comprises or consists essentially of, or yet further consists of amino acids 121 and 122 of each of SEQ ID NOs: 1-6, respectively.
- CDR1 of any one of SEQ ID NOs: 7-9 comprises or consists essentially of, or yet further consists of amino acid 47 to amino acid 57 of each of SEQ ID NOs: 7-9, respectively.
- CDR2 of any one of SEQ ID NOs: 7-9 comprises or consists essentially of, or yet further consists of amino acid 75 to amino acid 77 of each of SEQ ID NOs: 7-9, respectively.
- CDR3 of any one of SEQ ID NOs: 7-9 comprises or consists essentially of, or yet further consists of amino acids 114 and 120 of each of SEQ ID NOs: 7- 9, respectively.
- CDR1 of any one of SEQ ID NOs: 10-12 comprises or consists essentially of, or yet further consists of amino acid 47 to amino acid 52 of each of SEQ ID NOs: 10-12, respectively.
- CDR2 of any one of SEQ ID NOs: 10-12 comprises or consists essentially of, or yet further consists of amino acid 70 to amino acid 72 of each of SEQ ID NOs: 10-12, respectively.
- CDR3 of any one of SEQ ID NOs: 10-12 comprises or consists essentially of, or yet further consists of amino acids 109 and 110 of each of SEQ ID NOs: 10-12, respectively.
- CDR1 of any one of SEQ ID NOs: 1-6 comprises or consists essentially of, or yet further consists of amino acid 47 to amino acid 59 of each of SEQ ID NOs: 1-6, respectively.
- CDR2 of any one of SEQ ID NOs: 1-6 comprises or consists essentially of, or yet further consists of amino acid 74 to amino acid 83 of each of SEQ ID NOs: 1-6, respectively.
- CDR1 of any one of SEQ ID NOs: 7-9 comprises or consists essentially of, or yet further consists of amino acid 44 to amino acid 59 of each of SEQ ID NOs: 7-9, respectively.
- CDR2 of any one of SEQ ID NOs: 7-9 comprises or consists essentially of, or yet further consists of amino acid 74 to amino acid 81 of each of SEQ ID NOs: 7-9, respectively.
- CDR3 of any one of SEQ ID NOs: 7-9 comprises or consists essentially of, or yet further consists of amino acids 114 and 122 of each of SEQ ID NOs: 7-9, respectively.
- CDR1 of any one of SEQ ID NOs: 10-12 comprises or consists essentially of, or yet further consists of amino acid 44 to amino acid 54 of each of SEQ ID NOs: 10-12, respectively.
- CDR2 of any one of SEQ ID NOs: 10-12 comprises or consists essentially of, or yet further consists of amino acid 79 to amino acid 76 of each of SEQ ID NOs: 10-12, respectively.
- CDR3 of any one of SEQ ID NOs: 10-12 comprises or consists essentially of, or yet further consists of amino acids 109 and 116 of each of SEQ ID NOs: 10-12, respectively.
- an antibody, a fragment thereof, or an equivalent of each thereof comprising, or alternatively consisting essentially of, or yet further consisting of any one or any two or more of: the variable regions as disclosed herein and/or one or more of equivalent(s) of the variable regions(s).
- variable region(s) specifically binds to a DNABII peptide (such as the tip region and/or the tail region, including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, the tip-chimeric peptide IhfA5-mIhfB4NTHI, a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3-IhfB2 NTHI ).
- a DNABII peptide such as the tip region and/or the tail region, including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, the tip-chimeric peptide IhfA5-mIhfB4NTHI, a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3-Ihf
- variable region is selected from the following: amino acid (aa) 25 to aa 144 of SEQ ID NOs: 1-6, 13, 24 and 26; aa 21 to aa 132 of SEQ ID NOs: 7-9, 14, and 25; aa 21 to aa 126 of SEQ ID NOs: 10-12 or 27; amino acid 24 to amino acid 144 of SEQ ID NOs: 1-6, 13, 24 and 26; amino acid 20 to amino acid 132 of SEQ ID NOs: 7-12, 14, 25 and 27; amino acid 20 to amino acid 126 of SEQ ID NOs: 7-12, 14, 25 and 27.
- variable region or an equivalent thereof is a variable region as disclosed herein further comprising an additional 1 amino acid, or alternatively 2 amino acids, or alternatively 3 amino acids, or alternatively 4 amino acids, or alternatively 5 amino acids, or alternatively 6 amino acids, or alternatively 7 amino acids, or alternatively 8 amino acids at its amino terminus, or carboxyl terminus or both in the corresponding sequence provided herein with a SEQ ID NO.
- variable region or an equivalent thereof is a variable region as disclosed herein having 1 amino acid, or alternatively 2 amino acids, or alternatively 3 amino acids, or alternatively 4 amino acids, or alternatively 5 amino acids, or alternatively 6 amino acids, or alternatively 7 amino acids, or alternatively 8 amino acids truncated at its amino terminus, or carboxyl terminus or both in the corresponding sequence provided herein with a SEQ ID NO.
- SEQ ID NO: 1 may be amino acid 50 to amino acid 57 of SEQ ID NO: 1.
- variable region or an equivalent thereof relating to the variable region consisting of amino acid 24 to amino acid 144 of SEQ ID NO: 1 can also start from amino acid 16, or 17, or 18, or 19, or 20, or 21, or 22, or 23, or 24, or 25, or 26, or 27, or 28, or 29, or 30, or 31, or 32 of SEQ ID NO: 1.
- variable region or an equivalent thereof relating to the variable region consisting of amino acid 24 to amino acid 144 of SEQ ID NO: 1 can end at amino acid 136, or 137, or 138, or 139, or 140, or 141, or 142, or 143, or 144, or 145, or 146, or 147, or 148, or 149, or 150, or 151, or 152 of SEQ ID NO: 1 with proviso that the variable region ends after its start.
- variable region is about 90 amino acids long to about 200 amino acids long, for example, about 100 amino acid long, or alternatively about 110 amino acid long, or alternatively about 120 amino acid long, or alternatively about 130 amino acid long, or alternatively about 140 amino acid long, or alternatively about 150 amino acid long, or alternatively about 160 amino acid long, or alternatively about 170 amino acid long, or alternatively about 180 amino acid long, or alternatively about 190 amino acid long, or alternatively about 200 amino acid long.
- the equivalent to an antibody or a fragment thereof comprises one or more of (for example but not limited to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25) amino acid differences compared to the antibody or a fragment thereof in the regions other than the variable domain(s) (referred to herein as non-VH regions).
- non-VH regions include, but are not limited to, a constant region, an Fc region, a pFc’ region, a constant heavy chain (CH) domain (such as CH1, CH2, CH3 or CH4), a constant light chain (CL) domain, or a hinge region.
- an antibody, a fragment thereof, or an equivalent of each thereof as disclosed herein may be further modified in the non-VH regions (such as for increasing the assembly of a heavy chain with a light chain, conjugating directly or indirectly to a detectable or purification marker or a drug, increasing or decreasing activation of complement, enhancing or reducing antibody-dependent cellular cytotoxicity (ADCC), or increasing or decreasing activation and recruitment of an immune cell), providing a further equivalent.
- non-VH regions such as for increasing the assembly of a heavy chain with a light chain, conjugating directly or indirectly to a detectable or purification marker or a drug, increasing or decreasing activation of complement, enhancing or reducing antibody-dependent cellular cytotoxicity (ADCC), or increasing or decreasing activation and recruitment of an immune cell
- the equivalent further comprises up to 50, or alternatively up to 30, or alternatively up to 25, or alternatively up to 20, or alternatively up to 15, or alternatively up to 10, or alternatively up to 5 random amino acids on either the amino or carboxyl termini or on both.
- the equivalent to an amino acid sequence comprises or consists essentially of, or yet further consists of the amino acid sequence truncated at the amino or carboxyl termini or both, for example, by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20 or 25 amino acids.
- an antibody or a fragment thereof comprises a signal peptide at the amino terminus of VH and/or the amino terminus of VL.
- the VH signal peptide is different to the VL signal peptide.
- the VH signal peptide is the same compared to the VL signal peptide.
- the signal peptide comprises or consists essentially of, or yet further consists of an amino acid sequence of amino acids 1-24 of SEQ ID NO: 1.
- the signal peptide comprises or consists essentially of, or yet further consists of an amino acid sequence of amino acids 1-20 of SEQ ID NO: 7.
- the equivalent to an antibody or a fragment thereof comprises a signal peptide which is different from the signal peptide(s) of the antibody with the proviso that the signal peptide of the equivalent directs VH and/or VL to the same cellular location as the signal peptide(s) of the antibody.
- the equivalent to an antibody or a fragment thereof retains at least 50% (such as at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%) of or improves one or more of functional activities of the antibody or fragment.
- Such functional activities include but are not limited to binding specificity, binding avidity and/or affinity to a DNABII peptide (such as the tip region and/or the tail region, including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, the tip-chimeric peptide IhfA5-mIhfB4NTHI, a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3-IhfB2 NTHI ), preventing formation of a biofilm in vivo or in vitro, or disrupting a biofilm in vivo or in vitro.
- a DNABII peptide such as the tip region and/or the tail region, including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, the tip-chimeric peptide IhfA5-mIhfB4NTHI,
- an antibody or a fragment thereof that competes for binding to an epitope with an antibody or a fragment thereof as disclosed herein.
- the antibody or fragment thereof may be a polyclonal, a monoclonal and/or a humanized antibody.
- the antibody is a bispecific antibody or a trispecific, tetraspecific or pentaspecific antibody.
- the antibody is an IgA, an IgD, an IgE, an IgG or an IgM antibody.
- the antibodies further comprise a constant region selected from an IgA, an IgD, an IgE, an IgG or an IgM constant region.
- the constant region is an IgG1 constant region.
- antibodies that compete for binding to an epitope with an antibody as disclosed herein can be identified using conventional techniques, e.g. a competitive ELISA.
- the antibodies as disclosed herein can be polyclonal, monoclonal or humanized.
- the antibodies bind the “tip” region of a DNABII polypeptide, e.g., HU or IHF (such as IhfA and IhfB).
- the antibodies bind the “tail” region of a DNABII polypeptide, e.g., HU or IHF (such as IhfA and IhfB).
- a DNABII polypeptide e.g., HU or IHF (such as IhfA and IhfB).
- this disclosure provides antigen binding fragments.
- the antigen binding fragments are any one of Fab, F(ab’)2, Fab’, scFv, or Fv, that can be prepared using conventional techniques known to those of skill in the art.
- the antibody is soluble Fab.
- this disclosure provides a Fab fragment of the antibody as disclosed herein, wherein the antibody specifically binds the tip region of a DNABII peptide (including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, and/or the tip-chimeric peptide IhfA5-mIhfB4 NTHI ).
- a DNABII peptide including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, and/or the tip-chimeric peptide IhfA5-mIhfB4 NTHI .
- the DNABII is an IHF or an HU peptide.
- the DNABII is an IHF peptide.
- An equivalent can comprise a polypeptide having at least 80% amino acid identity to polypeptide, or a polypeptide that is encoded by a polynucleotide that hybridizes under conditions of high stringency to the complement of a polynucleotide encoding the polypeptide.
- the antibody, fragment thereof, polypeptide or CDR binds a DNABII protein (including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, the tip-chimeric peptide IhfA5- mIhfB4 NTHI , a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail- chimeric peptide IhfA3-IhfB2NTHI) at a half maximal effective concentration (EC50) of less than 500 ng/mL, or alternatively less than 250 ng/mL, or alternatively less than 200 ng/mL, or alternatively less than 150 ng/mL, or alternatively less than 100 ng/mL, or alternatively less than 90 ng/mL, or alternatively less than 80 ng/mL, or alternatively less than 70 ng/mL, or alternatively less than 65
- EC50 half maximal effective concentration
- such EC 50 is determined using the ELISA methods shown in the Examples.
- the antibody, fragment thereof, polypeptide or CDR binds a DNABII protein (including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, the tip-chimeric peptide IhfA5- mIhfB4NTHI, a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail- chimeric peptide IhfA3-IhfB2 NTHI ) with an equilibrium constant K D of less than 10 ⁇ 4 M, 10 ⁇ 5 M, 10 ⁇ 6 M, 10 ⁇ 7 M, 10 ⁇ 8 M, 10 ⁇ 9 M, 10 ⁇ 10 M, 10 ⁇ 11 M, or 10 ⁇ 12 M.
- the antibody, fragment thereof, polypeptide or CDR binds a DNABII protein with a KD of less than 1000 nM, or alternatively less than 900 nM, or alternatively less than 800 nM, or alternatively less than 700 nM, or alternatively less than 600 nM, or alternatively less than 500 nM, or alternatively less than 400 nM, or alternatively less than 300 nM, or alternatively less than 200 nM, or alternatively less than 100 nM, or alternatively less than 90 nM, or alternatively less than 80 nM, or alternatively less than 70 nM, or alternatively less than 60 nM, or alternatively less than 50 nM, or alternatively less than 40 nM, or alternatively less than 30 nM, or alternatively less than 20 nM, or alternatively less than 15 nM, or alternatively less than 10 nM, or alternatively less than 9 nM, or alternatively less than 8 nM, or alternatively less than 7
- such K D is determined using the surface plasmon resonance (SPR) methods shown in the Examples.
- the antigen binding site specifically binds to a DNABII protein.
- the antibody, fragment thereof, polypeptide or CDR binds a DNABII protein (including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, the tip-chimeric peptide IhfA5- mIhfB4 NTHI , a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail- chimeric peptide IhfA3-IhfB2NTHI) with a Koff of less than 1.0E-02 s ⁇ 1 , or alternatively less than 9.0E-03 s ⁇ 1 , or alternatively less than 8.0E-03 s ⁇ 1 , or alternative
- such Koff is determined using the surface plasmon resonance (SPR) methods shown in the Examples.
- the antibody, fragment thereof, polypeptide or CDR binds a DNABII protein (including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, the tip-chimeric peptide IhfA5- mIhfB4 NTHI , a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail- chimeric peptide IhfA3-IhfB2NTHI) with a Kon of less than 9.0E-02 M ⁇ 1 s ⁇ 1 , or alternatively less than 8.0E-02 M ⁇ 1 s ⁇ 1 , or alternatively less than 7.0E-02 M ⁇ 1 s ⁇ 1 , or alternatively less than 6.0E-02 M ⁇ 1 s ⁇ 1 ,
- such Kon is determined using the surface plasmon resonance (SPR) methods shown in the Examples.
- SPR surface plasmon resonance
- the association constant K A for the IhfA5- mIhfB4NTHI Tip chimeric peptide (in 1/M) is about 3E+05 to about 2E+08.
- the KA is about 3E+05 to about 1E+08, or alternatively about 2E+05 to about 1E+08, or alternatively about 1E+05 to about 1E+08, or alternatively about 1E+06 to about 1E+08, or alternatively about 1E+07 to about 1E+08, or alternatively about 1E+04 to about 1E+09, alternatively about 1E+05 to about 1E+09, alternatively about 1E+06 to about 1E+09, alternatively about 1E+07 to about 1E+09, alternatively about 1E+08 to about 1E+09, alternatively about 1E+04 to about 1E+09, or alternatively about 1E+03 to about 1E+10.
- the dissociation constant KD for the IhfA5-mIhfB4NTHI Tip chimeric peptide (in M) is about 5E-09 to about 3E-06, or alternatively about 1E-09 to about 1E-06, or alternatively about 1E-08 to about 1E-05, or alternatively about 1E-07 to about 1E-05, or alternatively about 1E-06 to about 1E-05, or alternatively about 1E-09 to about 1E-08, or alternatively about 1E-08 to about 1E-07, or alternatively about 1E-9 to about 1E-08, or alternatively about 1E-10 to about 1E-09, or alternatively about 1E-11 to about 1E-10.
- the KA for the IhfA3-IhfB2NTHI Tail chimeric peptide is from about 7E+06 to about 2E+09, or alternatively about 1E+05 to about 1E+08, or alternatively about 1E+06 to about 1E+08, or alternatively about 1E+07 to about 1E+08, or alternatively about 1E+04 to about 1E+09, alternatively about 1E+05 to about 1E+09, alternatively about 1E+06 to about 1E+09, alternatively about 1E+07 to about 1E+09, alternatively about 1E+08 to about 1E+09, alternatively about 1E+04 to about 1E+09, or alternatively about 1E+03 to about 1E+10, or alternatively about 1E+03 to about 1E+11, or alternatively about 1E+03 to about 1E+12, or alternatively about 1E+09 to about 1E+10, or alternatively about 1E+10 to about 1E+11,
- the K D for the IhfA3-IhfB2 NTHI Tail chimeric peptide (in M) is about 6E-10 to about 2E-07, or alternatively about 1E-09 to about 1E-06, or alternatively about 1E-08 to about 1E-05, or alternatively about 1E-07 to about 1E-05, or alternatively about 1E-06 to about 1E-05, or alternatively about 1E-09 to about 1E-08, or alternatively about 1E-08 to about 1E-07, or alternatively about 1E-9 to about 1E-08, or alternatively about 1E-10 to about 1E-09, or alternatively about 1E-11 to about 1E-10, or alternatively about 1E- 11 to about 1E-12.
- the antibody, fragment thereof, polypeptide or CDR that binds the tip region of a DNABII protein reduces biomass of a biofilm in vitro by at least about 10%, or alternatively at least about 15%, or alternatively at least about 20%, or alternatively at least about 25%, or alternatively at least about 30%, or alternatively at least about 35%, or alternatively at least about 40%, or alternatively at least about 45%, or alternatively at least about 50%, or alternatively at least about 55%, or alternatively at least about 60%, or alternatively at least about 65%, or alternatively at least about 70%, or alternatively at least about 75%, or alternatively at least about 80%, or alternatively at least about 85%, or alternatively at least about 90%, or alternative
- the antibody, fragment thereof, polypeptide or CDR that binds the tail region of a DNABII protein reduces biomass of a biofilm in vitro by less than about 1%, or alternatively less than about 2%, or alternatively less than about 3%, or alternatively less than about 4%, or alternatively less than about 5%, or alternatively less than about 6%, or alternatively less than about 7%, or alternatively less than about 8%, or alternatively less than about 9%, or alternatively less than about 10%, or alternatively less than about 12%, or alternatively less than about 15%, or alternatively less than about 20%, or alternatively less than about 25%, or alternatively less than about 30%, or alternatively less than about 35%, or alternatively less than about 40%, or alternatively
- such biomass change is determined using the methods shown in Example 3 or 4.
- the antibody, fragment thereof, polypeptide or CDR that binds the tip region of a DNABII protein reduces bacterial load in a subject by at least about 10%, or alternatively at least about 15%, or alternatively at least about 20%, or alternatively at least about 25%, or alternatively at least about 30%, or alternatively at least about 35%, or alternatively at least about 40%, or alternatively at least about 45%, or alternatively at least about 50%, or alternatively at least about 55%, or alternatively at least about 60%, or alternatively at least about 65%, or alternatively at least about 70%, or alternatively at least about 75%, or alternatively at least about 80%, or alternatively
- the antibody, fragment thereof, polypeptide or CDR that binds the tail region of a DNABII protein reduces bacterial load in a subject by less than about 1%, or alternatively less than about 2%, or alternatively less than about 3%, or alternatively less than about 4%, or alternatively less than about 5%, or alternatively less than about 6%, or alternatively less than about 7%, or alternatively less than about 8%, or alternatively less than about 9%, or alternatively less than about 10%, or alternatively less than about 12%, or alternatively less than about 15%, or alternatively less than about 20%, or alternatively less than about 25%, or alternatively less than about 30%, or alternatively less than about 35%, or alternatively less than about 40%, or alternatively less than about 1%, or alternatively less than about 2%, or alternatively less than about 3%, or alternatively less than about 4%, or alternatively less than about 5%, or alternatively less than about 6%, or alternatively less than about 7%, or alternatively less than about 8%, or alternative
- such change in the bacterial load is determined using the methods shown in the Examples.
- the antibody, fragment thereof, polypeptide or CDR that binds the tip region of a DNABII protein reduces middle ear occlusion in a subject having otitis media (OM) by at least about 10%, or alternatively at least about 15%, or alternatively at least about 20%, or alternatively at least about 25%, or alternatively at least about 30%, or alternatively at least about 35%, or alternatively at least about 40%, or alternatively at least about 45%, or alternatively at least about 50%, or alternatively at least about 55%, or alternatively at least about 60%, or alternatively at least about 65%, or alternatively at least about 70%, or alternatively at least
- the antibody, fragment thereof, polypeptide or CDR that binds the tail region of a DNABII protein reduces middle ear occlusion in a subject having otitis media (OM) by less than about 1%, or alternatively less than about 2%, or alternatively less than about 3%, or alternatively less than about 4%, or alternatively less than about 5%, or alternatively less than about 6%, or alternatively less than about 7%, or alternatively less than about 8%, or alternatively less than about 9%, or alternatively less than about 10%, or alternatively less than about 12%, or alternatively less than about 15%, or alternatively less than about 20%, or alternatively less than about 25%, or alternatively less than about 30%, or alternatively less than about 35%, or alternative
- such change in middle ear occlusion is determined using the methods shown in the Examples in an experimental OM model.
- the antibody, fragment thereof, polypeptide or CDR that binds the tip region of a DNABII protein reduces the relative mucosal biofilm score and/or biomass score in a subject having a mucosal biofilm (such as having OM) by at least about 10%, or alternatively at least about 15%, or alternatively at least about 20%, or alternatively at least about 25%, or alternatively at least about 30%, or alternatively at least about 35%, or alternatively at least about 40%, or alternatively at least about 45%, or alternatively at least about 50%, or alternatively at least about 55%, or alternatively at least about 60%, or
- the antibody, fragment thereof, polypeptide or CDR that binds the tip region of a DNABII protein reduces the relative mucosal biofilm score and/or biomass score in a subject having a mucosal biofilm (such as having OM) by at least about 0.5, or alternatively at least about 1, or alternatively at least about 1.5, or alternatively at least about 2, or alternatively at least about 2.5, or alternatively at least about 3, or alternatively at least about 3.5, or alternatively at least about 4.
- the antibody, fragment thereof, polypeptide or CDR that binds the tail region of a DNABII protein reduces the relative mucosal biofilm score and/or biomss score in a subject having a mucosal biofilm (such as having OM) by less than about 1%, or alternatively less than about 2%, or alternatively less than about 3%, or alternatively less than about 4%, or alternatively less than about 5%, or alternatively less than about 6%, or alternatively less than about 7%, or alternatively less than about 8%, or alternatively less than about 9%, or alternatively less than about 10%, or alternatively less than about 12%, or alternatively less than about 15%, or alternatively less than about 20%, or alternatively less than about 25%,
- the antibody, fragment thereof, polypeptide or CDR that binds the tail region of a DNABII protein reduces the relative mucosal biofilm score and/or biomss score in a subject having a mucosal biofilm (such as having OM) by less than about 0.1, or alternatively less than about 0.2, or alternatively less than about 0.3, or alternatively less than about 0.4, or alternatively less than about 0.5, or alternatively less than about 0.6, or alternatively less than about 0.7, or alternatively less than about 0.8, or alternatively less than about 0.9, or alternatively less than about 1, or alternatively less than about 1.5, or alternatively less than about 2, or alternatively less than about 2.5.
- the DNABII protein is an HU or an IHF. In a further embodiment, the DNABII protein is an IhfA, an IhfB or both.
- the antibody, fragment thereof, polypeptide or CDR binds the tip region or the tail region of the DNABII protein (including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, the tip-chimeric peptide IhfA5-mIhfB4NTHI, a tail region of IHF or HU, a tail region of IHFA or IHFB, and/or the tail-chimeric peptide IhfA3-IhfB2 NTHI ).
- the antibody, fragment thereof, polypeptide or CDR binds the IhfA5- mIhfB4NTHI Tip chimeric peptide.
- the antibody, fragment thereof, polypeptide or CDR binds the IhfA3-IhfB2 NTHI Tail chimeric peptide.
- the antibody is soluble Fab.
- the HC and LC variable domain sequences are components of the same polypeptide chain. In some of the aspects of the antibodies provided herein, the HC and LC variable domain sequences are components of different polypeptide chains.
- the antibody is a full-length antibody.
- the antibody is chimeric or humanized.
- the antibody comprises an Fc domain.
- the antibody is a non- human animal such as a rat, sheep, bovine, canine, feline or rabbit antibody.
- the antibody is a human or humanized antibody or is non-immunogenic in a human.
- the antibody comprises a human antibody framework region. Examples of framework regions that can be fused to the LC and HC sequences are known in the art, examples of such are provided in SEQ ID NOs: 15-23, or equivalents of each thereof.
- one or more amino acid residues in a CDR of the antibodies provided herein are substituted with another amino acid.
- the substitution may be “conservative” in the sense of being a substitution within the same family of amino acids.
- the naturally occurring amino acids may be divided into the following four families and conservative substitutions will take place within those families.
- Amino acids with basic side chains lysine, arginine, histidine.
- Amino acids with acidic side chains aspartic acid, glutamic acid
- Amino acids with uncharged polar side chains asparagine, glutamine, serine, threonine, tyrosine.
- amino acids with nonpolar side chains glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, cysteine.
- one or more amino acid residues are added to or deleted from one or more CDRs of an antibody. Such additions or deletions occur at the N or C termini of the CDR or at a position within the CDR.
- amino acid sequence of the CDRs of an antibody by addition, deletion or substitution of amino acids, various effects such as increased binding affinity for the target antigen may be obtained.
- antibodies of the present disclosure comprising such varied CDR sequences still bind a DNABII protein with similar specificity and sensitivity profiles as the disclosed antibodies. This may be tested by way of the binding assays, such as ELISA or SPR.
- the antibodies are characterized by being both immunodominant and immunoprotective, as determined using appropriate assays and screens.
- the antibodies can be modified by conventional techniques, that may in one aspect increase the half-life of the antibody, e.g., PEGylation, a PEG mimetic, polysialylation, HESylation or glycosylation.
- the antibodies and antigen binding fragments can further comprise a detectable marker or a purification marker.
- Antibodies and Derivatives Thereof This disclosure also provides an antibody that binds and/or specifically recognizes and binds an isolated polypeptide for use in the methods disclosed herein.
- the antibody can be any of the various antibodies described herein, non-limiting, examples of such include a polyclonal antibody, a monoclonal antibody, a chimeric antibody, a human antibody, a veneered antibody, a diabody, a humanized antibody, an antibody derivative, a recombinant humanized antibody, or an equivalent (such as a derivative) or fragment of each thereof.
- the fragment comprises, or alternatively consists essentially of, or yet further consists of the CDR of the antibody.
- the antibody is detectably labeled or further comprises a detectable label conjugated to it.
- a hybridoma cell line that produces a monoclonal antibody disclosed herein.
- Compositions comprising or alternatively consisting essentially of or yet further, consisting of one or more of the above embodiments are further provided herein.
- polynucleotides that encode the amino acid sequence of the antibodies and fragments as well as methods to produce recombinantly or chemically synthesize the antibody polypeptides and fragments thereof.
- the antibody polypeptides can be produced in a eukaryotic or prokaryotic cell, or by other methods known in the art and described herein.
- Examples of CDR sequences include without limitation comprise, consist essentially of, or yet further consist of, the following: the heavy chain variable region of the antibody or a fragment thereof comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below polynucleotide sequence:
- Antibodies can be generated using conventional techniques known in the art and are well-described in the literature. Several methodologies exist for production of polyclonal antibodies.
- polyclonal antibodies are typically produced by immunization of a suitable mammal such as, but not limited to, chickens, goats, guinea pigs, hamsters, horses, mice, rats, and rabbits.
- An antigen is injected into the mammal, induces the B-lymphocytes to produce immunoglobulins specific for the antigen.
- Immunoglobulins may be purified from the mammal's serum.
- Variations of this methodology include modification of adjuvants, routes and site of administration, injection volumes per site and the number of sites per animal for optimal production and humane treatment of the animal.
- adjuvants typically are used to improve or enhance an immune response to antigens.
- adjuvants provide for an injection site antigen depot, which allows for a stow release of antigen into draining lymph nodes.
- Other adjuvants include surfactants which promote concentration of protein antigen molecules over a large surface area and immunostimulatory molecules.
- Non-limiting examples of adjuvants for polyclonal antibody generation include Freund's adjuvants, Ribi adjuvant system, and Titermax.
- Polyclonal antibodies can be generated using methods known in the art some of which are described in U.S. Pat. Nos.7,279,559; 7,119,179; 7,060,800; 6,709,659; 6,656,746; 6,322,788; 5,686,073; and 5,670,153.
- Antibody derivatives of the present disclosure can also be prepared by delivering a polynucleotide encoding an antibody disclosed herein to a suitable host such as to provide transgenic animals or mammals, such as goats, cows, horses, sheep, and the like, that produce such antibodies in their milk. These methods are known in the art and are described for example in U.S. Pat. Nos.5,827,690; 5,849,992; 4,873,316; 5,849,992; 5,994,616; 5,565,362; and 5,304,489. [0365]
- the term “antibody derivative” includes post-translational modification to linear polypeptide sequence of the antibody or fragment. For example, U.S. Pat.
- No.6,602,684 B1 describes a method for the generation of modified glycol-forms of antibodies, including whole antibody molecules, antibody fragments, or fusion proteins that include a region equivalent to the Fc region of an immunoglobulin, having enhanced Fe-mediated cellular toxicity, and glycoproteins so generated.
- the antibodies disclosed herein also include derivatives that are modified by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from generating an anti-idiotypic response.
- Antibody derivatives include, but are not limited to, antibodies that have been modified by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Additionally, the derivatives may contain one or more non-classical amino acids. [0367] Antibody derivatives also can be prepared by delivering a polynucleotide disclosed herein to provide transgenic plants and cultured plant cells (e.g., but not limited to tobacco, maize, and duckweed) that produce such antibodies, specified portions or variants in the plant parts or in cells cultured therefrom. For example, Cramer et al. (1999) Curr. Top.
- Microbol. Immunol.240:95-118 and references cited therein describe the production of transgenic tobacco leaves expressing large amounts of recombinant proteins, e.g., using an inducible promoter.
- Transgenic maize has been used to express mammalian proteins at commercial production levels, with biological activities equivalent to those produced in other recombinant systems or purified from natural sources. See, e.g., Hood et al. (1999) Adv. Exp. Med. Biol.464:127-147 and references cited therein.
- Antibody derivatives have also been produced in large amounts from transgenic plant seeds including antibody fragments, such as single chain antibodies (scFv's), including tobacco seeds and potato tubers. See, e.g., Conrad et al.
- antibodies can also be produced using transgenic plants, according to know methods.
- Antibody derivatives also can be produced, for example, by adding exogenous sequences to modify immunogenicity or reduce, enhance or modify binding, affinity, on-rate, off-rate, avidity, specificity, half-life, or any other suitable characteristic. Generally, part or all of the non-human or human CDR sequences are maintained while the non-human sequences of the variable and constant regions are replaced with human or other amino acids or variable or constant regions from other isotypes.
- the CDR residues are directly and most substantially involved in influencing antigen binding.
- Humanization or engineering of antibodies can be performed using any known method such as, but not limited to, those described in U.S. Pat. Nos. 5,723,323; 5,976,862; 5,824,514; 5,817,483; 5,814,476; 5,763,192; 5,723,323; 5,766,886; 5,714,352; 6,204,023; 6,180,370; 5,693,762; 5,530,101; 5,585,089; 5,225,539; and 4,816,567. [0370] Chimeric, humanized or primatized antibodies of the present disclosure can be prepared based on the sequence of a reference monoclonal antibody prepared using standard molecular biology techniques.
- DNA encoding the heavy and light chain immunoglobulins can be obtained from the hybridoma of interest and engineered to contain non-reference (e.g., human) immunoglobulin sequences using standard molecular biology techniques.
- non-reference e.g., human
- the murine variable regions can be linked to human t t i i th d k i th t (US P t N 4816567) T t humanized antibody
- the murine CDR regions can be inserted into a human framework using methods known in the art (U.S. Pat. No.5,225,539 and U.S. Pat. Nos.5,530,101; 5,585,089; 5,693,762; and 6,180,370).
- the murine CDR regions can be inserted into a primate framework using methods known in the art (WO 93/02108 and WO 99/55369).
- Techniques for making partially to fully human antibodies are known in the art and any such techniques can be used.
- fully human antibody sequences are made in a transgenic mouse which has been engineered to express human heavy and light chain antibody genes. Multiple strains of such transgenic mice have been made which can produce different classes of antibodies.
- B cells from transgenic mice which are producing a desirable antibody can be fused to make hybridoma cell lines for continuous production of the desired antibody. (See for example, Russel et al.
- the antibodies disclosed herein also can be modified to create chimeric antibodies. Chimeric antibodies are those in which the various domains of the antibodies' heavy and light chains are coded for by DNA from more than one species. See, e.g., U.S. Pat. No.4,816,567.
- the antibodies disclosed herein can also be modified to create veneered antibodies.
- Veneered antibodies are those in which the exterior amino acid residues of the antibody of one species are judiciously replaced or “veneered” with those of a second species th t th tib di f th fi t i ill t b i i i th d i thereby reducing the immunogenicity of the antibody. Since the antigenicity of a protein is primarily dependent on the nature of its surface, the immunogenicity of an antibody could be reduced by replacing the exposed residues which differ from those usually found in another mammalian species. This judicious replacement of exterior residues should have little, or no, effect on the interior domains, or on the interdomain contacts.
- ligand binding properties should be unaffected as a consequence of alterations which are limited to the variable region framework residues.
- the process is referred to as “veneering” since only the outer surface or skin of the antibody is altered, the supporting residues remain undisturbed.
- the procedure for “veneering” makes use of the available sequence data for human antibody variable domains compiled by Kabat et al. (1987) Sequences of Proteins of Immunological interest, 4th ed., Bethesda, Md., National Institutes of Health, updates to this database, and other accessible U.S. and foreign databases (both nucleic acid and protein).
- Non-limiting examples of the methods used to generate veneered antibodies include EP 519596; U.S. Pat.
- antibody derivative also includes “diabodies” which are small antibody fragments with two antigen-binding sites, wherein fragments comprise a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain.
- VH heavy chain variable domain
- VL light chain variable domain
- antibody derivative further includes engineered antibody molecules, fragments and single domains such as scFv, dAbs, nanobodies, minibodies, Unibodies, and Affibodies & Hudson (2005) Nature Biotech 23(9):1126-36; U.S. Pat. Application Publication No.2006/0211088; PCT International Application Publication No. WO 2007/059782 US P t N 5831012) [0377]
- the term “antibody derivative” further includes “linear antibodies”. The procedure for making linear antibodies is known in the art and described in Zapata et al. (1995) Protein Eng.8(10):1057-1062.
- these antibodies comprise a pair of tandem Ed segments (VH- C H 1-VH-C H 1) which form a pair of antigen binding regions.
- Linear antibodies can be bispecific or monospecific.
- the antibodies disclosed herein can be recovered and purified from recombinant cell cultures by known methods including, but not limited to, protein A purification, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. High performance liquid chromatography (“HPLC”) can also be used for purification.
- HPLC high performance liquid chromatography
- Antibodies of the present disclosure include naturally purified products, products of chemical synthetic procedures, and products produced by recombinant techniques from a eukaryotic host, including, for example, yeast, higher plant, insect and mammalian cells, or alternatively from a prokaryotic host as described above. A number of antibody production systems are described in Birch & Radner (2006) Adv. Drug Delivery Rev.58: 671-685. [0380] If an antibody being tested binds with protein or polypeptide, then the antibody being tested and the antibodies provided by this disclosure are equivalent.
- an antibody has the same specificity as the antibody disclosed herein by determining whether the antibody being tested prevents an antibody disclosed herein from binding the protein or polypeptide with which the antibody is normally reactive. If the antibody being tested competes with the antibody disclosed herein as shown by a decrease in binding by the monoclonal antibody disclosed herein, then it is likely that the two antibodies bind to the same or a closely related epitope. Alternatively, one can pre-incubate the antibody disclosed herein with a protein with which it is normally reactive, and determine if the antibody being tested is inhibited in its ability to bind the antigen.
- antibody also is intended to include antibodies of all immunoglobulin isotypes and subclasses. Particular isotypes of a monoclonal antibody can be prepared either directly by selecting from an initial fusion, or prepared secondarily, from a parental hybridoma secreting a monoclonal antibody of different isotype by using the sib selection technique to isolate class switch variants using the procedure described in Steplewski et al. (1985) Proc. Natl. Acad. Sci. USA 82:8653 or Spira et al. (1984) J. Immunol.
- antibodies can be labeled with a detectable moiety such as a radioactive atom, a chromophore, a fluorophore, or the like.
- a detectable moiety such as a radioactive atom, a chromophore, a fluorophore, or the like.
- Such labeled antibodies can be used for diagnostic techniques, either in vivo, or in an isolated test sample.
- the coupling of antibodies to low molecular weight haptens can increase the sensitivity of the antibody in an assay.
- the haptens can then be specifically detected by means of a second reaction.
- haptens such as biotin, which reacts avidin, or dinitrophenol, pyridoxal, and fluorescein, which can react with specific anti- hapten antibodies. See, Harlow and Lane (1988) supra.
- variable region of the antibodies of the present disclosure can be modified by mutating amino acid residues within the VH and/or VL CDR 1, CDR 2 and/or CDR 3 regions to improve one or more binding properties (e.g., affinity) of the antibody. Mutations may be introduced by site-directed mutagenesis or PCR-mediated mutagenesis and the effect on antibody binding, or other functional property of interest, can be evaluated in appropriate in vitro or in vivo assays. In certain embodiments, conservative modifications are introduced and typically no more than one, two, three, four or five residues within a CDR region are altered. The mutations may be amino acid substitutions, additions or deletions.
- Framework modifications can be made to the antibodies to decrease immunogenicity, for example, by “backmutating” one or more framework residues to the corresponding germline sequence.
- the antibodies disclosed herein may be engineered to include modifications within the Fc region to alter one or more functional properties of the antibody, such as serum half-fife, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
- modifications include, but are not limited to, alterations of the number of cysteine residues in the hinge region to facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody (U.S. Pat. No.5,677,425) and amino acid mutations in the Fc hinge region to decrease the biological half-life of the antibody (U.S.
- the antibodies disclosed herein may be chemically modified. Glycosylation of an antibody can be altered, for example, by modifying one or more sites of glycosylation within the antibody sequence to increase the affinity of the antibody for antigen (U.S. Pat. Nos.5,714,350 and 6,350,861).
- a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures can be obtained by expressing the antibody in a host cell with altered glycosylation mechanism (Shields, R. L. et al. (2002) J. Biol.
- the antibodies disclosed herein can be pegylated to increase biological half-life by reacting the antibody or fragment thereof with polyethylene glycol (PEG) or a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
- PEG polyethylene glycol
- Antibody pegylation may be carried out by an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water soluble polymer).
- polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.
- the antibody to be pegylated can be an aglycosylated antibody. Methods for pegylating proteins are known in the art and can be applied to the antibodies disclosed herein (EP 0154316 and EP 0401384). [0390] Additionally, antibodies may be chemically modified by conjugating or fusing the antigen-binding region of the antibody to serum protein, such as human serum albumin, to increase half-life of the resulting molecule.
- the antibodies or fragments thereof of the present disclosure may be conjugated to a diagnostic agent and used diagnostically, for example, to monitor the development or progression of a disease and determine the efficacy of a given treatment regimen.
- diagnostic agents include enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions.
- the detectable substance may be coupled or conjugated either directly to the antibody or fragment thereof, or indirectly, through a linker using techniques known in the art.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase.
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin.
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin.
- An example of a luminescent material includes luminol.
- bioluminescent materials include luciferase, luciferin, and aequorin.
- radioactive material examples include 125 I, 131 I, Indium-111, Lutetium-171, Bismuth-212, Bismuth-213, Astatine-211, Copper-62, Copper-64, Copper-67, Yttrium-90, Iodine-125, Iodine-131, Phosphorus-32, Phosphorus-33, Scandium-47, Silver-111, Gallium- 67, Praseodymium-142, Samarium-153, Terbium-161, Dysprosium-166, Holmium-166, Rhenium-186, Rhenium-188, Rhenium-189, Lead-212, Radium-223, Actinium-225, Iron-59, Selenium-75, Arsenic-77, Strontium-89, Molybdenum-99, Rhodium-1105, Palladium-109, Praseodymium-143, Promethium-149, Erbium-169, Iridium-194, Gold-198, Gold-199, and Lead-211.
- Monoclonal antibodies may be indirectly conjugated with radiometal ions through the use of bifunctional chelating agents that are covalently linked to the antibodies.
- Chelating agents may be attached through amities (Meares et al. (1984) Anal. Biochem.142:68-78); sulfhydral groups (Koyama (1994) Chem. Abstr.120:217-262) of amino acid residues and carbohydrate groups (Rodwell et al. (1986) PNAS USA 83:2632-2636; Quadri et al. (1993) Nucl. Med. Biol.20:559-570).
- the antibodies or fragments thereof of the present disclosure may be conjugated to a therapeutic agent.
- Suitable therapeutic agents include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin, antimetabolites (such as methotrexate, 6- mercaptopurine, 6-thioguanine, cytarabine, fludarabin, 5-fluorouracil, decarbazine, hydroxyurea, asparaginase, gemcitabinc, cladribine), alkylating agents (such as mechlorethamine, thioepa, chloramhucil,
- Additional suitable conjugated molecules include ribonuclease (RNase), DNase I, an antisense nucleic acid, an inhibitory RNA molecule such as a siRNA molecule, an immunostimulatory nucleic acid, aptamers, ribozymes, triplex forming molecules, and external guide sequences.
- Aptamers are small nucleic acids ranging from 15-50 bases in length that fold into defined secondary and tertiary structures, such as stem-loops or G- quartets, and can bind small molecules, such as ATP (U.S. Pat. No.5,631,146) and theophiline (U.S. Pat. No.5,580,737), as well as large molecules, such as reverse transcriptase (U.S. Pat.
- Ribozymes are nucleic acid molecules that are capable of catalyzing a chemical reaction, either intramolecularly or intermolecularly. Ribozymes typically cleave nucleic acid substrates through recognition and binding of the target substrate with subsequent cleavage. Triplex forming function nucleic acid molecules can interact with double-stranded or single-stranded nucleic acid by forming a triplex, in which three strands of DNA form a complex dependent on both Watson-Crick and Hoogsteen base-pairing. Triplex molecules can bind target regions with high affinity and specificity.
- the functional nucleic acid molecules may act as effectors, inhibitors, modulators, and stimulators of a specific activity possessed by a target molecule, or the functional nucleic acid molecules may possess a de novo activity independent of any other molecules.
- the therapeutic agents can be linked to the antibody directly or indirectly, using any of a large number of available methods. For example, an agent can be attached at the hinge region of the reduced antibody component via disulfide bond formation, using cross-linkers such as N-succinyl 3-(2-pyridyldithio)proprionate (SPDP), or via a carbohydrate moiety in the Fc region of the antibody (Yu et al.1994 Int. J.
- SPDP N-succinyl 3-(2-pyridyldithio)proprionate
- the antibodies disclosed herein or antigen-binding regions thereof can be linked to another functional molecule such as another antibody or ligand for a receptor to generate a bi- specific or multi-specific molecule that binds to at least two or more different binding sites or target molecules.
- Linking of the antibody to one or more other binding molecules, such as another antibody, antibody fragment, peptide or binding mimetic, can be done, for example, by chemical coupling, genetic fusion, or noncovalent association.
- Multi-specific molecules can further include a third binding specificity, in addition to the first and second target epitope.
- Bi-specific and multi-specific molecules can be prepared using methods known in the art. For example, each binding unit of the hi-specific molecule can be generated separately and then conjugated to one another.
- cross-linking agents include protein A, carbodiimide, N-succinimidyl-S-acetyl-thioacetate (SATA), 5,5′-dithiobis(2-nitroberizoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N- succinimidyl-3-(2-pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N- maleimidomethyl)cyclohaxane-I-carboxylate (sulfo-SMCC) (Karpovsky et al.
- binding molecules are antibodies, they can be conjugated by sulfhydryl bonding of the C-terminus hinge regions of the two heavy chains.
- the antibodies or fragments thereof of the present disclosure may be linked to a moiety that is toxic to a cell to which the antibody is bound to form “depleting” antibodies. These antibodies are particularly useful in applications where it is desired to deplete an NK cell.
- the antibodies disclosed herein may also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen.
- Such solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
- the antibodies also can be bound to many different carriers.
- this disclosure also provides compositions containing the antibodies and another substance, active or inert.
- examples of well-known carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylase, natural and modified cellulose, polyacrylamide, agarose, and magnetite.
- the nature of the carrier can be either soluble or insoluble for purposes disclosed herein. Those skilled in the art will know of other suitable carriers for binding monoclonal antibodies, or will be able to ascertain such, using routine experimentation.
- the disclosure relates to an antibody or antigen binding fragment that specifically recognizes or binds a tip or tail domain of a DNABII protein or fragment thereof, the tail fragment or tip fragment.
- the DNABII protein or fragment thereof can be an IHF or an HU polypeptide.
- Functional Analysis with Antibodies can be used to purify the polypeptides disclosed herein and to identify biological equivalent polypeptide and/or polynucleotides. They also can be used to identify agents that modify the function of the polypeptides disclosed herein. These antibodies include polyclonal antisera, monoclonal antibodies, and various reagents derived from these preparations that are familiar to those practiced in the art and described above.
- Antibodies that neutralize the activities of proteins encoded by identified genes can also be used in vivo and in vitro to demonstrate function by adding such neutralizing antibodies into in vivo and in vitro test systems. They also are useful as pharmaceutical agents to modulate the activity of polypeptides disclosed herein.
- Various antibody preparations can also be used in analytical methods such as ELISA assays or Western blots to demonstrate the expression of proteins encoded by the identified genes by test cells in vitro or in vivo. Fragments of such proteins generated by protease degradation during metabolism can also be identified by using appropriate polyclonal antisera with samples derived from experimental samples.
- the antibodies disclosed herein may be used for vaccination or to boost vaccination, alone or in combination with peptides or protein-based vaccines or dendritic-cell based vaccines.
- An immunoglobulin monomer comprises two heavy chains and two light chains connected by disulfide bonds. Each heavy chain is paired with one of the light chains to which it is directly bound via a disulfide bond. Each heavy chain comprises a constant region (which varies depending on the isotype of the antibody) and a variable region.
- the variable region comprises three hypervariable regions (or complementarity determining regions) which are designated CDRH1, CDRH2 and CDRH3 and which are supported within framework regions.
- Each light chain comprises a constant region and a variable region, with the variable region comprising three hypervariable regions (designated CDRL1, CDRL2 and CDRL3) supported by framework regions in an analogous manner to the variable region of the heavy chain.
- the hypervariable regions of each pair of heavy and light chains mutually cooperate to provide an antigen binding site that is capable of binding a target antigen.
- the binding specificity of a pair of heavy and light chains is defined by the sequence of CDR1, CDR2 and CDR3 of the heavy and light chains.
- the set of CDR sequences can, in principle, be inserted into the appropriate positions within any other antibody framework regions linked with any antibody constant regions in order to provide a different antibody with the same antigen binding specificity.
- Antibodies for the production of the Fab fragments can be generated using conventional techniques known in the art and are well-described in the literature. Several methodologies exist for production of polyclonal antibodies.
- polyclonal antibodies are typically produced by immunization of a suitable mammal such as, but not limited to, chickens, goats, sheep, guinea pigs, hamsters, horses, dogs, mice, rats, and rabbits.
- a suitable mammal such as, but not limited to, chickens, goats, sheep, guinea pigs, hamsters, horses, dogs, mice, rats, and rabbits.
- An antigen is injected into the mammal, and induces the B-lymphocytes to produce immunoglobulins specific for the antigen.
- Immunoglobulins may be purified from the mammal's serum.
- Antibodies specific to an IHF ⁇ and/or an IHF ⁇ subunit can be generated by injection of polypeptides corresponding to different epitopes of IHF ⁇ and IHF ⁇ .
- antibodies can be generated using the 20 amino acids of each subunit such as fragments A3 and A5 of IHF, respectively, fragment A5 of HU, fragments B2, B4, and mB4 of IHF.
- Variations of this methodology include modification of adjuvants, routes and site of d i i t ti i j ti l it d th b f it i l f ti l production and humane treatment of the animal.
- adjuvants typically are used to improve or enhance an immune response to antigens. Most adjuvants provide for an injection site antigen depot, which allows for a stow release of antigen into draining lymph nodes.
- adjuvants include surfactants which promote concentration of protein antigen molecules over a large surface area and immunostimulatory molecules.
- Polyclonal antibodies can be generated using methods known in the art some of which are described in U.S. Patent Nos.
- Monoclonal antibodies can be generated using conventional hybridoma techniques known in the art and well-described in the literature.
- a hybridoma is produced by fusing a suitable immortal cell line (e.g., a myeloma cell line such as, but not limited to, Sp2/0, Sp2/0-AG14, NSO, NS1, NS2, AE-1, L.5, P3X63Ag8,653, Sp2 SA3, Sp2 MAI, Sp2 SS1, Sp2 SA5, U397, MIA 144, ACT IV, MOLT4, DA-1, JURKAT, WEHI, K-562, COS, RAJI, NIH 313, HL-60, MLA 144, NAMAIWA, NEURO 2A, CHO, PerC.6, YB2/O) or the like, or heteromyelomas, fusion products thereof, or any cell or fusion cell derived there from, or any other suitable cell line as known in the art (see, those at the following web addresses, e.g., atcc.org, lifetech.com, last accessed on Nov.26, 2007), with antibody producing cells
- Antibody producing cells can also be obtained from the peripheral blood or, in particular embodiments, the spleen or lymph nodes, of humans or other suitable animals that have been immunized with the antigen of interest. Any other suitable host cell can also be used for expressing-heterologous or endogenous nucleic acid encoding an antibody, specified fragment or variant thereof, of the present disclosure.
- the fused cells (hybridomas) or recombinant cells can be isolated using selective culture conditions or other suitable known methods, and cloned by limiting dilution or cell sorting, or other known methods.
- Some embodiments disclosed herein relate to specific hybridomas that produce monoclonal antibodies to IHF fragments; non-limiting examples include IhfA5 NTHI 14G8.F5.G6 (ATCC No. PTA-122334), IhfB4 NTHI 4E11.E5.G2 (ATCC No. PTA-122336), mIhfB4 NTHI 12E6.F8.D12.D5 (ATCC No. PTA-122335).
- Suitable methods of producing or isolating antibodies of the requisite specificity can be used, including, but not limited to, methods that select recombinant antibody from a peptide or protein library (e.g., but not limited to, a bacteriophage, ribosome, oligonucleotide, cDNA, or the like, display library; e.g., as available from various commercial vendors such as MorphoSys (Martinsreid/Planegg, Del.), BioInvent (Lund, Sweden), Affitech (Oslo, Norway) using methods known in the art. Art known methods are described in the patent literature some of which include U.S. Pat.
- Such techniques include, but are not limited to, ribosome display, e.g., Wanes et al. (1997) Proc. Natl. Acad. Sci. USA, 94:4937-4942; Hanes et al. (1998) Proc. Natl. Acad. Sci. USA 95:14130-14135); single cell antibody producing technologies (e.g., selected lymphocyte antibody method (“SLAM”) (U.S. Pat. No.5,627,052, Wen et al. (1987) J. Immunol 17:887-892; Babcook et al. (1996) Proc. Natl. Acad. Sci. USA 93:7843-7848); gel microdroplet and flow cytometry (Powell et al.
- SLAM selected lymphocyte antibody method
- Antibodies may also be produced by inducing in vivo production in the lymphocyte population or by screening recombinant immunoglobulin libraries or panels of highly specific binding reagents (Orlandi et al. (1989) PNAS 86: 3833-3837; Winter et al. (1991) Nature 349: 293-299).
- Single chain antibodies scF v s
- Single chain antibodies comprise a heavy chain variable region and a light chain variable region connected with a linker peptide (typically around 5 to 25 amino acids in length).
- the variable regions of the heavy chain and the light chain may be derived from the same antibody or different antibodies.
- scFvs may be synthesized using recombinant techniques, for example by expression of a vector encoding the scF v in a host organism such as E. coli.
- DNA encoding scFv can be obtained by performing amplification using a partial DNA encoding the entire or a desired amino acid sequence of a DNA selected from a DNA encoding the heavy chain or the variable region of the heavy chain of the above- mentioned antibody and a DNA encoding the light chain or the variable region of the light chain thereof as a template, by PCR using a primer pair that defines both ends thereof, and further performing amplification combining a DNA encoding a polypeptide linker portion and a primer pair that defines both ends thereof, so as to ligate both ends of the linker to the heavy chain and the light chain, respectively.
- An expression vector containing the DNA encoding scFv and a host transformed by the expression vector can be obtained according to conventional methods known in the art.
- Antigen binding fragments for example the F(ab′)2 fragments, can be produced by pepsin digestion of the antibody molecule and the Fab fragments which can be generated by reducing the disulfide bridges of the F(ab′) 2 fragments.
- Fab fragments in particular murine Fab fragments produced from murine monoclonal antibodies, can also be produced by digestion of the antibody with the thiol protease ficin in the presence of cysteine.
- Fab fragments in particular rabbit Fab fragments produced from rabbit polyclonal antibodies, may also be produced by digestion of the antibody with the protease papain in the presence of cysteine-HCl.
- Fab expression libraries may be constructed to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity (Huse et al. (1989) Science 256:1275-1281). Upon generation of the fragment, the fragment can be isolated and sequenced using conventional techniques and the amino acid sequence is determined.
- Antibody derivatives of the present disclosure can also be prepared by delivering a polynucleotide encoding an antibody fragment, antigen binding fragment or polypeptide as disclosed herein to a suitable host such as to provide transgenic animals or mammals, such as goats, cows, horses, sheep, and the like, that produce such antibodies in their milk.
- a suitable host such as to provide transgenic animals or mammals, such as goats, cows, horses, sheep, and the like, that produce such antibodies in their milk.
- the parental antibodies from which the antibody fragments, antigen binding fragments and polypeptides as disclosed herein, also include derivatives that are modified by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from generating an anti-idiotypic response.
- Antibody derivatives include, but are not limited to, antibodies that have been modified by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc.
- Non-limiting examples of the modified antibodies contemplated herein are aglycosylated whole antibody molecules, antibody fragments, or fusion proteins that include a region equivalent to the Fc region of an immunoglobulin.
- Such aglycosylate forms can be generated, for example, in host cells that lack the ability to modify proteins with N-linked glycans or by mutating N-linked consensus sites on the antibody of interest.
- the derivatives may contain one or more non-classical amino acids.
- Antibody derivatives of the parental antibodies also can be prepared by delivering a polynucleotide disclosed herein to provide transgenic plants and cultured plant cells (e.g., but not limited to tobacco, maize, and duckweed) that produce such antibodies, specified portions or variants in the plant parts or in cells cultured therefrom.
- a polynucleotide disclosed herein to provide transgenic plants and cultured plant cells (e.g., but not limited to tobacco, maize, and duckweed) that produce such antibodies, specified portions or variants in the plant parts or in cells cultured therefrom.
- Transgenic maize have been used to express mammalian proteins at commercial production levels, with biological activities equivalent to those produced in other recombinant systems or purified from natural sources. See, e.g., Hood et al. (1999) Adv. Exp. Med. Biol.464:127-147 and references cited therein.
- Antibody derivatives have also been produced in large amounts from transgenic plant seeds including antibody fragments, such as single chain antibodies (scFv's), including tobacco seeds and potato tubers. See, e.g., Conrad et al. (1998) Plant Mol. Biol.38:101-109 and references cited therein.
- scFv's single chain antibodies
- Antibody derivatives of the parental antibodies also can be produced, for example, by adding exogenous sequences to modify immunogenicity or to reduce, enhance or modify binding, affinity, on-rate, off-rate, avidity, specificity, half-life, or any other suitable characteristic. Generally part or all of the non-human or human CDR sequences are maintained while the non-human sequences of the variable and constant regions are replaced with human or other amino acids.
- Humanization or engineering of antibodies can be performed using any known method such as, but not limited to, those described in U.S. Pat.
- Chimeric, humanized or primatized parental antibodies of the antibody fragments, antigen binding fragments or polypeptides of the present disclosure can be prepared based on the sequence of a reference monoclonal antibody prepared using standard molecular biology techniques. Such antibodies may be used to generate the antibody fragments (e.g., Fab fragment or antigen binding fragment) of the present disclosure.
- DNA encoding the heavy and light chain immunoglobulins can be obtained from the hybridoma of interest and engineered to contain non-reference (e.g., human) immunoglobulin sequences using standard molecular biology techniques.
- the murine variable regions can be linked to human constant regions using methods known in the art (U.S.
- Patent No.4,816,567 To create a humanized antibody, the murine CDR regions can be inserted into a human framework using methods known in the art (U.S. Patent No.5,225,539 and U.S. Patent Nos.5,530,101; 5,585,089; 5,693,762; and 6,180,370). Similarly, to create a primatized antibody the murine CDR regions can be inserted into a primate framework using methods known in the art (PCT International Pat. Application Publication Nos. WO 93/02108 and WO 99/55369). [0424] Techniques for making partially to fully human antibodies are known in the art and any such techniques can be used.
- fully human antibody sequences are made in a transgenic mouse which has been engineered to express human heavy and light chain antibody genes. Multiple strains of such transgenic mice have been made which can produce different classes of antibodies. B cells from transgenic mice which are producing a desirable antibody can be fused to make hybridoma cell lines for continuous production of the desired antibody.
- Chimeric antibodies are those in which the various domains of the antibodies' heavy and light chains are coded for by DNA from more than one species. See, e.g., U.S. Pat. No.4,816,567.
- the antibodies disclosed herein can also be modified to create veneered antibodies. Veneered antibodies are those in which the exterior amino acid residues of the antibody of one species are judiciously replaced or “veneered” with those of a second species so that the antibodies of the first species will not be immunogenic in the second species thereby reducing the immunogenicity of the antibody.
- the immunogenicity of an antibody could be d d b l i th d id hi h diff f th ll f d i th mammalian species antibodies.
- This judicious replacement of exterior residues should have little, or no, effect on the interior domains, or on the interdomain contacts.
- ligand binding properties should be unaffected as a consequence of alterations which are limited to the variable region framework residues.
- the process is referred to as “veneering” since only the outer surface or skin of the antibody is altered, the supporting residues remain undisturbed.
- the antibody fragments, antigen binding fragments and polypeptides as disclosed herein can be recovered and purified from recombinant cell cultures by known methods including, but not limited to, protein A purification, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography.
- HPLC High performance liquid chromatography
- Antibodies for the preparation the antibody fragments, antigen binding fragments or of the present disclosure include naturally purified products, products of chemical synthetic procedures, and products produced by recombinant techniques from a eukaryotic host, including, for example, yeast, higher plant, insect and mammalian cells, or alternatively from a prokaryotic host as described above. A number of antibody production systems are described in Birch & Radner (2006) Adv. Drug Delivery Rev.58:671-685. [0430] If an antibody fragment being tested binds with protein or polypeptide, then the antibody fragment being tested and the antibody fragments provided by this disclosure are equivalent.
- an antibody fragment has the same specificity as the antibody fragment disclosed herein by determining whether the antibody being tested prevents an antibody fragment disclosed herein from binding the protein or polypeptide with which the antibody fragment is normally reactive. If the antibody fragment being tested competes with the antibody fragment disclosed herein as shown by a decrease in binding by the antibody fragment disclosed herein, then it is likely that the two antibody fragments bind to the same or a closely related epitope. Alternatively, one can pre-incubate the antibody fragment disclosed herein with a protein with which it is normally reactive, and determine if the antibody fragment being tested is inhibited in its ability to bind the antigen.
- antibody and “antibody fragment” also is intended to include antibodies of all immunoglobulin isotypes and subclasses. Particular isotypes of a monoclonal antibody can be prepared either directly by selecting from an initial fusion, or prepared secondarily, from a parental hybridoma secreting a monoclonal antibody of different isotype by using the sib selection technique to isolate class switch variants using the procedure described in Steplewski et al. (1985) Proc. Natl. Acad. Sci. USA 82:8653 or Spira et al.
- the antibody fragment, antigen binding fragment or polypeptide can be labeled with a detectable moiety such as a radioactive atom, a chromophore, a fluorophore, or the like.
- a detectable moiety such as a radioactive atom, a chromophore, a fluorophore, or the like.
- Such labeled antibodies can be used for diagnostic techniques, either in vivo, or in an isolated test sample.
- the coupling of antibodies, fragments and polypeptides to low molecular weight haptens can increase the sensitivity of the antibody fragment or polypeptide in an assay. The haptens can then be specifically detected by means of a second reaction.
- variable region of the parental antibodies of the present disclosure can be modified by mutating amino acid residues within the VH and/or VL CDR 1, CDR 2 and/or CDR 3 regions to improve one or more binding properties (e.g., affinity) of the antibody. Mutations may be introduced by site-directed mutagenesis or PCR-mediated mutagenesis and the effect on antibody binding, or other functional property of interest, can be evaluated in appropriate in vitro or in vivo assays.
- conservative modifications are introduced and typically no more than one, two, three, four or five residues within a CDR region are altered.
- the mutations may be amino acid substitutions, additions or deletions.
- Framework modifications can be made to the parental antibodies to decrease immunogenicity, for example, by “backmutating” one or more framework residues to the corresponding germline sequence.
- the antibody fragments, antigen binding fragments or polypeptides disclosed herein may be engineered to include modifications within the Fc region to alter one or more functional properties of the antibody, such as serum half-fife, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
- Such modifications include, but are not limited to, alterations of the number of cysteine residues in the hinge region to facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody (U.S. Patent No.5,677,425) and amino acid mutations in the Fc hinge region to decrease die biological half-life of the antibody (U.S. Patent No.6,165,745).
- the antibody fragments disclosed herein may be chemically modified. Glycosylation of an antibody can be altered, for example, by modifying one or more sites of glycosylation within the antibody sequence to increase the affinity of the antibody for antigen (U.S. Patent Nos.5,714,350 and 6,350,861).
- a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures can be obtained by expressing the antibody in a host cell with altered glycosylation mechanism (Shields et al. (2002) J. Biol. Chem.277:26733-26740; Umana et al. (1999) Nat. Biotech.17:176-180).
- the antibodies fragment, antigen binding fragment or polypeptide as disclosed herein can be pegylated to increase biological half-life by reacting the antibody or fragment thereof with polyethylene glycol (PEG) or a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
- Pegylation may be carried out by an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water soluble polymer).
- polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy- polyethylene glycol or polyethylene glycol-maleimide.
- the antibody to be pegylated can be an aglycosylated antibody. Methods for pegylating proteins are known in the art and can be applied to the antibodies disclosed herein (EP 0154316 and EP 0401384).
- the antibody binding fragment, antigen binding fragment or polypeptides may be chemically modified by conjugating or fusing the antigen-binding region to serum protein, such as human serum albumin, to increase half-life of the resulting molecule.
- the antibody fragment, antigen binding fragment or polypeptide as disclosed herein may be conjugated to a diagnostic agent and used diagnostically, for example, to monitor the development or progression of a disease and determine the efficacy of a given treatment regimen.
- diagnostic agents include enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions.
- the detectable substance may be coupled or conjugated either directly to the antibody or fragment thereof, or indirectly, through a linker using techniques known in the art.
- Suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase.
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin.
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, h d i di hl t i i l i fl i d l hl id h th i
- a l of a luminescent material includes luminol.
- bioluminescent materials include luciferase, luciferin, and aequorin.
- radioactive material examples include 125 I, 131 I, Indium-111, Lutetium-171, Bismuth-212, Bismuth-213, Astatine-211, Copper-62, Copper- 64, Copper-67, Yttrium-90, Iodine-125, Iodine-131, Phosphorus-32, Phosphorus-33, Scandium-47, Silver-111, Gallium-67, Praseodymium-142, Samarium-153, Terbium-161, Dysprosium-166, Holmium-166, Rhenium-186, Rhenium-188, Rhenium-189, Lead-212, Radium-223, Actinium-225, Iron-59, Selenium-75, Arsenic-77, Strontium-89, Molybdenum- 99, Rhodium-1105, Palladium-109, Praseodymium-143, Promethium-149, Erbium-169, Iridium-194, Gold-198, Gold-199, and Lead-211.
- Monoclonal antibodies may be indirectly conjugated with radiometal ions through the use of bifunctional chelating agents that are covalently linked to the antibodies.
- Chelating agents may be attached through amities (Meares et al. (1984) Anal. Biochem.142:68-78); sulfhydral groups (Koyama 1994 Chem. Abstr.120: 217262t) of amino acid residues and carbohydrate groups (Rodwell et al. (1986) PNAS USA 83:2632-2636; Quadri et al. (1993) Nucl. Med. Biol.20:559-570).
- the antibody fragment, antigen binding fragment or polypeptide of the present disclosure may be conjugated to a therapeutic agent.
- Suitable therapeutic agents include antibiotics or antimicrobials for example, or host defense peptides (e.g., specifically targeted antimicrobial peptides (STAMPs)).
- Additional suitable conjugated molecules include ribonuclease (RNase), DNase, an antisense nucleic acid, an inhibitory RNA molecule such as a siRNA molecule, an immunostimulatory nucleic acid, aptamers, ribozymes, triplex forming molecules, and external guide sequences.
- Aptamers are small nucleic acids ranging from 15-50 bases in length that fold into defined secondary and tertiary structures, such as stem-loops or G- quartets, and can bind small molecules, such as ATP (U.S. Pat.
- Ribozymes are nucleic acid molecules that are capable of catalyzing a chemical reaction, either intra- molecularly or inter-molecularly. Ribozymes typically cleave nucleic acid substrates through recognition and binding of the target substrate with subsequent cleavage.
- Triplex forming function nucleic acid molecules can interact with double-stranded or single-stranded nucleic acid by forming a triplex, in which three strands of DNA form a complex dependent on both Watson-Crick and Hoogsteen base-pairing. Triplex molecules can bind target regions with high affinity and specificity. Suitable conjugated molecules may further include any protein that binds to DNA provided that it does not create or stabilize biofilm architecture; it is envisioned that at least a subset of such proteins may facilitate the kinetics of binding for the agents disclosed herein.
- the functional nucleic acid molecules may act as effectors, inhibitors, modulators, and stimulators of a specific activity possessed by a target molecule, or the functional nucleic acid molecules may possess a de novo activity independent of any other molecules.
- the therapeutic agents can be linked to the fragment or polypeptide directly or indirectly, using any of a large number of available methods. For example, an agent can be attached at the hinge region of the reduced antibody component via disulfide bond formation, using cross-linkers such as N-succinyl 3-(2-pyridyldithio) proprionate (SPDP), or via a carbohydrate moiety in the Fc region of the antibody (Yu et al. (1994) Int. J.
- the fragments or polypeptides can be linked to another functional molecule such as another antibody or ligand for a receptor to generate a bi-specific or multi-specific molecule that binds to at least two or more different binding sites or target molecules.
- Linking of the antibody to one or more other binding molecules, such as another antibody, antibody fragment, peptide or binding mimetic, can be done, for example, by chemical coupling, genetic fusion, or non-covalent association.
- Multi-specific molecules can further include a third binding specificity, in addition to the first and second target epitope.
- Bi-specific and multi-specific molecules can be prepared using methods known in the art. For example, each binding unit of the hi-specific molecule can be generated separately and then conjugated to one another.
- cross-linking agents include protein A, carbodiimide, N-succinimidyl-S-acetyl-thioacetate (SATA), 5,5′-dithiobis(2-nitroberizoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N- succinimidyl-3-(2-pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N- maleimidomethyl)cyclohaxane-I-carboxylate (sulfo-SMCC) (Karpovsky et al.
- the antibody fragment, antigen binding fragment or polypeptide as disclosed herein may also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen.
- solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
- the antibody fragment, antigen binding fragment or polypeptide also can be bound to many different carriers.
- this disclosure also provides compositions containing the fragments or polypeptides and another substance, active or inert.
- examples of well-known carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylase, natural and modified cellulose, polyacrylamide, agarose, and magnetite.
- the nature of the carrier can be either soluble or insoluble for purposes disclosed herein. Those skilled in the art will know of other suitable carriers for binding monoclonal antibodies, or will be able to ascertain such, using routine experimentation.
- compositions comprising, or alternatively consisting essentially of, or yet further consisting of, one or more of the above embodiments are further provided herein.
- polynucleotides that encode the amino acid sequence of the antibody fragment, the antigen binding fragment or polypeptides, as well as methods to produce recombinantly or chemically synthesize the fragments and polypeptides.
- the antibody polypeptides and fragments can be produced in a eukaryotic or a prokaryotic cell, or by other methods known in the art and briefly described herein.
- the fragments and isolated polypeptides comprising the fragments disclosed herein may be selected such that they have a high level of epitope binding specificity and high binding affinity to the biofilm.
- the fragments and isolated polypeptides comprising the antibody fragments of the present technology useful in the disclosed methods usually have binding affinities of at least 10 -6 , 10 -7 , 10 -8 , 10 -9 , 10 -10 , 10 -11 , or 10 -12 M.
- the fragments and isolated polypeptides comprising the antibody fragments have a sufficient kinetic on-rate to reach equilibrium under standard conditions in at least 12 hours, at least 5 hours, at least 1 hour, or at least 30 minutes.
- the affinity of the antibody or antigen binding fragment is less than or about 1000 picoMole (pM), less than about 900 pM, less than about 800 pM, less than about 700 pM, less than about 600 pM, less than about 500 pM, less than about 400 pM, less than about 300 pM, less than about 200 pM, less than about 100 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, or about 10 pM, or about 9 pM, or about 8 pM, or alternatively less than about 4 pM, or alternatively less than about 2 pM.
- pM picoMole
- a peptide linker can be added to the N-terminus or C-terminus of the antibody fragment, antigen binding fragment or polypeptide as disclosed herein.
- a “linker” or “peptide linker” refers to a peptide sequence linked to either the N- terminus or the C-terminus of a polypeptide sequence. In one aspect, the linker is from about 1 to about 20 amino acid residues long or alternatively 2 to about 10, about 3 to about 5 amino acid residues long.
- An example of a peptide linker is Gly-Pro-Ser-Leu-Lys-Leu (SEQ ID NO.43).
- the ⁇ -lactam antibiotic comprises, or consists essentially of, or yet further consists of amoxicillin plus clavulanic acid (AMC).
- the ⁇ -lactam antibiotic comprises, or consists essentially of, or yet further consists of one or more of: Benzathine, benzylpenicillin (Penicillin G), Benzathine penicillin G, Benzathine penicillin V, Phenoxymethylpenicillin (penicillin V), Procaine penicillin, Pheneticillin, Cloxacillin, Dicloxacillin, Flucloxacillin, Methicillin, Nafcillin, Oxacillin, Temocillin, Amoxicillin, Ampicillin, Mecillinam, Piperacillin, Carbenicillin, Ticarcillin, Carboxypenicillin, Ureidopenicillin, Azlocillin, Mezlocillin; Cefazolin, Cephalexin, Cephalosporin C, Cephalothin, Cefapirin, Cefaclor, Cefamandole, Cefuroxime, Cefotetan, Cefoxitin, Ce
- the sulfonamide antibiotic comprises, or consists essentially of, or yet further consists of trimethoprim plus sulfamethoxazole (TMP-SMX).
- TMP-SMX trimethoprim plus sulfamethoxazole
- the sulfonamide antibiotic comprises, or consists essentially of, or yet further consists of one or more of the following: Sulfafurazole; Sulfacetamide, Sulfadiazine, Sulfadimidine, Sulfafurazole (sulfisoxazole), Sulfisomidine (sulfaisodimidine), Sulfamethoxazole, Sulfamoxole, Sulfanitran, Sulfadimethoxine, Sulfamethoxypyridazine, Sulfametoxydiazine, Sulfadoxine, Sulfametopyrazine, or Terephty
- the antibiotic comprises, or consists essentially of, or yet further consists of one or more of the following: ampicillin, amoxicillin-clavulanate, and Cefdinir.
- Administration Protocols [0457] Routes of administration applicable to the methods disclosed herein include intranasal, intramuscular, urethrally, intratracheal, subcutaneous, intradermal, transdermal, topical application, intravenous, rectal, nasal, oral, inhalation, and other enteral and parenteral routes of administration. Routes of administration may be combined, if desired, or adjusted depending upon the agent and/or the desired effect. An active agent can be administered in a single dose or in multiple doses.
- routes of administration suitable for the methods disclosed herein include, but are not limited to, direct injection, enteral, parenteral, or inhalational routes.
- Parenteral routes of administration other than inhalation administration include, but are not limited to, topical, transdermal, subcutaneous, intramuscular, intraorbital, intracapsular, intraspinal, intrasternal, and intravenous routes, i.e., any route of administration other than through the alimentary canal.
- Parenteral administration can be conducted to effect systemic or local delivery of the inhibiting agent. Where systemic delivery is desired, administration typically involves invasive or systemically absorbed topical or mucosal administration of pharmaceutical preparations.
- the agents disclosed herein can also be delivered to the subject by enteral administration.
- Enteral routes of administration include, but are not limited to, oral and rectal (e.g., using a suppository) delivery.
- Methods of administration of the active through the skin or mucosa include, but are not limited to, topical application of a suitable pharmaceutical preparation, transcutaneous transmission, transdermal transmission, injection and epidermal administration.
- transdermal transmission absorption promoters or iontophoresis are suitable methods.
- Iontophoretic transmission may be accomplished using commercially available “patches” that deliver their product continuously via electric pulses through unbroken skin for periods of several days or more.
- the interfering agent will be administered by inhalation, injection or orally on a continuous, daily basis, at least once per day (QD), and in various embodiments two (BID), three (TID), or even four times a day.
- the therapeutically effective daily dose will be at least about 1 mg, or at least about 10 mg, or at least about 100 mg, or about 200 to about 500 mg, and sometimes, depending on the compound, up to as much as about 1 g to about 2.5 g.
- compositions described herein can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, for example, to determine the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50. In certain embodiments, compositions exhibit high therapeutic indices.
- the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
- the dosage of such compounds lies (in certain embodiments, within a range of circulating concentrations that include the ED50 with little or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
- the therapeutically effective dose can be estimated initially from cell culture assays.
- a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC 50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography.
- an effective amount of a composition sufficient for achieving a therapeutic or prophylactic effect ranges from about 0.000001 mg per kilogram body weight per administration to about 10,000 mg per kilogram body weight per administration.
- the dosage ranges are from about 0.0001 mg per kilogram body weight per administration to about 100 mg per kilogram body weight per administration.
- Administration can be provided as an initial dose, followed by one or more “booster” doses.
- Booster doses can be provided a day, two days, three days, a week, two weeks, three weeks, one, two, three, six or twelve months after an initial dose.
- a booster dose is administered after an evaluation of the subject's response to prior administrations.
- certain factors may influence the dosage and timing required to effectively treat a subject, including but not limited to, the severity of the disease or disorder, previous treatments, the general health and/or age of the subject, and other diseases present.
- treatment of a subject with a therapeutically effective amount of the therapeutic compositions described herein can include a single treatment or a series of treatments.
- the methods are useful to screen for or confirm agents having the same, similar or opposite ability as the polypeptides, polynucleotides, antibodies or fragments thereof, host cells, small molecules and compositions disclosed herein. Alternatively, they can be used to identify which agent is best suited to treat a microbial infection. For example, one can screen for new agents or combination therapies by having two samples containing for example, the DNABII polypeptide and microbial DNA and the agent to be tested. The second sample contains the DNABII polypeptide and microbial DNA and an agent known to active, e.g., an anti-IHF antibody or a small molecule to serve as a positive control.
- an agent known to active e.g., an anti-IHF antibody or a small molecule to serve as a positive control.
- the agents are added to the system in increasing dilutions to determine the optimal dose that would likely be effective in treating a subject in the clinical setting.
- a negative control containing the DNABII polypeptide and the microbial DNA can be provided.
- the DNABII polypeptide and the microbial DNA are detectably labeled, for example with luminescent molecules that will emit a signal when brought into close contact with each other.
- the samples are contained under similar conditions for an effective amount of time for the agent to inhibit, compete or titrate the interaction between the DNABII polypeptide and microbial DNA and then the sample is assayed for emission of signal from the luminescent molecules.
- the in vitro method is practiced in a miniaturized chamber slide system wherein the microbial (such as a bacterial) isolate causing an infection could be isolated from the human/animal then cultured to allow it to grow as a biofilm in vitro, see for example experiments below.
- the agent such as anti-IHF antibody
- potential agent such as an anti-IHF (or other antibody, small molecule, agent, etc.) to find the optimal dose that would likely be effective at treating that patient when delivered to the subject where the infection existed.
- the method is practiced in a high throughput platform with the agent (such as anti-IHF antibody) and/or potential agent (alone or in combination with another agent) in a flow cell.
- the agent (such as anti-IHF antibody) or potential agent is added alone or in combination with another agent to the culture with or without increasing dilutions of the potential agent or agent such as an anti-IHF (or other antibody, small molecule, agent, etc.) to find the optimal dose that would likely be effective at treating that patient when delivered to the subject where the infection existed.
- Biofilm isolates are sonicated to separate biofilm bacteria from DNABII polypeptide such as IHF bound to microbial DNA.
- the DNABII polypeptide—DNA complexes are isolated by virtue of the anti-IHF antibody on the platform.
- the microbial DNA is then be released with e.g., a salt wash, and used to identify the biofilm bacteria added.
- the freed DNA is then identified, e.g., by PCR sequenced. If DNA is not freed, then the agent(s) successfully performed or bound the microbial DNA. If DNA is found in the sample, then the agent did not interfere with DNABII polypeptide-microbial DNA binding.
- a positive and/or negative control can be simultaneously performed.
- one or more of the agents or antibodies disclosed herein are used in a method of detecting a biofilm in vivo.
- the agents or antibodies are detectably labeled, for example with a luminescent or fluorescent molecule.
- Further applications of the methods disclosed herein include methods of use of such agents or antibodies to image a biofilm using, for example, a detectably labeled primary agent or antibody which provides a detectable signal upon binding to the biofilm or a detectably labeled secondary antibody which binds to the primary agent or antibody when it is bound to the biofilm.
- the methods can be used to identify the microbe causing the infection and/or confirm effective agents in an industrial setting.
- an antibiotic or antimicrobial known to inhibit growth of the underlying infection is added sequentially or concurrently, to determine if the infection can be inhibited. It is also possible to add the agent to the microbial DNA or DNABII polypeptide before adding the complex to assay for biofilm inhibition.
- the method When practiced in vivo in non-human animal such as a chinchilla, the method provides a pre-clinical screen to identify agents that can be used alone or in combination with other agents to break down biofilms.
- a method of inhibiting, dissolving preventing or breaking down a biofilm in a subject by administering to the subject an effective amount of a polypeptide, polynucleotide, vector, host cell, antibody or antigen binding fragment thereof, thereby inhibiting, preventing, dissolving or breaking down the microbial biofilm.
- methods of inhibiting, dissolving preventing or breaking down a biofilm may be practiced in vitro and/or ex vivo and involve providing a sample of the biofilm – taken from a subject or generated in vitro – and administering an effective amount of a polypeptide, polynucleotide, vector, host cell, antibody or antigen binding fragment thereof, thereby inhibiting, preventing or breaking down the microbial biofilm.
- the compositions disclosed herein may be used in method embodiments for inhibiting, preventing, or breaking down microbial biofilms on surfaces colonized by biofilms such as, but not limited to, hospital instruments, industrial equipment, and other materials not comprised of living tissue.
- the methods disclosed herein comprise, or alternatively consist essentially of, or yet further comprise, administering one or more of a polypeptide, polynucleotide, vector, host cell, antibody or antigen binding fragment thereof, alone or in combination.
- the agents may be administered simultaneously.
- the antibodies are administered sequentially.
- Also provided herein is a method for inducing an immune response in or conferring passive immunity on subject in need thereof, comprising, or alternatively consisting essentially of, or yet further consisting of, administering to the subject an effective amount of one or more of a polypeptide, polynucleotide, vector, host cell, antibody or antigen binding fragment thereof as disclosed herein.
- the antibody or antigen binding fragment is not a polyclonal antibody.
- the methods further comprise, or alternatively consist essentially of, or yet further consist of administering to the subject an effective amount of one or more of an antimicrobial, an antigenic peptide or an adjuvant.
- an antimicrobial agent are antibodies directed against vaccine component such as a surface antigen, e.g., an OMP P5, rsPilA, OMP 26, OMP P2, or Type IV Pilin protein (see Jurcisek and Bakaletz (2007) J. Bacteriology 189(10):3868-3875; Murphy et al.
- agents and compositions disclosed herein can be concurrently or sequentially administered with other antimicrobial agents and/or surface antigens.
- administration is locally to the site of the infection by direct injection or by inhalation for example.
- Other non-limiting examples of administration include by one or more method comprising transdermally, urethrally, sublingually, rectally, vaginally, ocularly, subcutaneous, intramuscularly, intraperitoneally, intranasally, by inhalation or orally.
- These microbial infections may be present in the upper, mid and lower airway (otitis, sinusitis, bronchitis but also exacerbations of chronic obstmctive pulmonary disease (COPD), chronic cough, complications of and/or primary cause of cystic fibrosis (CF) and community acquired pneumonia (CAP).
- COPD chronic obstmctive pulmonary disease
- COPD chronic cough
- CF cystic fibrosis
- CAP community acquired pneumonia
- Infections might also occur in the oral cavity (caries, periodontitis) and caused by Streptococcus mutans, Porphyromonas gingivalis, Aggregatibacter actinomvctemcomitans. Infections might also be localized to the skin (abscesses, ‘staph’ infections, impetigo, secondary infection of bums, Lyme disease) and caused by Staphylococcus aureus, Staphylococcus epidermidis, Pseudomonas aeruginosa and Borrelia burdorferi. Infections of the urinary tract (UTI) can also be treated and are typically caused by Escherichia coli.
- Infections of the gastrointestinal tract are typically caused by Salmonella enterica serovar, Vibrio cholerae and Helicobacter pylori.
- Infections of the genital tract include and are typically caused by Neisseria gonorrhoeae .
- Infections can be of the bladder or of an indwelling device caused by Enterococcus faecalis.
- Infections associated with implanted prosthetic devices, such as artificial hip or knee replacements, or dental implants, or medical devices such as pumps, catheters, stents, or monitoring systems, typically caused by a variety of bacteria, can be treated by the methods disclosed herein. These devices can be coated or conjugated to an agent as described herein.
- these diseases and complications from these infections can also be prevented or treated.
- Infections caused by Streptococcus agalactiae can also be treated by the methods disclosed herein and it is the major cause of bacterial septicemia in newborns. Infections caused by Neisseria meningitidis which can cause meningitis can also be treated.
- the biologically active fragment of an antibody comprises, or consists essentially of, or yet further consists of an isolated polypeptide comprising, or alternatively consisting essentially of, or yet further consisting of heavy and light chains of the antibody, an antigen binding fragment thereof, CDRs and equivalents of each thereof with the addition of up to 25, or alternatively 20, or alternatively 15, or alternatively up to 10, or alternatively up to 5 random amino acids on either the amino or carboxyl termini (or on both).
- the biologically active fragment can further comprise a detectable or purification marker.
- the biologically active fragment of a peptide and/or an antibody comprises, or consists essentially of, or yet further consists of an isolated or recombinant polypeptide comprising, or alternatively consisting essentially of, or yet further consisting of, one, two or more, or three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, ten or more, eleven or more, twelve or more, thirteen or more of, fourteen or more of, or all of the polypeptides as disclosed herein, or a fragment or an equivalent of each thereof.
- a peptide linker can be added to the N-terminus or C-terminus of the polypeptide.
- linker refers to a peptide sequence linked to either the N-terminus or the C-terminus of a polypeptide sequence.
- the linker is from about 1 to about 20 amino acid residues long or alternatively 2 to about 10, about 3 to about 5 amino acid residues long.
- An example of a peptide linker is Gly-Pro-Ser- Leu-Lys-Leu (SEQ ID NO:).
- the isolated polypeptides disclosed herein are intended to include recombinantly produced polypeptides and proteins from prokaryotic and eukaryotic host cells, as well as muteins, analogs and fragments thereof, examples of such cells are described above. In some embodiments, the term also includes antibodies and anti-idiotypic antibodies as described herein.
- polypeptides can be isolated or produced using the methods known in the art and briefly described herein. [0491] It is understood that functional equivalents or variants of the wild type polypeptide or protein also are within the scope of this disclosure, for example, those having conservative amino acid substitutions of the amino acids. [0492] In a further aspect, the polypeptides are conjugated or linked to a detectable label or an agent to increase the half-life of the polypeptide, e.g., PEGylation a PEG mimetic, polysialyation, HESylation or glycosylation. Suitable labels are known in the art and described herein.
- polypeptides with or without a detectable label can be contained or expressed on the surface of a host prokaryotic or eukaryotic host cell, such as a dendritic cell.
- a host prokaryotic or eukaryotic host cell such as a dendritic cell.
- the proteins and polypeptides are obtainable by a number of processes known to those of skill in the art, which include purification, chemical synthesis and recombinant methods. Polypeptides can be isolated from preparations such as host cell systems by methods such as immunoprecipitation with antibody, and standard techniques such as gel filtration, ion-exchange, reversed-phase, and affinity chromatography. For such methodology, see for example Deutscher et al.
- polypeptides also can be obtained by chemical synthesis using a commercially available automated peptide synthesizer such as those manufactured by Perkin/Elmer/Applied Biosystems, Inc., Model 430A or 431A, Foster City, Calif., USA.
- the synthesized polypeptide can be precipitated and further purified, for example by high performance liquid chromatography (HPLC).
- this disclosure also provides a process for chemically synthesizing the proteins disclosed herein by providing the sequence of the protein and reagents, such as amino acids and enzymes and linking together the amino acids in the proper orientation and linear sequence.
- the proteins and polypeptides can be obtained by well-known recombinant methods as described, for example, in Sambrook et al. (1989) supra, using a host cell and vector systems described herein.
- antibodies that are specific for the tail regions of the DNABII polypeptides are particularly useful in diagnostic assays for the detection of biofilms and can be used alone or in combination of one or more antibodies as described herein.
- antibodies specific for the tail regions are used as a companion diagnostic for an antibody that is specific for a tip region of the DNABII polypeptide (including but not limited to: a tip region of IHF or HU, a tip region of IHFA or IHFB, and/or the tip-chimeric peptide IhfA5-mIhfB4 N THi).
- amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.
- a peptide of three or more amino acids is commonly called an oligopeptide if the peptide chain is short. If the peptide chain is long, the peptide is commonly called a polypeptide or a protein.
- Peptides disclosed herein can be modified to include unnatural amino acids.
- the peptides may comprise D-amino acids, a combination of and L-amino acids, and various “designer” amino acids (e.g., beta-methyl amino acids, C-alpha-methyl amino acids, and N- alpha-methyl amino acids, etc.) to convey special properties to peptides.
- various “designer” amino acids e.g., beta-methyl amino acids, C-alpha-methyl amino acids, and N- alpha-methyl amino acids, etc.
- peptides with alpha-helices, beta turns, beta sheets, gamma-turns, and cyclic peptides can be generated.
- alpha-helical secondary structure or random secondary structure may be of particular use.
- polypeptides disclosed herein also can be combined with various solid phase carriers, such as an implant, a stent, a paste, a gel, a dental implant, or a medical implant or liquid phase carriers, such as beads, sterile or aqueous solutions, pharmaceutically acceptable carriers, pharmaceutically acceptable polymers, liposomes, micelles, suspensions and emulsions.
- solid phase carriers such as an implant, a stent, a paste, a gel, a dental implant, or a medical implant or liquid phase carriers, such as beads, sterile or aqueous solutions, pharmaceutically acceptable carriers, pharmaceutically acceptable polymers, liposomes, micelles, suspensions and emulsions.
- non-aqueous solvents include propyl ethylene glycol, polyethylene glycol and vegetable oils.
- the carriers also can include an adjuvant that is useful to non-specifically augment a specific immune response. A skilled artisan can easily determine whether an adjuvant is required and select one.
- suitable adjuvants include, but are not limited to Freund's Complete and Incomplete, mineral salts and polynucleotides.
- suitable adjuvants include monophosphoryl lipid A (MPL), mutant derivatives of the heat labile enterotoxin of E. coli, mutant derivatives of cholera toxin, CPG oligonucleotides, and adjuvants derived from squalene.
- MPL monophosphoryl lipid A
- mutant derivatives of the heat labile enterotoxin of E. coli mutant derivatives of cholera toxin
- CPG oligonucleotides CPG oligonucleotides
- adjuvants derived from squalene derived from squalene.
- compositions are useful for various diagnostic and therapeutic methods as described herein.
- Polynucleotides [0502] Also provided are isolated or recombinant polynucleotides encoding one or more of the above-identified antibodies, fragments thereof, CDRs, isolated or recombinant polypeptides and their respective complementary strands.
- Vectors comprising the isolated or recombinant polynucleotides are further provided examples of which are known in the art and briefly described herein.
- the isolated or recombinant polynucleotides can be contained within a polycistronic vector.
- the polynucleotides can be DNA, RNA, mRNA or interfering RNA, such as siRNA, miRNA or dsRNA.
- Such polynucleotide and vectors can be used to deliver the antibody, polypeptide, or a biologically active fragment of each thereof to a subject in needed via administering to the subject and expressing the antibody, polypeptide or biologically active fragment.
- this disclosure provides an interfering agent that is a polynucleotide that interferes with the binding of the DNA to a polypeptide or protein in a microbial biofilm, or a four-way junction polynucleotide resembling a Holliday junction, a 3 way junction polynucleotide resembling a replication fork, a polynucleotide that has inherent flexibility or bent polynucleotide which can treat or inhibit DNABII polynucleotide (HU or IHF) from binding to microbial DNA as well treat, prevent or inhibit biofilm formation and associated infections and disorders.
- HU or IHF DNABII polynucleotide
- the disclosure further provides the isolated or recombinant polynucleotide operatively linked to a promoter of RNA transcription, as well as other regulatory sequences for replication and/or transient or stable expression of the DNA or RNA.
- a promoter of RNA transcription as well as other regulatory sequences for replication and/or transient or stable expression of the DNA or RNA.
- the term “operatively linked” means positioned in such a manner that the promoter will direct transcription of RNA off the DNA molecule. Examples of such promoters are SP6, T4 and T7.
- cell-specific promoters are used for cell-specific expression of the inserted polynucleotide.
- Vectors which contain a promoter or a promoter/enhancer, with termination codons and selectable marker sequences, as well as a cloning site into which an inserted piece of DNA can be operatively linked to that promoter are known in the art and commercially available.
- Gene Expression Technology Goeddel ed., Academic Press, Inc. (1991)
- references cited therein Vectors: Essential Data Series (Gacesa and Ramji, eds., John Wiley & Sons, N.Y. (1994)) which contains maps, functional properties, commercial suppliers and a reference to GenEMBL accession numbers for various suitable vectors.
- polynucleotides derived from the polynucleotides disclosed herein encode polypeptides or proteins having diagnostic and therapeutic utilities as described herein as well as probes to identify transcripts of the protein that may or may not be present.
- These nucleic acid fragments can by prepared, for example, by restriction enzyme digestion of larger polynucleotides and then labeled with a detectable marker. Alternatively, random fragments can be generated using nick translation of the molecule. For methodology for the preparation and labeling of such fragments, see, Sambrook et al. (1989) supra.
- Expression vectors containing these nucleic acids are useful to obtain host vector systems to produce proteins and polypeptides. It is implied that these expression vectors must be replicable in the host organisms either as episomes or as an integral part of the chromosomal DNA.
- suitable expression vectors include plasmids, yeast vectors, viral vectors and liposomes.
- Adenoviral vectors are particularly useful for introducing genes into tissues in vivo because of their high levels of expression and efficient transformation of cells both in vitro and in vivo.
- a suitable host cell e.g., a prokaryotic or a eukaryotic cell and the host cell replicates
- the protein can be recombinantly produced.
- suitable host cells will depend on the vector and can include mammalian cells, animal cells, human cells, simian cells, insect cells, yeast cells, and bacterial cells constructed using known methods. See, Sambrook et al. (1989) supra.
- the nucleic acid can be inserted into the host cell by methods known in the art such as transformation for bacterial cells; transfection using calcium phosphate precipitation for mammalian cells; or DEAE-dextran; electroporation; or microinjection. See, Sambrook et al. (1989) supra, for methodology.
- a host cell e.g., a mammalian cell, an animal cell (rat or mouse), a human cell, or a prokaryotic cell such as a bacterial cell, containing a polynucleotide encoding a protein or polypeptide or antibody.
- a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide.
- the sequence of nucleotides can be interrupted by non-nucleotide components.
- a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component. The term also refers to both double- and single-stranded molecules.
- any embodiment disclosed herein that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
- a pharmaceutically acceptable vector such as a replication-incompetent retroviral or adenoviral vector, are exemplary (but non-limiting) and may be of particular use.
- Pharmaceutically acceptable vectors containing the nucleic acids disclosed herein can be further modified for transient or stable expression of the inserted polynucleotide.
- the term “pharmaceutically acceptable vector” includes, but is not limited to, a vector or delivery vehicle having the ability to selectively target and introduce the nucleic acid into dividing cells.
- a vector or delivery vehicle having the ability to selectively target and introduce the nucleic acid into dividing cells.
- An example of such a vector is a “replication-incompetent” vector defined by its inability to produce viral proteins, precluding spread of the vector in the infected host cell.
- An example of a replication-incompetent retroviral vector is LNL6 (Miller et al. (1989) BioTechniques 7:980-990). The methodology of using replication-incompetent retroviruses for retroviral-mediated gene transfer of gene markers has been established.
- This disclosure also provides genetically modified cells that contain and/or express the polynucleotides disclosed herein.
- the genetically modified cells can be produced by insertion of upstream regulatory sequences such as promoters or gene activators (see, U.S. Pat. No.5,733,761).
- the modified cells are eukaryotic cells or prokaryotic cells.
- the polynucleotides can be conjugated to a detectable marker, e.g., an enzymatic label or a radioisotope for detection of nucleic acid and/or expression of the gene in a cell.
- a detectable marker e.g., an enzymatic label or a radioisotope for detection of nucleic acid and/or expression of the gene in a cell.
- detectable markers include fluorescent, radioactive, enzymatic or other ligands, such as avidin/biotin, which are capable of giving a detectable signal.
- a fluorescent label or an enzyme tag such as urease, alkaline phosphatase or peroxidase, instead of radioactive or other environmentally undesirable reagents.
- calorimetric indicator substrates can be employed to provide a means visible to the human eye or spectrophotometrically, to identify specific hybridization with complementary nucleic acid- containing samples.
- this disclosure further provides a method for detecting a single- stranded polynucleotide or its complement, by contacting target single-stranded polynucleotide with a labeled, single-stranded polynucleotide (a probe) which is a portion of the polynucleotide disclosed herein under conditions permitting hybridization (optionally moderately stringent hybridization conditions) of complementary single-stranded polynucleotides, or optionally, under highly stringent hybridization conditions.
- Hybridized polynucleotide pairs are separated from un-hybridized, single-stranded polynucleotides.
- the hybridized polynucleotide pairs are detected using methods known to those of skill in the art and set forth, for example, in Sambrook et al. (1989) supra.
- the polynucleotide embodied in this disclosure can be obtained using chemical synthesis, recombinant cloning methods, PCR, or any combination thereof. Methods of chemical polynucleotide synthesis are known in the art and need not be described in detail herein.
- One of skill in the art can use the sequence data provided herein to obtain a desired polynucleotide by employing a DNA synthesizer or ordering from a commercial service.
- the polynucleotides disclosed herein can be isolated or replicated using PCR.
- the PCR technology is the subject matter of U.S. Pat. Nos. 4,683,195; 4,800,159; 4,754,065; and 4,683,202 and described in PCR: The Polymerase Chain Reaction (Mullis et al. eds., Birkhauser Press, Boston (199.4)) or MacPherson et al. (1991) and (1995) supra, and references cited therein.
- one of skill in the art can use the sequences provided herein and a commercial DNA synthesizer to replicate the DNA.
- this disclosure also provides a process for obtaining the polynucleotides disclosed herein by providing the linear sequence of the polynucleotide, nucleotides, appropriate primer molecules, chemicals such as enzymes and instructions for their replication and chemically replicating or linking the nucleotides in the proper orientation to obtain the polynucleotides.
- these polynucleotides are further isolated.
- one of skill in the art can insert the poly-nucleotide into a suitable replication vector and insert the vector into a suitable host cell (prokaryotic or eukaryotic) for replication and amplification.
- the DNA so amplified can be isolated from the cell by methods known to those of skill in the art.
- a process for obtaining polynucleotides by this method is further provided herein as well as the polynucleotides so obtained.
- RNA can be obtained by first inserting a DNA polynucleotide into a suitable host cell.
- the DNA can be delivered by any appropriate method, e.g., by the use of an appropriate gene delivery vehicle (e.g., liposome, plasmid or vector) or by electroporation.
- an appropriate gene delivery vehicle e.g., liposome, plasmid or vector
- electroporation e.g., liposome, plasmid or vector
- the RNA can then be isolated using methods known to those of skill in the art, for example, as set forth in Sambrook et al. (1989) supra.
- mRNA can be isolated using various lytic enzymes or chemical solutions according to the procedures set forth in Sambrook et al. (1989) supra, or extracted by nucleic- acid-binding resins following the accompanying instructions provided by manufactures.
- Polynucleotides exhibiting sequence complementarity or homology to a polynucleotide disclosed herein are useful as hybridization probes or as an equivalent of the specific polynucleotides identified herein. Since the full coding sequence of the transcript is known, any portion of this sequence or homologous sequences can be used in the methods disclosed herein.
- a “perfectly matched” probe is not needed for a specific hybridization. Minor changes in probe sequence achieved by substitution, deletion or insertion of a small number of bases do not affect the hybridization specificity. In general, as much as 20% base-pair mismatch (when optimally aligned) can be tolerated.
- a probe useful for detecting the aforementioned mRNA is at least about 80% identical to the homologous region. In some embodiments, the probe is 85% identical to the corresponding gene sequence after alignment of the homologous region; in some embodiments, it exhibits 90% identity.
- These probes can be used in radioassays (e.g., Southern and Northern blot analysis) to detect, prognose, diagnose or monitor various cells or tissues containing these cells.
- the probes also can be attached to a solid support or an array such as a chip for use in high throughput screening assays for the detection of expression of the gene corresponding a polynucleotide disclosed herein.
- this disclosure also provides a probe comprising or corresponding to a polynucleotide disclosed herein, or its equivalent, or its complement, or a fragment thereof, attached to a solid support for use in high throughput screens.
- the total size of fragment, as well as the size of the complementary stretches, will depend on the intended use or application of the particular nucleic acid segment. Smaller fragments will generally find use in hybridization embodiments, wherein the length of the complementary region may be varied, such as between at least 5 to 10 to about 100 nucleotides, or even full length according to the complementary sequences one wishes to detect.
- Nucleotide probes having complementary sequences over stretches greater than 5 to 10 nucleotides in length are generally well suited, so as to increase stability and selectivity of the hybrid, and thereby improving the specificity of particular hybrid molecules obtained.
- Such fragments may be readily prepared by, for example, directly synthesizing the fragment by chemical means, by application of nucleic acid reproduction technology, such as the PCR technology with two priming oligonucleotides as described in U.S. Pat.
- a probe is about 50-75 or more alternatively, 50-100, nucleotides in length.
- the polynucleotides of the present disclosure can serve as primers for the detection of genes or gene transcripts that are expressed in cells described herein.
- amplification means any method employing a primer-dependent polymerase capable of replicating a target sequence with reasonable fidelity. Amplification may be carried out by natural or recombinant DNA-polymerases such as T7 DNA polymerase, Klenow fragment of E. coli DNA polymerase, and reverse transcriptase.
- a primer is the same length as that identified for probes.
- One method to amplify polynucleotides is PCR and kits for PCR amplification are commercially available. After amplification, the resulting DNA fragments can be detected by any appropriate method known in the art, e.g., by agarose gel electrophoresis followed by visualization with ethidium bromide staining and ultraviolet illumination.
- Methods for administering an effective amount of a gene delivery vector or vehicle to a cell have been developed and are known to those skilled in the art and described herein.
- Methods for detecting gene expression in a cell include techniques such as in hybridization to DNA microarrays, in situ hybridization, PCR, RNase protection assays and Northern blot analysis. Such methods are useful to detect and quantify expression of the gene in a cell.
- expression of the encoded polypeptide can be detected by various methods.
- Such antibodies are useful for visualizing cells that express the polypeptide using techniques such as immunohistology, ELISA, and Western blotting. These techniques can be used to determine expression level of the expressed polynucleotide.
- Also provided are methods to produce the antibodies, fragments, CDRs, or polypeptides comprising, or alternatively consisting of, or yet further consisting of, culturing a host cell comprising a polynucleotide encoding the antibody, antigen binding fragment, polypeptide, or CDR under conditions for expression of the polynucleotide, and optionally isolating the antibody, fragment, CDR and/or polypeptide from the cell and/or culture.
- a host cell comprising a polynucleotide encoding the antibody, antigen binding fragment, polypeptide, or CDR under conditions for expression of the polynucleotide.
- the host cell is a eukaryotic cell or a prokaryotic cell.
- the host cell is a mammalian cell.
- compositions are further provided.
- the compositions comprise a carrier and one or more of an isolated polypeptide disclosed herein, an isolated polynucleotide disclosed herein, a vector disclosed herein, an isolated host cell disclosed herein, a small molecule or an antibody, and/or an antigen binding fragment disclosed herein.
- the carriers can be one or more of a solid support or a pharmaceutically acceptable carrier.
- the compositions can further comprise an adjuvant or other components suitable for administrations as vaccines.
- the compositions are formulated with one or more pharmaceutically acceptable excipients, diluents, carriers and/or adjuvants.
- compositions of the present disclosure include one or more of an isolated polypeptide disclosed herein, an isolated polynucleotide disclosed herein, a vector disclosed herein, a small molecule, an isolated host cell disclosed herein, or an antibody of the disclosure, formulated with one or more pharmaceutically acceptable substances.
- any one or more of an isolated or recombinant polypeptide as described herein, an isolated or recombinant polynucleotide as described herein, a vector as described herein, an isolated host cell as described herein, a small molecule or an antibody or fragment thereof as described herein can be used alone or in pharmaceutical formulations disclosed herein comprising, or consisting essentially of, the compound in combination with appropriate additives to make tablets, powders, granules or capsules, for example, with conventional additives, such as lactose, mannitol, corn starch or potato starch; with binders, such as crystalline cellulose, cellulose derivatives, acacia, corn starch or gelatins; with disintegrators, such as corn starch, potato starch or sodium carboxymethylcellulose; with lubricants, such as talc or magnesium stearate; and if desired, with diluents, buffering agents, moistening agents, preservatives and flavoring
- compositions can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or com starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
- a binder such as microcrystalline cellulose, gum tragacanth or gelatin
- an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or com starch
- a lubricant such as magnesium stearate or Sterotes
- a glidant such as colloidal silicon dioxide
- a sweetening agent such as sucrose or saccharin
- compositions and unit dose forms suitable for oral administration are particularly useful in the treatment of chronic conditions, infections, and therapies in which the patient self-administers the drug.
- the formulation is specific for pediatric administration.
- the disclosure provides pharmaceutical formulations in which the one or more of an isolated polypeptide disclosed herein, an isolated polynucleotide disclosed herein, a vector disclosed herein, an isolated host cell disclosed herein, or an antibody disclosed herein can be formulated into preparations for injection in accordance with the disclosure by dissolving, suspending or emulsifying them in an aqueous or nonaqueous solvent, such as vegetable or other similar oils, synthetic aliphatic acid glycerides, esters of higher aliphatic acids or propylene glycol; and if desired, with conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifying agents, stabilizers and preservatives or other antimicrobial agents.
- an aqueous or nonaqueous solvent such as vegetable or other similar oils, synthetic aliphatic acid glycerides, esters of higher aliphatic acids or propylene glycol
- solubilizers isotonic agents
- suspending agents emulsifying agents
- a non-limiting example of such is a antimicrobial agent such as other vaccine components such as surface antigens, e.g., an OMP P5, OMP 26, OMP P2, or Type IV Pilin protein (see Jurcisek and Bakaletz (2007) J. of Bacteriology 189(10) :3868-3875 and Murphy, T F, Bakaletz, L O and Smeesters, P R (2009) The Pediatric Infectious Disease Journal, 28 : S 121 -S 126) and antibacterial agents.
- suitable carriers include physiological bacteriostatic water, Cremophor ELTM (BASF, Parsippany, N.J.), or phosphate buffered saline (PBS).
- a composition for parenteral administration must be sterile and should be fluid to the extent that easy syringability exists.
- Aerosol formulations provided by the disclosure can be administered via inhalation and can be propellant or non-propellant based.
- embodiments of the pharmaceutical formulations disclosed herein comprise a compound disclosed herein formulated into pressurized acceptable propellants such as dichlorodifluoromethane, propane, nitrogen and the like.
- the compounds can be delivered in the form of an aerosol spray from a pressurized container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
- a non-limiting example of a non-propellant is a pump spray that is ejected from a closed container by means of mechanical force (i.e., pushing down a piston with one's finger or by compression of the container, such as by a compressive force applied to the container wall or an elastic force exerted by the wall itself, e.g., by an elastic bladder).
- Suppositories disclosed herein can be prepared by mixing a compound disclosed herein with any of a variety of bases such as emulsifying bases or water-soluble bases. Embodiments of this pharmaceutical formulation of a compound disclosed herein can be administered rectally via a suppository.
- the suppository can include vehicles such as cocoa butter, carbowaxes and polyethylene glycols, which melt at body temperature, yet are solidified at room temperature.
- Unit dosage forms for oral or rectal administration such as syrups, elixirs, and suspensions, may be provided wherein each dosage unit, for example, teaspoonful, tablespoonful, tablet or suppository, contains a predetermined amount of the composition containing one or more compounds disclosed herein.
- unit dosage forms for injection or intravenous administration may comprise a compound disclosed herein in a composition as a solution in sterile water, normal saline or another pharmaceutically acceptable carrier.
- Embodiments of the pharmaceutical formulations disclosed herein include those in which one or more of an isolated polypeptide disclosed herein, an isolated polynucleotide disclosed herein, a vector disclosed herein, a small molecule for use in the disclosure, an isolated host cell disclosed herein, or an antibody or fragment thereof as disclosed herein is formulated in an injectable composition.
- injectable pharmaceutical formulations disclosed herein are prepared as liquid solutions or suspensions; or as solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection. The preparation may also be emulsified or the active ingredient encapsulated in liposome vehicles in accordance with other embodiments of the pharmaceutical formulations disclosed herein.
- one or more of an isolated polypeptide disclosed herein, an isolated polynucleotide disclosed herein, a vector disclosed herein, an isolated host cell disclosed herein, or an antibody disclosed herein is formulated for delivery by a continuous delivery system.
- continuous delivery system is used interchangeably herein with “controlled delivery system” and encompasses continuous (e.g., controlled) delivery devices (e.g., pumps) in combination with catheters, injection devices, and the like, a wide variety of which are known in the art.
- Mechanical or electromechanical infusion pumps can also be suitable for use with the present disclosure.
- Examples of such devices include those described in, for example, U.S. Pat. Nos. 4,692,147; 4,360,019; 4,487,603; 4,360,019; 4,725,852; 5,820,589; 5,643,207;
- a compound disclosed herein can be accomplished using any of a variety of refillable, pump systems. Pumps provide consistent, controlled release over time.
- a compound disclosed herein is in a liquid formulation in a drug-impermeable reservoir, and is delivered in a continuous fashion to the individual.
- the drug delivery system is an at least partially implantable device.
- the implantable device can be implanted at any suitable implantation site using methods and devices well known in the art.
- An implantation site is a site within the body of a subject at which a drug delivery device is introduced and positioned.
- Implantation sites include, but are not necessarily limited to, a subdermal, subcutaneous, intramuscular, or other suitable site within a subject's body. Subcutaneous implantation sites are used in some embodiments because of convenience in implantation and removal of the drug delivery device.
- Drug release devices suitable for use in the disclosure may be based on any of a variety of modes of operation, polymers such as for example poly(glycolide-co-lactide) (PGLA) that is commercially available from a number of vendors, e.g., BioDegmer and Sigma- Aldrich.
- PGLA poly(glycolide-co-lactide)
- the drug release device can be based upon a diffusive system, a convective system, or an erodible system (e.g., an erosion-based system).
- the drug release device can be an electrochemical pump, osmotic pump, an electroosmotic pump, a vapor pressure pump, or osmotic bursting matrix, e.g., where the drug is incorporated into a polymer (e.g., PGLA) and the polymer provides for release of drug formulation concomitant with degradation of a drug-impregnated polymeric material (e.g., a biodegradable, drug- impregnated polymeric material).
- the drug release device is based upon an electrodiffusion system, an electrolytic pump, an effervescent pump, a piezoelectric pump, a hydrolytic system, etc.
- Drug release devices based upon a mechanical or electromechanical infusion pump can also be suitable for use with the present disclosure. Examples of such devices include those described in, for example, U.S. Pat. Nos.4,692,147; 4,360,019; 4,487,603; 4,360,019; 4,725,852; and the like.
- a subject treatment method can be accomplished using any of a variety of refillable, non-exchangeable pump systems. Pumps and other convective systems may be utilized due to their generally more consistent, controlled release over time. Osmotic pumps are used in some embodiments due to their combined advantages of more consistent controlled release and relatively small size (see, e.g., PCT International Application Publication No. WO 97/27840 and U.S.
- osmotically-driven devices suitable for use in the disclosure include, but are not necessarily limited to, those described in U.S. Pat. Nos.3,760,984; 3,845,770; 3,916,899; 3,923,426; 3,987,790; 3,995,631; 3,916,899; 4,016,880; 4,036,228; 4,111,202; 4,111,203; 4,203,440; 4,203,442; 4,210,139; 4,327,725; 4,627,850; 4,865,845; 5,057,318; 5,059,423; 5,112,614; 5,137,727; 5,234,692; 5,234,693; 5,728,396; and the like.
- a further exemplary device that can be adapted for the present disclosure is the Synchromed infusion pump (Medtronic).
- the drug delivery device is an implantable device.
- the drug delivery device can be implanted at any suitable implantation site using methods and devices well known in the art.
- an implantation site is a site within the body of a subject at which a drug delivery device is introduced and positioned. Implantation sites include, but are not necessarily limited to a subdermal, subcutaneous, intramuscular, or other suitable site within a subject's body.
- Suitable excipient vehicles for a compound disclosed herein are, for example, water, saline, dextrose, glycerol, ethanol, or the like, and combinations thereof.
- compositions of the present disclosure include those that comprise a sustained-release or controlled release matrix.
- embodiments of the present disclosure can be used in conjunction with other treatments that use sustained-release formulations.
- a sustained-release matrix is a matrix made of materials, usually polymers, which are degradable by enzymatic or acid-based hydrolysis or by dissolution. Once inserted into the body, the matrix is acted upon by enzymes and body fluids.
- a sustained-release matrix desirably is chosen from biocompatible materials such as liposomes, polylactides (polylactic acid), polyglycolide (polymer of glycolic acid), polylactide co-glycolide (copolymers of lactic acid and glycolic acid), polyanhydrides, poly(ortho)esters, polypeptides, hyaluronic acid, collagen, chondroitin sulfate, carboxcylic acids, fatty acids, phospholipids, polysaccharides, nucleic acids, polyamino acids, amino acids such as phenylatanine, tyrosine, isoleucine, polynucleotides, polyvinyl propylene, polyvinylpyrrolidone and silicone.
- biocompatible materials such as liposomes, polylactides (polylactic acid), polyglycolide (polymer of glycolic acid), polylactide co-glycolide (copolymers of lactic acid and glycolic acid),
- Illustrative biodegradable matrices include a polylactide matrix, a polyglycolide matrix, and a polylactide co-glycolide (co-polymers of lactic acid and glycolic acid) matrix.
- the polypeptide, antibody or fragment thereof is delivered in a controlled release system.
- a compound disclosed herein may be administered using intravenous infusion, an implantable osmotic pump, a transdermal patch, liposomes, or other modes of administration.
- a pump may be used (Sefton (1987) CRC Crit. Ref. Biomed. Eng.14:201; Buchwald et al.
- a controlled release system is placed in proximity of the therapeutic target, i.e., the liver, thus requiring only a fraction of the systemic dose.
- a controlled release system is placed in proximity of the therapeutic target, thus requiring only a fraction of the systemic.
- Other controlled release systems are discussed in the review by Langer (1990) Science 249:1527-1533.
- compositions of the present disclosure include those formed by impregnation of an inhibiting agent described herein into absorptive materials, such as sutures, bandages, and gauze, or coated onto the surface of solid phase materials, such as surgical staples, zippers and catheters to deliver the compositions.
- absorptive materials such as sutures, bandages, and gauze
- solid phase materials such as surgical staples, zippers and catheters to deliver the compositions.
- Other delivery systems of this type will be readily apparent to those skilled in the art in view of the instant disclosure.
- the present disclosure provides methods and compositions for the administration of a one or more of an interfering agent to a host (e.g., a human) for the treatment of a microbial infection.
- these methods disclosed herein span almost any available method and route suitable for drug delivery, including in vivo and ex vivo methods, as well as systemic and localized routes of administration.
- Formulations and Co-formulations [0542] The disclosure provided herein contemplates specific formulations and co- formulations of the agents disclosed herein along with a pharmaceutically acceptable excipient, such as those disclosed herein above. [0543] In specific aspects, the disclosure provides for formulations or co-formulations comprising antibodies or antigen binding fragments thereof that specifically recognize or bind an isolated or recombinant polypeptides. Antibodies disclosed herein may be selected such that they have a high level of epitope binding specificity and high binding affinity to the biofilm.
- the antibodies of the present technology useful in the disclosed methods usually have binding affinities of at least 10 -6 , 10 -7 , 10 -8 , 10 -9 , 10 -10 , 10- 11 , or 10 -12 M.
- the antibodies have a sufficient kinetic on-rate to reach equilibrium under standard conditions in at least 12 hours, at least 5 hours, at least 1 hour, or at least 30 minutes.
- the affinity of the antibody or antigen binding fragment is less than or about 1000 picoMole (pM), 900 pM, 800 pM, 700 pM, 600 pM, 500 pM, 400 pM, 300 pM, 200 pM, about 100 pM, 50 pM, 40 pM, 30 pM, 20 pM, 10 pM, 9 pM, 8 pM, 7 pM, 6 pM, 5 pM, or 4 pM.
- pM picoMole
- the antibodies or antigen binding fragments thereof are present in the formulation at a concentration from about 0.1 mg/mL to about 200 mg/mL, or alternatively from about 1 to about 150 mg/mL, or alternatively about 2 mg/mL to about 100 mg/mL, or alternatively about 3 mg/mL to about 80 mg/mL, or alternatively about 4 mg/mL to about 50 mg/mL, or alternatively about 5 mg/mL to about 20 mg/mL.
- the antibodies are present at a concentration of at least about 1 mg/mL, or alternatively at least about 2 mg/mL, at least about 3 mg/mL, or alternatively at least about 4 mg/mL, or alternatively at least about 5 mg/mL, or alternatively at least about 6 mg/mL, or alternatively at least about 7 mg/mL, or alternatively at least about 8 mg/mL, or alternatively at least about 9 mg/mL, or alternatively at least about 10 mg/mL, or alternatively at least about 15 mg/mL, or alternatively at least about 20 mg/mL, or alternatively at least about 30 mg/mL, or alternatively at least about 40 mg/mL, or alternatively at least about 50 mg/mL, or alternatively at least about 60 mg/mL, or alternatively at least about 70 mg/mL, or alternatively at least about 80 mg/mL, or alternatively at least about 90 mg/mL, or alternatively at least about 100 mg/mL, or alternatively at least about 120
- At least one of the plurality of antibodies is present at a concentration of at least about 1 mg/mL, or alternatively at least about 2 mg/mL, or alternatively at least about 3 mg/mL, or alternatively at least about 4 mg/mL, or alternatively at least about 5 mg/mL, or alternatively at least about 6 mg/mL, or alternatively at least about 7 mg/mL, or alternatively at least about 8 mg/mL, or alternatively at least about 9 mg/mL, or alternatively at least about 10 mg/mL, or alternatively at least about 15 mg/mL, or alternatively at least about 20 mg/mL, or alternatively at least about 30 mg/mL, or alternatively at least about 40 mg/mL, or alternatively at least about 50 mg/mL, or alternatively at least about 60 mg/mL, or alternatively at least about 70 mg/mL, or alternatively at least about 80 mg/mL, or alternatively at least about 90 mg/mL, or alternatively at least about 100 mg/
- the different antibodies may be present in substantially equal concentrations.
- the different antibodies one or more of the antibodies may be present in a substantially higher concentration than the other antibodies, e.g., ratios of about 1.5:1, or alternatively about 1.5:1:1, or alternatively about 1.5:1:1:1, or alternatively about 2:1, or alternatively about 2:1:1, or alternatively about 2:1:1:1, or alternatively at least about 2.5:1, or alternatively at least about 2.5:1:1, or alternatively at least about 2.5:1:1:1.
- the co-formulation comprises, or alternatively consists essentially of, or yet further comprises an antibody that specifically recognizes or binds an isolated or recombinant polypeptide consisting essentially of a two or more of A5 a fragment or equivalent thereof (e.g., in duplicate or in combination with another such as mB4) or two or more of mB4 polypeptide, a fragment or equivalent thereof or mB4 in combination with A5, a fragment or an equivalent of each thereof.
- one or more antibodies in the formulation is not a polyclonal antibody. In some embodiments, this formulation is used as a therapeutic.
- the co-formulation comprises, or alternatively consists essentially of, or yet further comprises an antibody that specifically recognizes or binds an isolated or recombinant polypeptide consisting essentially of two or more of A1 to A4 or A6 or B1 to B6, or a fragment or equivalent thereof.
- one or more antibodies in the formulation is not a polyclonal antibody. In some embodiments, this formulation is used as a diagnostic.
- Methods of stably formulating antibody formulations and co-formulations can be made according to techniques disclosed in the art – see, e.g., U.S. Pat. Publication No. US 2011/0059079.
- an “agent” is intended to include, but not be limited to a biological or chemical compound such as a simple or complex organic or inorganic molecule (referred to herein as a small molecule, such as a nucleic acid), a peptide, a protein (e.g., antibody), a polynucleotide anti-sense) or a ribozyme.
- a vast array of compounds can be synthesized, for example polymers, such as polypeptides and polynucleotides, and synthetic organic compounds based on various core structures, and these are also included in the term “agent.”
- various natural sources can provide compounds for screening, such as plant or animal extracts, and the like. It should be understood, although not always explicitly stated that the agent is used alone or in combination with another agent, having the same or different biological activity as the agents identified by the inventive screen.
- the potential inhibitory or binding effect (i.e., interaction or association) of an agent such as a small molecule compound may be analyzed prior to its actual synthesis and testing by the use of computer modeling techniques.
- the agent can then be synthesized and tested for its ability to bind to or inhibit the interaction using various methods such as in vitro or in vivo experiments. Methods of testing an agent's ability to inhibit or titrate a biofilm, alone or in connection with another agent, are disclosed herein. In this manner, synthesis of inoperative agents and compounds can be avoided.
- One skilled in the art may use any of several methods to screen chemical or biological entities or fragments for their ability to associate with DNABII or microbial DNA and more particularly with the specific binding sites. Selected fragments or chemical entities may then be positioned in a variety of orientations, or docked, within an individual binding site of DNA or DNABII polypeptide. Docking may be accomplished using software such as QUANTA, SYBYL, followed by energy minimization and molecular dynamics with standard molecular mechanical force fields, such as CHARMM and AMBER. [0553] Commercial computer programs are also available for in silico design.
- a compound designed or selected can be further computationally optimized so that in its bound state it may optionally lack repulsive electrostatic interaction with the target protein.
- Such non-complementary (e.g., electrostatic) interactions include repulsive charge- charge, dipole-dipole, and charge-dipole interactions.
- electrostatic interactions include repulsive charge- charge, dipole-dipole, and charge-dipole interactions.
- Computer softwares are also available in the art to evaluate compound deformation energy and electrostatic interaction.
- substitutions may then be made in some of its atoms or side groups in order to improve or modify its binding properties.
- initial substitutions are conservative, i.e., the replacement group will have approximately the same size, shape, hydrophobicity and charge as the original group. It should, of course, be understood that components known in the art to alter conformation should be avoided.
- small molecules are molecules having low molecular weights (MW) that are, in one embodiment, capable of binding to a protein of interest thereby altering the function of the protein. In some embodiments, the MW of a small molecule is no more than 1,000. Methods for screening small molecules capable of altering protein function are known in the art.
- a miniaturized arrayed assay for detecting small molecule-protein interactions in cells is discussed by You et al. (1997) Chem. Biol.4:961-968.
- suitable cell culture or tissue infected with the microbial to be treated are first provided.
- the cells are cultured under conditions (temperature, growth or culture medium and gas (CO 2 )) and for an appropriate amount of time to attain exponential proliferation without density dependent constraints. It also is desirable to maintain an additional separate cell culture that is not infected as a control.
- suitable cells can be cultured in micro-titer plates and several agents can be assayed at the same time by noting genotypic changes, phenotypic changes or a reduction in microbial titer.
- the agent is a composition other than a DNA or RNA, such as a small molecule as described above, the agent can be directly added to the cell culture or added to culture medium for addition.
- an “effective” a mount must be added which can be empirically determined.
- the agent is an antibody or antigen binding fragment
- the agent can be contacted or incubated with the target antigen and polyclonal antibody as described herein under conditions to perform a competitive ELISA. Such methods are known to the skilled artisan.
- the assays also can be performed in a subject. When the subject is an animal such as a rat, chinchilla, mouse or simian, the method provides a convenient animal model system that can be used prior to clinical testing of an agent in a human patient.
- a candidate agent is a potential drug if symptoms of the disease or microbial infection is reduced or eliminated, each as compared to untreated, animal having the same infection. It also can be useful to have a separate negative control group of cells or animals that are healthy and not treated, which provides a basis for comparison.
- the agents and compositions can be used in the manufacture of medicaments and for the treatment of humans and other animals by administration in accordance with conventional procedures, such as an active ingredient in pharmaceutical compositions.
- Combination Therapies [0565] The compositions and related methods of the present disclosure may be used in combination with the administration of other therapies.
- the methods and compositions include a deoxyribonuclease (DNase) enzyme that acts synergistically with the anti-DNABII antibody.
- DNase is any enzyme that catalyzes the cleavage of phosphodiester linkages in the DNA backbone.
- DNase enzymes that are known to target not only cruciform structures, but also a variety of secondary structure of DNA include DNAse I, T4 EndoVII, T7 Endo I, RuvABC, and RusA.
- the effective amount of anti- DNABII antibody needed to destabilize the biofilm is reduced when combined with a DNase.
- the DNase can be added directly to the assay or in a suitable buffer known to stabilize the enzyme.
- the effective Unit dose of DNase and the assay conditions may vary, and can be optimized according to procedures known in the art.
- the methods and compositions can be combined with antibiotics and/or antimicrobials.
- Antimicrobials are substances that kill or inhibit the growth of microorganisms such as bacteria, fungi, or protozoans.
- biofilms are generally resistant to the actions of antibiotics
- compositions and methods described herein can be used to sensitize the infection involving a biofilm to traditional therapeutic methods for treating infections.
- the use of antibiotics or antimicrobials in combination with methods and compositions described herein allow for the reduction of the effective amount of the antimicrobial and/or biofilm reducing agent.
- Some non-limiting examples of antimicrobials and antibiotics useful in combination with methods of the current disclosure include amoxicillin, amoxicillin-clavulanate, cefdinir, azithromycin, and sulfamethoxazole- trimethoprim.
- the therapeutically effective dose of the antimicrobial and/or antibiotic in combination with the biofilm reducing agent can be readily determined by traditional methods.
- the dose of the antimicrobial agent in combination with the biofilm reducing agent is the average effective dose which has been shown to be effective in other bacterial infections, for example, bacterial infections wherein the etiology of the infection does not include a biofilm.
- the dose is 0.1, 0.15, 0.2, 0.25, 0.30, 0.35, 0.40, 0.45, 0.50, 0.55, 0.60, 0.65, 0.70, 0.75, 0.8, 0.85, 0.9, 0.95, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.5, 3.0 or 5 times the average effective dose.
- the antibiotic or antimicrobial can be added prior to, concurrent with, or subsequent to the addition of the anti- DNABII antibody.
- the methods and compositions can be combined with antibodies that treat the bacterial infection.
- an antibody useful in combination with the methods and compositions described herein is an antibody directed against an unrelated outer membrane protein (i.e., OMP P5). Treatment with this antibody alone does not debulk a biofilm in vitro. Combined therapy with this antibody and a biofilm reducing agent results in a greater effect than that which could be achieved by either reagent used alone at the same concentration.
- Other antibodies that may produce a synergistic effect when combined with a biofilm reducing agent or methods to reduce a biofilm include anti- rsPilA anti-OMP26, anti-OMP P2, and anti-whole OMP preparations.
- compositions and methods described herein can be used to sensitize the bacterial infection involving a biofilm to common therapeutic modalities effective in treating bacterial infections without a biofilm but are otherwise ineffective in treating bacterial infections involving a biofilm.
- the compositions and methods described herein can be used in combination with therapeutic modalities that are effective in treating bacterial infections involving a biofilm, but the combination of such additional therapy and biofilm reducing agent or method produces a synergistic effect such that the effective dose of either the biofilm reducing agent or the additional therapeutic agent can be reduced.
- the combination of such additional therapy and biofilm reducing agent or method produces a synergistic effect such that the treatment is enhanced.
- An enhancement of treatment can be evidenced by a shorter amount of time required to treat the infection.
- kits containing the agents and instructions necessary to perform the in vitro and in vivo methods as described herein also are claimed.
- kits for performing these methods may include an antibody, antibody fragment, polypeptide, polynucleotide, vector or host cell, as well as instructions for carrying out the methods disclosed herein such as collecting a sample and/or performing the screen, and/or analyzing the results, and/or administration of an effective amount of an antibody, antibody fragment, polypeptide, polynucleotide, vector or host cell, as defined herein.
- kits can comprise, or alternatively consist essentially of, or yet further consist of any one or more of agents identified above, e.g., antibody, antibody fragment, polypeptide, polynucleotide, vector or host cell, and instructions for use.
- the kit can further comprise one or more of an adjuvant, an antigenic peptide or an antimicrobial.
- carriers include a liquid carrier, a pharmaceutically acceptable carrier, a solid phase carrier, a pharmaceutically acceptable carrier, a pharmaceutically acceptable polymer, a liposome, a micelle, an implant, a stent, a paste, a gel, a dental implant, or a medical implant.
- kits for performing these methods which may include an agent disclosed herein as well as instructions for carrying out the methods disclosed herein such as collecting a sample and/or performing the screen, and/or analyzing the results, and/or administration of an effective amount of an agent as defined herein.
- agents disclosed herein such as collecting a sample and/or performing the screen, and/or analyzing the results, and/or administration of an effective amount of an agent as defined herein.
- kits for carrying out the methods disclosed herein such as collecting a sample and/or performing the screen, and/or analyzing the results, and/or administration of an effective amount of an agent as defined herein.
- agents can be used alone or in combination with other suitable antimicrobial agents.
- a kit can comprise, or alternatively consist essentially of, or yet further consist of any one or more agent identified above, e.g., an agent of the group of an isolated or recombinant polypeptide or a fragment or an equivalent of each thereof; an isolated or recombinant polynucleotide encoding any one
- the kit can further comprising one or more of an adjuvant, an antigenic peptide or an antimicrobial.
- carriers include a liquid carrier, a pharmaceutically acceptable carrier, a solid phase carrier, a pharmaceutically acceptable carrier, a pharmaceutically acceptable polymer, a liposome, a micelle, an implant, a stent, a paste, a gel, a dental implant, or a medical implant.
- a common characteristic of these released bacteria is sensitivity to antibiotic killing greater than that shown by even planktonically grown bacteria (Brockson et al., 2014; Chambers et al., 2017; Goodwine et al., 2019; Mokrzan et al., 2018).
- P. aeruginosa released from a biofilm by exposure to either glutamate or nitric oxide showed variable sensitivity to tobramycin and/or colistin compared to each other, both populations were more sensitive to antibiotic killing than their planktonic counterparts (Chambers et al., 2017; Petrova and Sauer, 2016). Applicant showed that NTHI and M.
- catarrhalis released from a dual species biofilm by anti-rsPilA antibodies are significantly more sensitive to killing by either trimethoprim plus sulfamethoxazole or clarithromycin, respectively, than their agar-grown counterparts (Mokrzan et al., 2018).
- NTHI biofilms exposured to anti-DNABII antibodies in combination with antibiotics significantly augments killing of the newly released NTHI by all three first-line antibiotics used to treat OM (e.g. ampicillin, amoxicillin- clavulanate, cefdinir) in vitro (Brockson et al., 2014).
- Applicant’s in vivo studies demonstrate that treatment with anti-DNABII antibodies in combination with the aminoglycoside antibiotic tobramycin confers an added benefit to the eradication of P. aeruginosa from the murine lung compared to treatment with antibodies or antibiotic alone (Novotny et al., 2016).
- Applicant used NTHI as a model organism to further characterize the phenotype of newly released bacteria, hereafter referred to as ‘NRel’.
- NTHI released from biofilm residence after incubation with rabbit polyclonal IgG isolated from either anti-rsPilA or anti-IHF serum Sterile culture medium or an equivalent concentration of polyclonal IgG recovered from either naive serum or from antiserum against the NTHI adhesin outer membrane protein P5 (OMP P5), none of which disperse established NTHI biofilms (Mokrzan et al., 2018; Novotny et al., 2015), served as negative controls.
- DEPs specific to anti-rsPilA NRel with >1.5-fold increase included tryptophan biosynthesis and cysteine metabolism enzymes.
- ‘translation, ribosomal structure & biogenesis’ was the most frequently represented COG category (13.6%) among the 103 DEPs, compared to planktonic NTHI (FIGURE 3c, anti-IHF bars & Table 1).
- each of the cell envelope biogenesis, coenzyme metabolism, and lipid metabolism COG category proteins were >1.5- fold decreased compared to planktonic NTHI, for example, Lic2A, LicC, and LicD, proteins responsible for modification of lipooligosaccharide (LOS) and decoration with a phosphorylcholine moiety (Poole et al., 2013; Swords et al., 2003), and the lipoprotein carrier protein LolA, which shuttles lipoproteins from the inner membrane to the outer membrane (Kaplan et al., 2018).
- planktonic NTHI for example, Lic2A, LicC, and LicD, proteins responsible for modification of lipooligosaccharide (LOS) and decoration with a phosphorylcholine moiety (Poole et al., 2013; Swords et al., 2003), and the lipoprotein carrier protein LolA, which shuttles lipoproteins from the inner membrane to the outer membrane (Kaplan
- anti-IHF NRel contained abundant ribosomes for translation of proteins, however translation was limited due to the reduced translation initiation factor proteins. Further, anti-IHF NRel demonstrated decreased expression of LOS-modifying enzymes and lipid metabolism genes, with a concurrent increase in expression of outer membrane integrity maintenance proteins, which suggested differences in membrane composition of anti-IHF NRel compared to planktonically grown NTHI. [0595] The increased abundance of ribosomal proteins observed in the anti-IHF NRel proteomic profile is also characteristic of bacteria in lag phase of growth (Rolfe et al., 2012).
- Anti-rsPilA or anti-IHF NRel were significantly more sensitive to killing by a specific antibiotic than planktonic NTHI [0598] With the observed significant differences in relative expression of distinct proteins between the two NRel populations demonstrated, Applicant next examined how these differences altered phenotypic character.
- Applicant compared the anti-rsPilA NRel and anti-IHF NRel susceptibilities to killing by TMP-SMX or AMC, to that of both biofilm- resident NTHI (canonically highly resistant) and to planktonic NTHI grown to mid-log phase of growth (canonically sensitive and representative of the population commonly used to determine MIC values in clinical microbiology laboratories) (FIGURE 5a).
- anti-rsPilA NRel were significantly more sensitive than biofilm-resident NTHI to killing by either TMP-SMX or AMC (P ⁇ 0.0001) (FIGURES 5b&5c) Notably however, sensitivity of anti-rsPilA NRel to killing by TMP-SMX was significantly greater compared to that for planktonic NTHI (P ⁇ 0.001) after only 2 h of antibiotic exposure (FIGURE 5b) In contrast, anti-rsPilA NRel were only equally as sensitive as their planktonic counterparts to killing by the P-lactam antibiotic AMC (FIGURE 5c).
- Bacterial sensitivity to antibiotic killing is the result of multiple processes that include drug uptake, efflux, and degradation, as well as the direct mechanism of antibiotic action (Kapoor et al., 2017).
- Applicant used qRT-PCR to examine the relative expression of several genes likely to play a role in susceptibility or resistance to TMP-SMX or AMC.
- the protein targets of TMP and SMX, dihydrofolate reductase and dihydropteroate synthetase, are encoded by folA and folP, respectively; overproduction of FolA and FolP is associated with resistance to TMP-SMX (Huovinen, 2001). Accordingly, Applicant speculated that anti-rsPilA NRel NTHI would likely demonstrate less relative expression of folA and/or folP than anti-IHF NRels at the selected time points. Applicant’s results confirmed this hypothesis, as folA and folP expression were both significantly reduced in anti-rsPilA V5. anti-IHF NRel (FIGURE 4b, PO.OOOl).
- Efflux pumps enable bacteria to decrease the concentration of intracellular antibiotic.
- the EmrE efflux system transports P-lactam antibiotics in Neisseria gonorrhoeae (Du et al., 2018), and in E. coli, TMP-SMX exposure stimulates expression of the EmrAB efflux pump (Barrero et al., 2014), which suggested that the EmrAB efflux pump could influence NRel sensitivity to TMP-SMX.
- Applicant found that relative expression of emrA and emrB by anti- rsPilA NRel was significantly less that by anti-IHF NRel, consistent with the greater sensitivity of anti-rsPilA NRel to TMP-SMX (FIGURE 4c, P ⁇ 0.001).
- the ArcAB efflux pump can transport ⁇ -lactam antibiotics and is under the control of the transcriptional repressor acrR (Anes et al., 2015).
- anti-rsPilA NRel were significantly more susceptible to killing by TMP-SMX (P ⁇ 0.0001) (FIGURE 6a), and equally susceptible to killing by AMC, as planktonic NTHI (FIGURE 6b).
- time-matched anti-IHF NRel were significantly more susceptible to killing by AMC (P ⁇ 0.0001) (FIGURE 6c), and equally susceptible to killing by TMP-SMX (FIGURE 6d), compared to planktonic NTHI.
- Such persistent and recurrent infections are attributable to causative agents that form biofilms wherein the resident bacteria have a unique transcriptome and a highly recalcitrant phenotype that renders them resistant to antibiotics and host immune effectors that readily kill their planktonic counterparts (Ahearn et al., 2017; Hall and Mah, 2017; Pang et al., 2012; Sharma et al., 2019; Silva and Sillankorva, 2019; Stewart, 2002).
- the advances in the recognition and understanding of the NRel phenotype now provide us with the opportunity to merge aspects of these development pathways to consider the use of therapeutic antibodies to release bacteria from the recalcitrant biofilm-residence into a state that is now markedly more vulnerable to killing.
- catarrhalis are more susceptible to TMP-SMX or clarithromycin, respectively, when released from a dual-species biofilm by incubation with anti-rsPilA, than those from growth on agar (Mokrzan et al., 2018).
- Applicant aimed to begin to understand the relative phenotypes of the two NRel populations as induced by the specifically targeted anti-rsPilA and anti-IHF sera, which release NTHI from biofilm residence by discrete mechanisms as this could have a notable influence on relative clinical approach to best mediate eradication of the resultant NRel population.
- the anti-rsPilA NRel population proteomic profile was defined by an adaptive state of energy metabolism & conversion and amino acid transport & metabolism in response to their being induced to actively disperse from the biofilm.
- This adaptive metabolic state is likely somewhat more heterogenous than anti-IHF NRel NTHI due to the more gradual release of cells as they actively disperse from the biofilm due to expression of both AI-2 and the Type IV twitching pilus over the 6 h incubation period. Nonetheless, the adaptive metabolic state of this anti- rsPilA NRel population was very similar to that described for other genera (e.g. S. pneumoniae, K. pneumoniae, and P.
- anti-IHF NRel might be expected to still largely resemble biofilm-resident NTHI bacteria. Indeed, targeted transcriptomics indicated that anti-IHF NRel were in a state of growth similar to lag phase. Nonetheless, the anti-IHF NRel phenotype was also clearly different from that of biofilm-resident NTHI, as revealed by their significantly greater killing by both sulfonamide and ⁇ -lactam antibiotics compared to biofilm-resident NTHI. [0609] As expected from Applicant’s previous work (Brockson et al., 2014; Mokrzan et al., 2018), NRel NTHI were highly sensitive to two first-line antibiotics prescribed to treat NTHI-induced diseases.
- the two resultant NRel populations showed significant differences in relative proteomic expression profiles, targeted transcriptomic profiles, character of release from biofilm residence (both growth phase and as single cells vs. aggregates), and antibiotic sensitivities.
- the anti-rsPilA NRel adaptive amino acid transport & metabolism state provided insight into the mechanism of this population’s uniquely increased susceptibility to TMP- SMX, because the sulfonamide class of antibiotic targets the folic acid synthesis pathway involved in amino acid synthesis (Fernandez-Villa et al., 2019).
- the lower relative expression of folA and folP which encode the protein targets for TMP and SMX, respectively, together with lower expression of emrA and emrB, which encode subunits of the EmrAB efflux pump that transports TMP-SMX out of the cell, also supported the greater sensitivity to TMP-SMX of anti-rsPilA vs. anti-IHF NRels.
- the differences noted in the anti-IHF NRel lipid metabolism and cell membrane composition proteins supported the observed increased sensitivity to AMC, wherein the modified membrane content could have altered membrane permeability to allow greater access of the ⁇ -lactam antibiotic to the periplasm where they could bind to the penicillin binding proteins to prevent peptidoglycan crosslinking (Delcour, 2009).
- NRel NTHI populations Further investigation to characterize the likely manifold distinctions between NRel NTHI populations will include examination of environmental conditions under which biofilms are formed, maturation status and character of biofilms formed by diverse strains of NTHI as well as other genera of bacteria. Furthermore, since the two NRel populations described here represent an adaptive state, the NRel phenotype is likely dynamic over time. Indeed, dissecting the contribution of release kinetics and means to disperse or disrupt biofilms is a focus of investigations to fully characterize the onset and duration of the distinct antibiotic- sensitive phenotypes.
- An additional potential benefit of a less frequent antibiotic treatment regimen is reduction of off-target side effects and other undesirable sequelae of oral antibiotic use; which includes development of antibiotic resistance (Patini et al., 2020; Tagliabue and Rappuoli, 2018) and/or disruption of the gut microbiome (Bailey et al., 2020; Gillies et al., 2015; Kuehn et al., 2015; MacPherson et al., 2018; Pallav et al., 2014).
- Applicant provided proof-of-principal for this strategy to treat biofilm- associated diseases caused by NTHI via use of NRel-inducing antibodies directed against unique biofilm associated targets of this important human pathogen.
- Nontypeable Haemophilus influenzae strain 86-028NP is a clinical isolate recovered from the nasopharynx of a child undergoing tympanostomy tube insertion due to chronic OM (Harrison et al., 2005; Sirakova et al., 1994) and has been maintained frozen at a low passage number.
- NTHI biofilms were established in brain heart infusion broth supplemented (sBHI) with 2 ⁇ g each of ⁇ -nicotinamide adenine dinucleotide ( ⁇ -NAD) and heme per ml for 16 h in 8-well chambered coverglass slides as described (Jurcisek et al., 2011). After 16 h, biofilms were washed with 200 ⁇ l of equilibrated (37°C) Dulbecco’s phosphate buffered saline without calcium or magnesium (DPBS).
- DPBS equilibrated
- IgG IgG concentration present within a 1:50 dilution of each respective rabbit hyperimmune serum Applicant used in previous studies (Brockson et al., 2014; Mokrzan et al., 2018). The incubation times used coincide with the time wherein maximal release of NTHI from biofilm residence is achieved (Mokrzan et al., 2018; Novotny et al., 2019).
- Rabbit polyclonal IgG derived from anti- NTHI OMP P5 or that isolated from naive rabbit serum served as negative controls and were used at equivalent concentrations to the NRel- inducing antisera (e.g.
- Cell pellets were suspended in buffer (2% sodium dodecyl sulfate, 150 mM NaCl, 50 mM Tris pH 8), lysed with a sonic probe (Q Sonica, Newtown, CT) and heated at 100°C for 10 min. Protein concentration of the extract was determined by Qubit fluorometry, and 10 ⁇ g of each sample was processed by SDS-PAGE using a 10% Bis Tris NuPage mini-gel (Invitrogen) in the MES buffer system.
- buffer 2% sodium dodecyl sulfate, 150 mM NaCl, 50 mM Tris pH 8
- a sonic probe Q Sonica, Newtown, CT
- the migration windows (1 cm gel lane) were excised and digested in-gel with trypsin using a ProGest robot (DigiLab, Hopkinton, MA) with the following protocol: 1) wash with 25 mM ammonium bicarbonate followed by acetonitrile; 2) reduce with 10 mM dithiothreitol at 60°C followed by alkylation with 50 mM iodoacetamide at room temperature; 3) digest with trypsin (Promega, Madison, WI) at 37°C for 4h; 4) quench with formic acid. Supernatants were analyzed directly without further processing.
- Mass spectrometry [0621] Half of each pooled fraction was analyzed by nano LC-MS/MS with a Waters M- Class HPLC system interfaced to a ThermoFisher Fusion Lumos mass spectrometer. Peptides were loaded on a trapping column and eluted over a 75 ⁇ m analytical column at 350 nL/min; both columns were packed with Luna C18 resin (Phenomenex, Torrance, CA). The mass spectrometer was operated in data-dependent mode, with MS and MS-MS performed in the Orbitrap at 60,000 FWHM (full width at half maximum) resolution and 15,000 FWHM resolution, respectively. The instrument was run with a 3 s cycle for MS and MS/MS.
- Mass spectrometry data processing [0623] Data were searched using a local copy of Mascot (Matrix Science) with the following parameters: enzyme, trypsin/P; database, www.ncbi.nlm.nih.gov/nuccore/CP000057.2 (concatenated forward and reverse plus common contaminants); fixed modifications, carbamidomethyl (C); variable modifications: acetyl (N term) deamidation (NQ) oxidation (M), pyro-glu (N-term Q); mass values, monoisotopic; peptide mass tolerance, 10 ppm; fragment mass tolerance, 0.02 Da; maximum missed cleavages, 2.
- enzyme trypsin/P
- database www.ncbi.nlm.nih.gov/nuccore/CP000057.2 (concatenated forward and reverse plus common contaminants); fixed modifications, carbamidomethyl (C); variable modifications: acetyl (N term) deamidation (NQ) oxidation (M),
- Mascot DAT files were parsed into Scaffold (Proteome Software) for validation, filtering and to create a non- redundant list per sample. Data were filtered using a 1% protein and peptide false discovery rate (FDR), requiring at least two unique peptides per protein. Applicant used the normalized spectral counts for downstream analysis.
- FDR protein and peptide false discovery rate
- Applicant generated the PCA plot with 95% confidence ellipses surrounding each population (using the FactoMineR and ggplot2 packages in R), with the normalized spectral counts for each protein identified by mass spectrometry in the three samples of planktonic, anti-rsPilA NRel, and anti-IHF NRel groups (Lê et al., 2008; Wickham et al., 2016).
- NTHI planktonic cell density
- Applicant adjusted the planktonic cell density to the same CFU per ml as the NRel population in each experiment as follows: NTHI were incubated statically to mid log phase growth then diluted to either 3 x 10 8 CFU/ml for comparison with anti-rsPilA NRel collected at 6 h, or to 2 x 10 8 CFU/ml for comparison with anti-IHF NRel collected at 15 min (see FIGURE 1). Applicant then determined the concentrations of amoxicillin (Sigma-Aldrich, St. Louis, MO) and clavulanate (U.S.
- anti-IHF or anti-rsPilA NRel collected at 2 h
- Applicant first quantitated NRel, and found ⁇ 2.0 x 10 8 or 4.0 x 10 8 CFU/ml released by exposure of biofilms to anti-rsPilA or anti-IHF IgG, respectively.
- Applicant then assessed killing of anti-IHF or anti-rsPilA NRel by concentrations of amoxicillin plus clavulanic acid (“augmentin”, AMC) or trimethoprim plus sulfamethoxazole (TMP-SMX) that killed 25% of the planktonic NTHI at the same density.
- AMC amoxicillin plus clavulanic acid
- TMP-SMX trimethoprim plus sulfamethoxazole
- Anti-rsPilA or anti-IHF NRel were collected and sonicated as described above. After sonication for 2 min in a water bath sonicator to break up any NTHI aggregates, NRel or planktonic NTHI were incubated with the indicated antibiotics at 37°C for 2 h, then serially diluted and plated on chocolate agar to quantify viable NTHI. To assay biofilm-resident NTHI, biofilms were established for 16 h at 37°C as described above, washed twice with DPBS and incubated in sBHI supplemented with the indicated antibiotics at 37°C.
- NTHI biofilms were established in 8-well chambered coverglass slides. After 16 h, medium was aspirated from each well and biofilms incubated with 5 ⁇ g IgG from rabbit polyclonal IHF for 15 min or 11 ⁇ g IgG from polyclonal rabbit anti-rsPilA for 6 h at 37°C, 5% CO2.
- RNA Isolation and qRT-PCR assay [0631] For RNA isolation, Applicant seeded 6 ml of NTHI at 2 x 10 5 CFU/ml into a T-25 tissue culture flask. After 16 h incubation at 37°C, 5% CO 2 , the flask was gently inverted and the medium poured off. With the flask upside down, 6 ml prewarmed DPBS was added then the flask was slowly inverted to gently wash the biofilm. To remove the DPBS wash, the flask was inverted again and DPBS poured off.
- Antibody diluted in sBHI was added with the flask still upside down, to deliver the same concentration of antibody/cm 2 as used in chamberslide assays (51.5 ⁇ g anti-IHF IgG per ml or 113 ⁇ g anti-rsPilA IgG per ml).
- the flask was returned to the incubator, inverted gently so that the medium again covered the biofilm.
- After 3 min for anti-IHF, or 3 h for anti-rsPilA the flask was inverted and the medium poured off to collect the NRel NTHI, and centrifuged for 1 min at 16.1 x g.
- treatment groups such as media alone as a negative control, 3 ⁇ g anti-rsPilA antibodies, 1.25 ⁇ g anti-MsTipMab (i.e., mouse monoclonal antibody against DNABII tip chimer), and 3 ⁇ g anti-rsPilA antibodies plus 1.25 ⁇ g anti-MsTipMab.
- Bacteria were labeled with FM1-43 FX and relative fluorescence was calculated per well.
- Applicant can overcome several important bottlenecks to treatment and/or prevention.
- Applicant determined that despite genetic identity, populations of NRel bacteria are unique due to the exact manner by which they were released from the biofilm. The phenotype of these NRel bacterial populations can be leveraged in a unique way to overcome multiple bottlenecks to both treatment and/or prevention of chronic and recurrent bacterial diseases wherein biofilms contribute significantly to pathogenesis and the disease course.
- Applicant hypothesizes that in states of mixed bacterial biofilm infection Applicant can leverage this understanding to capitalize on the power of anti-rsPilA to induce sustained but slower top-down release of NTHI from an established biofilm due to programmed expression of both LuxS and type IV pili as well as prevent the formation of any new NTHI biofilm as a result of active immunization but also, via either active immunization and/or therapeutic delivery of anti-DNABII antibody directed specifically against the protective epitopes, rapidly disrupt biofilms formed by multiple bacterial species via a non- programmed mechanism.
- Applicant also uses humanized monoclonal antibodies directed against the specific protective epitopes of both rsPilA and the DNABII proteins which Applicant identified and characterized.
- Applicant similarly immunizes with vaccine candidates that Applicant designed and tested extensively preclinically for their relative effectiveness.
- Applicant uses the high throughput 96-well biofilm plate assay developed to build both diverse single species and mixed species biofilms by multiple high priority pathogens then treat these biofilms with either anti-rsPilA alone, anti-DNABII alone or a combination of both to determine their relative ability to disrupt/disperse an existing biofilm.
- Bacteria to be tested include: NTHI, M.
- Applicant uses the high throughput assay to generate/recover NRel bacteria to test for relative antibiotic sensitivity when compared to planktonic counterparts (as used in clinical microbiology laboratories to determine MIC values and treatment regimens for patients) testing both single species and mixed species biofilms as above.
- Applicant uses any of the three animal models of biofilm diseases (chinchilla model of OM; rat model of periimplantitis or murine model of lung disease) to test the combined active immunization + therapeutic approach as hypothesized above.
- Experiment No.5 - 2-species biofilm disruption/dispersal synergy assay [0647] Bacteria were grown on agar for 18-20 hrs, then diluted in supplemented BHI broth (sBHI) to achieve a specific target concentration that was pre-determined to allow both microorganisms to survive being cultured together and allowed us to be able to recover NTHI at similar concentrations to those achievable when NTHI was in a single-species biofilm of the same age when being treated.
- BHI BHI broth
- NTHI + Burkholderia cenocepacia is highly problematic and particularly so in individuals with cystic fibrosis (CF);
- NTHI + Staphylococcus aureus is a problematic combo throughout the airway and
- NTHI + Streptococcus pneumoniae is problematic throughout the airway
- sBHI media alone
- the open bars depict what happens to NTHI when it builds a biofilm alone (see FIG.7 wherein it is shown that sBHI does not release bacteria from a biofilm but that both anti-rsPilA antibody and anti- TipMab do and the cocktail is synergistic and thus induces the greatest release) – open bars. They gray shaded and solid black bars to show that when NTHI forms a biofilm with another bacterial species and treated with sBHI, one of the two antisera or a cocktail of both antisera. See FIG.9. FIG.10 shows the results of treatment of NTHI and M. cat. biofilms.
- results of labeling of otorrhea solids from pediatric patients with tympanostomy tubes and persistent otorrhea for eDNA and IHF in combination with microbiological culture indicate that biofilms play a role in chronic otorrhea.
- 9 (60%) contained solids positive for labeling IHF in association with a lattice of eDNA (labeled using rabbit anti-IHF, detected with goat anti- rabbit IgG conjugated to AlexaFlour 594) and 75% yielded positive bacterial cultures.
- Bacterial culture results demonstrated the presence of H. influenzae, Staphylococcus aureus (MRSA), S.
- chinchilla model of OM juvenile chinchillas are first given a viral “cold” followed a week later by their being challenged intranasally with an inoculum viable bacteria. Similar to the human condition wherein “my child has a cold and a week later gets an ear infection” chinchillas also develops a bacterial OM approximately one week after a challenge, and while experiencing the viral upper respiratory tract infection.
- Applicants thus contemplate and indeed have already used chinchilla models as reported herein to demonstrate the protective efficacy of IHF immunization which results in rapid resolution of existing biofilms. This model is also useful for therapeutic approaches via either passive delivery of anti-DNABII antibody or via delivery of a small molecule or other agent known to bind to IHF or other DNABII family members.
- NTHI bacteria were injected into the middle ear space of the chinchillas and allowed to form a biofilm.
- chinchillas per cohort are sacrificed on day 13 (three dose experiments). Following sacrifice, chinchillas are imaged, middle ear mucosa is collected, adherent biofilm is assessed, middle ear fluids are collected, quantitation of bacteria is performed, and middle ear fluids are assessed using a cytokine multiplex assay. [0657] Middle ear fluids are collected and an aliquot serially diluted and plated on to chocolate agar to quantitate the relative planktonic bacterial load. Remaining fluids are centrifuged at 1000 x g for 5 min, supernatants separated and both cellular pellet and fluid fractions snap-frozen prior to storage at -80°C.
- the middle ear mucosa and adherent bacterial biomass are digitally imaged, collected into pre-weighed microcentrifuge tubes and homogenized in 1.0 ml sterile 0.9% sodium chloride. Homogenates are also serially diluted and plated, as before, to quantitate the population of bacteria adherent within the middle ear space per mg tissue/biomass. Remaining sample is snap-frozen prior to storage at -80°C. Culture plates are incubated for 24 h at 37°C in a humidified atmosphere prior to enumeration of bacterial colonies via Protocol2 instrument (Synbiosis).
- Video otoscopy using a 0-degree, 3-inch probe connected to a digital camera system is utilized to monitor signs of OM (e.g. tympanic membrane inflammation and/or presence of fluid in the middle ear space).
- OM e.g. tympanic membrane inflammation and/or presence of fluid in the middle ear space.
- Tympanometry is performed with a MADSEN Otoflex tympanometer and data analyzed with OTOsuite software (Otometrics, Schaumburg, IL).
- Overall signs of OM are blindly rated on an established 0 to 4+ scale and middle ears with a score of ⁇ 2.0 are considered positive for OM if middle ear fluid is visible behind the tympanic membrane.
- Table 5 The relative quantity of a panel of pro- and anti-inflammatory cytokines in clarified middle ear fluids (IL-1 ⁇ , IL-6, IL-8, IL-12p70, IL-17A, TNF, IFN ⁇ , IL-4, IL-10, and IL-13) is determined using BD Cytometric Bead array (BD Biosciences) according to manufacturer’s instructions and samples are assessed on a BD Accuri C6 cytometer. Data are analyzed with FloJo V_10 software.
- Implants with and without established Aa biofilm are transmucosally placed into the alveolar bone of female rats between premolar and incisor region of the maxillae.
- bacterial samples are collected from saliva and the oral surfaces of implants after 2 days.
- Aa can be detected by culture, as well as by PCR analysis.
- Micro-CT and histological analysis of peri-implant bone and mucosal tissues can be performed at various time points, e.g., six weeks after implantation.
- the oral cavity contains an array of bacterial species that coexist within biofilm communities.
- Confocal microscopy can be utilized to analyze the biofilm structure, and differential plating and immunofluorescence microscopy can be used to determine the composition of the bacterial species present within the biofilms.
- the methods and compositions disclosed herein are contemplated to develop both therapeutic as well as preventative strategies for reduction and/or elimination of these biofilms. A decrease in redness, inflammation, and bleeding compared to infected controls would indicate biofilm reduction and/or elimination. In addition, reduced or absent inflammatory or proinflammatory histology and maintenance of torque removal force for the implant screw compared to infected controls would indicate biofilm reduction and/or elimination.
- Cystic Fibrosis is an autosomal recessive disease due to mutations in a gene that encodes the CF transmembrane conductance regulator (called CFTR) anion channel.
- CFTR CF transmembrane conductance regulator
- compositions disclosed herein are contemplated to develop both therapeutic as well as preventative strategies for reduction and/or elimination of these biofilms and/or for amelioration of the signs of disease and associated pathologies.
- Experiment No.9 – PilA Vaccine Methods described herein may be used to elicit immune responses against PilA in humans and animals.
- Immunogenic compositions may be administered to human and animal subjects in the presence of adjuvants such as but not limited to aluminum salts and liposomes. Those skilled in the art will understand that any number of pharmaceutically acceptable adjuvants can also be used.
- Immunogenic compositions may be administered to a human or animal subjects intramuscularly, subdermally, intranasally, or through any other suitable route.
- Immunogenic compositions may be prepared in a manner consistent with the selected mode of administration. Immunogenic compositions may take the form of polypeptides, nucleic acids, or a combination thereof, and may comprise full-length or partial antigens. Additionally, or alternatively, immunogenic compositions may take the form of APCs pulsed with a particular antigen, or APCs transfected with one or more polynucleotides encoding a particular antigen. Administration may comprise a single dose of an immunogenic composition, or an initial administration, followed by one or more booster doses. Booster doses may be provided a day, two days, three days, a week, two weeks, three weeks, one, two, three, six or twelve months, or at any other time point after an initial dose.
- a booster dose may be administered after an evaluation of the subject's antibody titer.
- Experiment No.10 – Passive Immunity Methods described herein may be used to confer passive immunity on a non-immune subject against PilA and/or DNABII as disclosed herein. Passive immunity against a given antigen may be conferred through the transfer of antibodies or antigen binding fragments that specifically recognize or bind to a particular antigen.
- Antibody donors and recipients may be human or non-human subjects.
- the antibody composition may comprise an isolated or recombinant polynucleotide encoding an antibody or antigen binding fragment that specifically recognizes or binds to a particular antigen.
- Passive immunity may be conferred in cases where the administration of immunogenic compositions poses a risk for the recipient subject, the recipient subject is immuno-compromised, or the recipient subject requires immediate immunity.
- Immunogenic compositions may be prepared in a manner consistent with the selected mode of administration.
- Compositions may comprise whole antibodies, antigen binding fragments, polyclonal antibodies, monoclonal antibodies, antibodies generated in vivo, antibodies generated in vitro, purified or partially purified antibodies, or whole serum.
- Administration may comprise a single dose of an antibody composition, or an initial administration followed by one or more booster doses.
- Booster doses may be provided a day, two days, three days, a week, two weeks, three weeks, one, two, three, six or twelve months, or at any other time point after an initial dose.
- a booster dose may be administered after an evaluation of the subject's antibody titer.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Communicable Diseases (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Gastroenterology & Hepatology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pulmonology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Cosmetics (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP21887747.0A EP4237445A4 (en) | 2020-11-01 | 2021-11-01 | Compositions and methods for preventing, inhibiting, disrupting, or treating a polymicrobial biofilm |
| AU2021371032A AU2021371032A1 (en) | 2020-11-01 | 2021-11-01 | Compositions and methods for preventing, inhibiting, disrupting, or treating a polymicrobial biofilm |
| CN202180072653.9A CN116490778A (zh) | 2020-11-01 | 2021-11-01 | 用于预防、抑制、破坏或治疗多微生物生物膜的组合物和方法 |
| US18/034,668 US20230406911A1 (en) | 2020-11-01 | 2021-11-01 | Compositions and methods for preventing, inhibiting, disrupting, or treating a polymicrobial biofilm |
| CA3194301A CA3194301A1 (en) | 2020-11-01 | 2021-11-01 | Compositions and methods for preventing, inhibiting, disrupting, or treating a polymicrobial biofilm |
| JP2023524899A JP2023548073A (ja) | 2020-11-01 | 2021-11-01 | 多微生物性バイオフィルムを防止する、阻害する、破壊する、または処置するための組成物および方法 |
| JP2025247996A JP2026034590A (ja) | 2020-11-01 | 2025-12-12 | 多微生物性バイオフィルムを防止する、阻害する、破壊する、または処置するための組成物および方法 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063108421P | 2020-11-01 | 2020-11-01 | |
| US63/108,421 | 2020-11-01 | ||
| US17/364,578 US12116614B2 (en) | 2020-06-30 | 2021-06-30 | Methods for determining antibiotic sensitivity |
| US17/364,578 | 2021-06-30 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2022094433A2 true WO2022094433A2 (en) | 2022-05-05 |
| WO2022094433A3 WO2022094433A3 (en) | 2022-06-30 |
Family
ID=81384466
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/057626 Ceased WO2022094433A2 (en) | 2020-11-01 | 2021-11-01 | Compositions and methods for preventing, inhibiting, disrupting, or treating a polymicrobial biofilm |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20230406911A1 (https=) |
| EP (1) | EP4237445A4 (https=) |
| JP (2) | JP2023548073A (https=) |
| CN (1) | CN116490778A (https=) |
| AU (1) | AU2021371032A1 (https=) |
| CA (1) | CA3194301A1 (https=) |
| WO (1) | WO2022094433A2 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024107449A1 (en) * | 2022-11-14 | 2024-05-23 | Research Institute At Nationwide Children's Hospital | Antibody compositions and methods for disrupting nontuberculous mycobacteria biofilms |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2016303688B2 (en) * | 2015-07-31 | 2023-06-15 | Research Institute At Nationwide Children's Hospital | Peptides and antibodies for the removal of biofilms |
-
2021
- 2021-11-01 US US18/034,668 patent/US20230406911A1/en active Pending
- 2021-11-01 AU AU2021371032A patent/AU2021371032A1/en active Pending
- 2021-11-01 JP JP2023524899A patent/JP2023548073A/ja active Pending
- 2021-11-01 CN CN202180072653.9A patent/CN116490778A/zh active Pending
- 2021-11-01 CA CA3194301A patent/CA3194301A1/en active Pending
- 2021-11-01 WO PCT/US2021/057626 patent/WO2022094433A2/en not_active Ceased
- 2021-11-01 EP EP21887747.0A patent/EP4237445A4/en active Pending
-
2025
- 2025-12-12 JP JP2025247996A patent/JP2026034590A/ja active Pending
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024107449A1 (en) * | 2022-11-14 | 2024-05-23 | Research Institute At Nationwide Children's Hospital | Antibody compositions and methods for disrupting nontuberculous mycobacteria biofilms |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3194301A1 (en) | 2022-05-05 |
| AU2021371032A1 (en) | 2023-05-11 |
| CN116490778A (zh) | 2023-07-25 |
| WO2022094433A3 (en) | 2022-06-30 |
| EP4237445A2 (en) | 2023-09-06 |
| US20230406911A1 (en) | 2023-12-21 |
| EP4237445A4 (en) | 2024-10-02 |
| AU2021371032A9 (en) | 2024-05-23 |
| JP2026034590A (ja) | 2026-02-27 |
| JP2023548073A (ja) | 2023-11-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12239763B2 (en) | Peptides and antibodies for the removal of biofilms | |
| JP7627255B2 (ja) | バイオフィルムを破壊するための抗体組成物 | |
| EP3595445B1 (en) | Composition and methods for disruption of bacterial biofilms without accompanying inflammation | |
| AU2018206552C1 (en) | DNABII vaccines and antibodies with enhanced activity | |
| AU2018206560B9 (en) | Antibody fragments for the treatment of biofilm-related disorders | |
| JP2026034590A (ja) | 多微生物性バイオフィルムを防止する、阻害する、破壊する、または処置するための組成物および方法 | |
| RU2851685C2 (ru) | Композиции антител для разрушения биопленок | |
| JPWO2022094433A5 (https=) |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| ENP | Entry into the national phase |
Ref document number: 3194301 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023524899 Country of ref document: JP Ref document number: 202180072653.9 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21887747 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2021371032 Country of ref document: AU Date of ref document: 20211101 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021887747 Country of ref document: EP Effective date: 20230601 |