WO2022093373A1 - Compounds,compositions and methods of use to treat bone fractures - Google Patents

Compounds,compositions and methods of use to treat bone fractures Download PDF

Info

Publication number
WO2022093373A1
WO2022093373A1 PCT/US2021/047824 US2021047824W WO2022093373A1 WO 2022093373 A1 WO2022093373 A1 WO 2022093373A1 US 2021047824 W US2021047824 W US 2021047824W WO 2022093373 A1 WO2022093373 A1 WO 2022093373A1
Authority
WO
WIPO (PCT)
Prior art keywords
compound
bone
amino acid
seq
acid residues
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/047824
Other languages
English (en)
French (fr)
Inventor
Philip S. Low
Stewart LOW
Jeffery Nielsen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Purdue Research Foundation
Original Assignee
Purdue Research Foundation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Purdue Research Foundation filed Critical Purdue Research Foundation
Priority to US18/033,665 priority Critical patent/US20230399374A1/en
Priority to MX2023004796A priority patent/MX2023004796A/es
Priority to CN202180087681.8A priority patent/CN116801900A/zh
Priority to EP21887113.5A priority patent/EP4232074A4/en
Priority to AU2021370296A priority patent/AU2021370296A1/en
Priority to JP2023525002A priority patent/JP2024506435A/ja
Priority to CA3194776A priority patent/CA3194776A1/en
Publication of WO2022093373A1 publication Critical patent/WO2022093373A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575—Hormones
    • C07K14/635—Parathyroid hormone, i.e. parathormone; Parathyroid hormone-related peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22—Hormones
    • A61K38/28—Insulins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22—Hormones
    • A61K38/29—Parathyroid hormone, i.e. parathormone; Parathyroid hormone-related peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/548—Phosphates or phosphonates, e.g. bone-seeking
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04—Organic compounds
    • A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04—Organic compounds
    • A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/088—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins conjugates with carriers being peptides, polyamino acids or proteins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/0012—Galenical forms characterised by the site of application
    • A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner

Definitions

  • the present disclosure relates to osteotropic ligands, bone anabolic agents, conjugates comprising both, compositions comprising the same, and methods of use to treat bone fractures.
  • compositions and methods for treating or improving healing of bone fractures e.g, through the combined use of osteotropic ligands and bone anabolic agents (e.g., conjugates)).
  • osteotropic ligands and bone anabolic agents e.g., conjugates
  • a method for treating a bone-healing event e.g. , bone fracture
  • a bone-healing event e.g. , bone fracture
  • administering e.g., a therapeutically effective amount of
  • a compound or pharmaceutically acceptable salt thereof provided herein, such as, for example, a compound or pharmaceutically acceptable salt thereof that comprises a bone targeting agent (e.g, an osteotropic ligand) and/or an anabolic agent (e.g, a bone anabolic agent).
  • a bone targeting agent e.g, an osteotropic ligand
  • an anabolic agent e.g, a bone anabolic agent
  • the compound having the structure of Formula (I) is a pharmaceutically acceptable salt thereof.
  • X is a bone anabolic agent.
  • X is a bone anabolic agent selected from the group consisting of a parathyroid hormone (PTH) (e.g., or a derivative or fragment thereof (e.g., having bone anabolic activity)), a PTH-related protein (PTHrP) (e.g., or a derivative or fragment thereof (e.g., having bone anabolic activity)), and abaloparatide (e.g, or a derivative or fragment thereof (e.g., having bone anabolic activity)).
  • PTH parathyroid hormone
  • PTHrP PTH-related protein
  • abaloparatide e.g, or a derivative or fragment thereof (e.g., having bone anabolic activity)
  • Y is absent or a linker (e.g., a releasable linker or a non- releasable linker). In some embodiments, Y is a releasable linker or a non-releasable linker. In some embodiments, Z is an osteotropic ligand (e.g., an acidic oligopeptide (AOP) (e.g, comprising at least 4 amino acid residues (e.g., 4 to 20 amino acid residues))).
  • AOP acidic oligopeptide
  • X is a bone anabolic agent selected from the group consisting of a PTH (e.g. , or a derivative or fragment thereof (e.g. , having bone anabolic activity)), a PTHrP (e.g. , or a derivative or fragment thereof (e.g., having bone anabolic activity)), and abaloparatide (e.g, or a derivative or fragment thereof (e.g., having bone anabolic activity)).
  • a PTH e.g. , or a derivative or fragment thereof (e.g. , having bone anabolic activity)
  • PTHrP e.g. , or a derivative or fragment thereof (e.g., having bone anabolic activity)
  • abaloparatide e.g, or a derivative or fragment thereof (e.g., having bone anabolic activity)
  • the bone anabolic agent is a PTH or a PTHrP or a derivative or fragment thereof (e.g, (SEQ ID NO: 1 and/or having bone anabolic activity)).
  • the bone anabolic agent is a parathyroid hormone (PTH) (e.g, or a derivative or fragment thereof).
  • the bone anabolic agent is a PTHrP or a derivative or fragment thereof).
  • the bone anabolic agent is a modified PTH or a derivative or fragment thereof).
  • the modified PTH or derivative or fragment thereof is synthetically modified.
  • the bone anabolic agent is a modified PTHrP or a derivative or fragment thereof such as, for example, comprising SEQ ID NO: 1.
  • the modified PTHrP or a derivative or fragment thereof is synthetically modified.
  • the bone anabolic agent is abaloparatide (e.g, or a derivative or fragment thereof (e.g, having bone anabolic activity)).
  • the bone anabolic agent is abaloparatide (SEQ ID NO: 2).
  • the bone anabolic agent is a (e.g, synthetically) modified abaloparatide.
  • X is a PTH or a derivative or fragment thereof (e.g, having bone anabolic activity).
  • X is a PTHrP or a derivative or fragment thereof (e.g., having bone anabolic activity).
  • X is abaloparatide or a derivative or fragment thereof (e.g, having bone anabolic activity).
  • X is dasatinib.
  • X is proinsulin-like growth factor II (pro-IGF-II).
  • X is a cyclic peptide (e.g, optionally substituted 101 or optionally substituted 102). In some embodiments, X is optionally substituted 101. In some embodiments, X is optionally substituted 102. In some embodiments, X is 101. In some embodiments, X is 102. [0018] In some embodiments, X modulates integrin alpha 5 beta 1 activity. In some embodiments, X is a ligand of integrin alpha 5 beta 1. In some embodiments, 101 and 102 modulate integrin alpha 5 beta 1 activity.
  • Z is a tetracycline, a phosphonate (e.g, monobisphosphonate, tribisphosphonate, or a polybisphosphonate), or an AOP.
  • Z is a tetracycline.
  • Z is a monobisphosphonate, a tribisphosphonate, or a polybisphosphonate.
  • Z is a monobisphosphonate.
  • Z is a tribisphosphonate.
  • Z is a polybisphosphonate.
  • Z is a linear chain of amino acid residues. In some embodiments, Z is a branched chain of amino acid residues. In some embodiments, Z is an AOP (e.g. , comprising at least 4 glutamic acid amino acid residues or 4 aspartic acid amino acid residues).
  • AOP e.g. , comprising at least 4 glutamic acid amino acid residues or 4 aspartic acid amino acid residues.
  • Z comprises at least 4 amino acid residues (e.g, 4 or more, 10 or more, 20 or more, 30 or more, 50 or more, 75 or more, or 100 or more). In some embodiments, Z comprises 4 to 75 acidic amino acid residues (e.g, D-glutamic acid amino acid residues). In some embodiments, Z comprises at most 100 amino acid residues (e.g, 100 or less, 75 or less, 50 or less, 30 or less, 20 or less, 10 or less, or 4 or less). In some embodiments, Z comprises not less than 4 and not more than 35 amino acids. In some embodiments, Z comprises not less than 4 and not more than 20 amino acids. In some embodiments, Z comprises not less than 6 and not more than 30 amino acids.
  • Z comprises not less than 8 and not more than 30 amino acids. In some embodiments, Z comprises not less than 8 and not more than 20 amino acids. In some embodiments, Z comprises glutamic acid amino acid residues. In some embodiments, Z comprises D-glutamic acid amino acid residues.
  • Z comprises 4 to 75 D-glutamic acid amino acid residues. In some embodiments, Z comprises 8 to 30 D-glutamic acid amino acid residues. In some embodiments, Z comprises 8 to 20 D-glutamic acid amino acid residues.
  • the AOP comprises from about 4 to about 20 amino acid residues (such as 4 to about 20 or about 4 to 20) or more amino acid residues, such as 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20. In various embodiments, the AOP comprises about 20 amino acid residues, such as 20 amino acid residues.
  • Z comprises at least 4 (e.g., D-) glutamic acid amino acid residues (e.g, 4 to 20 D-glutamic acid amino acid residues) and/or at least 4 (e.g, D-) aspartic acid amino acid residues (e.g, 4 to 20 D-aspartic acid amino acid residues).
  • the amino acid is aspartic acid (represented by the letter D), glutamic acid (represented by the letter E), or a mixture thereof.
  • the amino acid residues can have D chirality, L chirality, or a mixture thereof.
  • the amino acid residue has D chirality.
  • the amino acid residue has L chirality.
  • Z comprises at least 4 (e.g, acidic) amino acid residues (e.g, having the same chirality (e.g, D- or L- amino acid residues)).
  • each of the at least 4 (e.g, acidic) amino acid residue has D chirality.
  • the aspartic acid is D-aspartic acid or L-aspartic acid.
  • the glutamic acid is D-glutamic acid or L-glutamic acid.
  • Z comprises not less than 4 and not more than 20 D-glutamic acid residues or L- glutamic acid residues. In some embodiments, Z comprises not less than 4 and not more than 20 D-aspartic acid residues or L-aspartic acid residues.
  • Z comprises at least 4 (e.g, D-) glutamic acid amino acid residues (e.g, 4 to 20 D-glutamic acid amino acid residues) and/or at least 4 (e.g, D-) aspartic acid amino acid residues (e.g, 4 to 20 D-aspartic acid amino acid residues).
  • Z comprises a mixture of (e.g, D-) glutamic acid amino acid residues and (e.g, D-) aspartic acid amino acid residues.
  • Z comprises at least 4 repeating D-glutamic acid amino acid residues (e.g, 4 repeating D-glutamic acid amino acid residues (DE4) or more, 6 repeating D- glutamic acid amino acid residues (DE6) or more, 8 repeating D-glutamic acid amino acid residues (DE8) or more, 10 repeating D-glutamic acid amino acid residues (DE10) or more, 15 repeating D-glutamic acid amino acid residues (DEI 5) or more, 20 repeating D-glutamic acid amino acid residues (DE20) or more, 25 repeating D-glutamic acid amino acid residues (DE25) or more, 30 repeating D-glutamic acid amino acid residues (DE30) or more, or 35 repeating D-glutamic acid amino acid residues (DE35) or more). In some embodiments, Z comprises at least DE10 or more, DEI 5 or more, or DE20 or more). In some embodiments, Z is DE10 or DE20.
  • Z comprises at least DE15 or at least DE20.
  • X is abaloparatide or a derivative or fragment thereof (e.g, having bone anabolic activity) and Z is DE20.
  • Y is a non-releasable linker. In some embodiments, Y is a non- releasable linker containing at least one carbon-carbon bond. In some embodiments, Y is a non- releasable linker containing at least one amide bond. In some embodiments, Y is a non-releasable linker containing at least one carbon-carbon bond and at least one amide bond.
  • Y is a non-releasable linker and comprises one or more amide bond(s). In some embodiments, Y is a non-releasable linker and comprises 1-20 amide bond(s). In some embodiments, Y is a non-releasable linker and comprises 1-10 amide bond(s). In some embodiments, Y is a non-releasable linker and comprises 10-20 amide bond(s). In some embodiments, Y is a non-releasable linker and comprises 1-5 amide bond(s).
  • Y is anon-releasable linker and comprises one or more amino acid linker group(s).
  • Y is a polypeptide.
  • the polypeptide comprises 1-20 amino acid residue(s).
  • the polypeptide comprises 1-10 amino acid residue(s).
  • the polypeptide comprises 10-20 amino acid residue(s).
  • the polypeptide comprises 1-5 amino acid residue(s).
  • Y is a non-releasable linker and comprises one or more ether bond(s) (C-O). In some embodiments, Y is a non-releasable linker and comprises 1-20 ether bond(s) (C-O). In some embodiments, Y is a non-releasable linker and comprises 1-10 ether bond(s) (C-O). In some embodiments, Y is a non-releasable linker and comprises 10-20 ether bond(s) (C-O). In some embodiments, Y is anon-releasable linker and comprises 1-5 ether bond(s) (C-O).
  • Y is a non-releasable linker and comprises one or more polyethylene glycol (PEG) linker group(s). In some embodiments, Y is a PEG.
  • Y is a non-releasable linker and comprises one or more thioether bond(s) (C-S). In some embodiments, Y is a non-releasable linker and comprises 1-20 thioether bond(s) (C-S). In some embodiments, Y is a non-releasable linker and comprises 1-10 thioether bond(s) (C-S). In some embodiments, Y is a non-releasable linker and comprises 10-20 thioether bond(s) (C-S). In some embodiments, Y is a non-releasable linker and comprises 1-5 thioether bond(s) (C-S).
  • S-S disulfide
  • Y is a releasable linker containing at least one (e.g., protease-specific) amide bond.
  • Y is a releasable linker and comprises one or more amide bond(s). In some embodiments, Y is a releasable linker and comprises 1-20 amide bond(s). In some embodiments, Y is a releasable linker and comprises 1-10 amide bond(s). In some embodiments, Y is a releasable linker and comprises 10-20 amide bond(s). In some embodiments, Y is a releasable linker and comprises 1-5 amide bond(s).
  • Y is a releasable linker and comprises one or more amino acid linker group(s).
  • Y is a polypeptide.
  • the polypeptide comprises 1-20 amino acid residue(s).
  • the polypeptide comprises 1-10 amino acid residue(s).
  • the polypeptide comprises 10-20 amino acid residue(s).
  • the polypeptide comprises 1-5 amino acid residue(s).
  • Y is a releasable linker and comprises one or more ether bond(s) (C-O). In some embodiments, Y is a releasable linker and comprises 1-20 ether bond(s) (C-O). In some embodiments, Y is a releasable linker and comprises 1-10 ether bond(s) (C-O). In some embodiments, Y is a releasable linker and comprises 10-20 ether bond(s) (C-O). In some embodiments, Y is a releasable linker and comprises 1-5 ether bond(s) (C-O).
  • Y is a releasable linker and comprises one or more PEG linker group(s).
  • X is abaloparatide (e.g, or a derivative or fragment thereof (e.g, having bone anabolic activity))
  • Y is a releasable oligopeptide linker comprising at least one protease-specific amide bond
  • Z is 20 repeating DE20.
  • X is abaloparatide (e.g, or a derivative or fragment thereof (e.g, having bone anabolic activity)), Y is anon-releasable oligopeptide linker, and Z is DE10.
  • the compound is SEQ ID NO: 3.
  • the compound is SEQ ID NO: 14.
  • X is abaloparatide or a derivative or fragment thereof (e.g, having bone anabolic activity), Y is a non-releasable oligopeptide linker, and Z is DE20.
  • the compound is SEQ ID NO: 4.
  • X is abaloparatide or a derivative or fragment thereof (e.g, having bone anabolic activity), Y is a non-releasable oligopeptide linker, and Z is DE20.
  • the compound is SEQ ID NO: 11.
  • X is a (poly)peptide.
  • a compound having the structure of Formula (I) is a (poly)peptide.
  • a (poly)peptide having bone anabolic activity e.g, abaloparatide (SEQ ID NO: 2)
  • a substantially pure (poly)peptide having bone anabolic activity e.g, abaloparatide
  • the (poly)peptide comprises an amino acid sequence having at least 75%, at least 85%, at least 95% amino acid sequence identity with an amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, or SEQ ID NO: 14.
  • SEQ ID NO: 3 and/or SEQ ID NO: 14 have bone anabolic activity (e.g, and bone targeting activity).
  • SEQ ID NO: 4 has bone anabolic activity (e.g. , and bone targeting activity).
  • the (poly)peptide comprises an amino acid sequence having at least 75% sequence identity (e.g, at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more) with the (e.g, PTH, PTHrP (SEQ ID NO: 1), or abaloparatide (Abalo) (SEQ ID NO: 2)), or the amino acid sequence set forth in SEQ ID NO: 3.
  • the (poly)peptide comprises an amino acid sequence having at least 75% sequence identity (e.g, at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more) with PTH or PTHrP (SEQ ID NO: 1), or Abalo (SEQ ID NO: 2)), or the amino acid sequence set forth in SEQ ID NO: 4.
  • at least 75% sequence identity e.g, at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more
  • PTH or PTHrP SEQ ID NO: 1
  • Abalo SEQ ID NO: 2
  • the (poly)peptide is an amino acid sequence having at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more to an amino acid sequence shown in FIG. 1 A. In another embodiment, the (poly)peptide is an amino acid sequence shown in FIG. 1 A. In another embodiment, the (poly)peptide is an amino acid sequence having at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more to an amino acid sequence shown in FIG. IB. In another embodiment, the (poly)peptide is an amino acid sequence shown in FIG. IB.
  • the (poly)peptide is an amino acid sequence having at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more to 101 (e.g. , see SEQ ID NO: 7 in Fig. 1A). In some embodiments, the (poly)peptide is 101 (e.g, see SEQ ID NO: 7 in Fig. 1A). In some embodiments, the (poly)peptide is an amino acid sequence having at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more to 102 (e.g., see SEQ ID NO: 8 in Fig. IB). In some embodiments, the (poly)peptide is 102 (e.g., see SEQ ID NO: 8 in Fig. IB).
  • a compound provided herein comprises a payload.
  • the payload comprises Abalo or a derivative or fragment thereof (e.g., having bone anabolic activity)) (e.g, SEQ ID NO: 2).
  • the payload comprises a linker provided herein (e.g, SEQ ID NO: 12).
  • the payload comprises Abalo or a derivative or fragment thereof (e.g, having bone anabolic activity)) (e.g, SEQ. ID. NO.: 2) and a linker provided herein (e.g, SEQ ID NO: 12).
  • the linker is or comprises SEQ ID NO: 12. In some embodiments, the linker is or comprises a polypeptide consisting essentially of SEQ ID NO: 12. In some embodiments, the linker comprises one or more amino acid(s) of SEQ ID NO: 12. In some embodiments, the linker comprises each amino acid of SEQ ID NO: 12. In some embodiments, the linker is SEQ ID NO: 12.
  • the (poly)peptide is a pharmaceutically acceptable salt of any compound provided herein (e.g, a compound having a structure of Formula (I), SEQ ID NO: 3, or SEQ ID NO: 4).
  • a pharmaceutical composition comprising any compound provided herein (e.g, a compound having a structure of Formula (I), SEQ ID NO: 3, or SEQ ID NO: 4), or a pharmaceutically acceptable salt thereof.
  • the pharmaceutical composition comprises any compound provided herein and at least one pharmaceutically acceptable carrier or excipient.
  • the compound provided herein e.g, the compound having the structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4 is administered (e.g, subcutaneously) to an individual (e.g, a patient or an individual in need thereof).
  • X is a bone anabolic agent selected from the group consisting of a PTH, a PTHrP (SEQ ID NO: 1), abaloparatide (SEQ ID NO: 2), a derivative of any of the foregoing having bone anabolic activity, and a fragment of any of the foregoing having bone anabolic activity.
  • Y when present, is a linker, which can be either releasable or non- releasable.
  • the linker is an amino acid sequence having at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more to an amino acid sequence shown in FIG. 1 A.
  • the linker is an amino acid sequence shown in FIG. 1A.
  • the linker is an amino acid sequence having at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more to an amino acid sequence shown in FIG. IB (e.g., SEQ ID NO: 12).
  • linker is an amino acid sequence shown in FIG. IB (e.g., SEQ ID NO: 12).
  • Z is an osteotropic ligand, which is an AOP comprising at least 11 to 100 amino acid residues.
  • the amino acid residues can be glutamic acid, aspartic acid, or a mixture thereof.
  • the amino acid residues can have D chirality.
  • the AOP can be a linear chain of amino acid residues.
  • Y can be a non-releasable linker containing at least one carbon-carbon bond and/or at least one amide bond.
  • Y can be a releasable linker containing at least one disulfide, ester, and/or protease-specific amide bond.
  • a pharmaceutical composition comprising any compound provided herein (e.g, a compound having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4), or a pharmaceutically acceptable salt thereof (e.g, and at least one pharmaceutically acceptable carrier or excipient).
  • any compound provided herein e.g, a compound having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4
  • a pharmaceutically acceptable salt thereof e.g, and at least one pharmaceutically acceptable carrier or excipient.
  • composition comprising an effective amount of an above-described conjugate and a pharmaceutically acceptable carrier.
  • the compound provided herein e.g, the compound having the structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4 is administered (e.g, subcutaneously) to an individual (e.g, a patient or an individual in need thereof).
  • a method of treating a bone fracture e.g, of an individual (e.g, a patient or an individual in need thereof)).
  • the method comprises administering (e.g, subcutaneously) a therapeutically effective amount of any compound provided herein (e.g, a compound having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4) to the individual (e.g, a patient or an individual in need thereof).
  • a therapeutically effective amount of any compound provided herein e.g, a compound having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4
  • administering e.g, subcutaneously
  • the therapeutically effective amount of any compound provided herein e.g, a compound having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4
  • the individual e.g, a patient or an individual in need thereof
  • a method of treating a bone fracture in a patient comprising administering (e.g, subcutaneously) to the patient (e.g, in need thereof) a therapeutically effective amount of any compound (e.g, having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4) or pharmaceutical composition provided herein, thereby treating the bone fracture in the patient (e.g, in need thereof).
  • a therapeutically effective amount of any compound e.g, having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4
  • pharmaceutical composition provided herein
  • the patient is susceptible to a bone fracture.
  • the patient e.g, in need thereof
  • the patient e.g, in need thereof
  • the patient e.g. , in need thereof
  • has a maxillofacial deficiency, defect, or injury e.g, a maxillofacial fracture.
  • the maxillofacial fracture is a mandibular osteotomy stabilized with a microplate.
  • the patient e.g, in need thereof
  • the patient has one or more comorbidities selected from the group consisting of diabetes mellitus, osteoporosis, a maxillofacial injury, and a maxillofacial deficiency.
  • administering e.g, subcutaneously
  • the therapeutically effective amount of any compound (e.g, having a structure of Formula (I)) or pharmaceutical composition provided herein is by injection.
  • administering e.g, subcutaneously
  • the therapeutically effective amount of any compound (e.g, having a structure of Formula (I)) or pharmaceutical composition provided herein is by subcutaneous injection.
  • the therapeutically effective amount of any compound or pharmaceutical composition provided herein is administered by parenterally administration or enterally administration.
  • a method of treating a bone fracture e.g, of an individual (e.g, a patient or an individual in need thereof)).
  • the method comprises administering (e.g, subcutaneously) a therapeutically effective amount of any compound provided herein (e.g, a compound having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4) to the individual (e.g, a patient or an individual in need thereof).
  • a therapeutically effective amount of any compound provided herein e.g, a compound having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4
  • administering e.g, subcutaneously
  • the therapeutically effective amount of any compound provided herein e.g, a compound having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4
  • the individual e.g, a patient or an individual in need thereof
  • administering the therapeutically effective amount of any compound or pharmaceutical composition provided herein is by parenteral administration or enteral administration.
  • administering results in a reduction of pain in the patient within three weeks (e.g, between 2-3 weeks) following administration of the therapeutically effective amount of the compound or pharmaceutical composition provided herein.
  • Methods for promoting bone growth in a patient are also provided.
  • the method comprises administering to the patient a therapeutically effective amount of a compound or pharmaceutical composition provided herein, thereby increasing a bone mineral density in a bone of the patient as compared to pre-treatment (e.g. , bone density prior to administration of the compound or pharmaceutical composition provided herein).
  • pre-treatment e.g. , bone density prior to administration of the compound or pharmaceutical composition provided herein.
  • the increased bone mineral density in the bone occurs at a fracture site or in one or more resorption pits present on the bone (e.g, in a patient experiencing osteoporosis).
  • a compound provided herein is administered (e.g, to an individual in need thereof) subcutaneously.
  • a therapeutically effective amount of any compound or pharmaceutical composition provided herein is administered daily, weekly, bi-weekly, or monthly (e.g, for a period of time, such as, for example, one week, one month, one year, or longer). In some embodiments, a therapeutically effective amount of any compound or pharmaceutical composition provided herein is administered once or twice weekly. In some embodiments, the therapeutically effective amount of any compound or pharmaceutical composition provided herein is administered in 1 to 800 independent doses. In certain embodiments, the therapeutically effective amount of the compound or pharmaceutical composition has a concentration of compound of at or between 0.01 mg/kg of patient body weight to 1 mg/kg of patient body weight.
  • the bone anabolic agent is a PTH or a PTHrP (SEQ ID NO: 1) or a derivative or fragment thereof (e.g, having bone anabolic activity)). In some embodiments, the bone anabolic agent is a PTH or a derivative or fragment thereof. In some embodiments, the bone anabolic agent is a PTHrP (SEQ ID NO: 1) or a derivative or fragment thereof. In some embodiments, the bone anabolic agent is a (e.g, synthetically) modified PTH or a derivative or fragment thereof. In some embodiments, the bone anabolic agent is a (e.g. , synthetically) modified PTHrP (SEQ ID NO: 1) or a derivative or fragment thereof.
  • the bone anabolic agent is abaloparatide or a derivative or fragment thereof (e.g, having bone anabolic activity).
  • the bone anabolic agent is abaloparatide (SEQ ID NO: 2).
  • the bone anabolic agent is a (e.g, synthetically) modified abaloparatide.
  • Z is a linear chain of amino acid residues.
  • Z is an AOP (e.g, comprising at least 4 glutamic acid amino acid residues or 4 aspartic acid amino acid residues).
  • Z comprises at least 4 amino acid residues (e.g, 4 or more, 10 or more, 20 or more, 30 or more, 50 or more, 75 or more, or 100 or more). In some embodiments, Z comprises at most 100 amino acid residues (e.g, 100 or less, 75 or less, 50 or less, 30 or less, 20 or less, 10 or less, or 4 or less). In some embodiments, Z comprises not less than 4 and not more than 35 amino acids. In some embodiments, Z comprises not less than 4 and not more than 20 amino acids. In some embodiments, Z comprises not less than 6 and not more than 30 amino acids. In some embodiments, Z comprises not less than 8 and not more than 30 amino acids. In some embodiments, Z comprises not less than 8 and not more than 20 amino acids.
  • the AOP comprises from about 4 to about 20 amino acid residues (such as 4 to about 20 or about 4 to 20) or more amino acid residues, such as 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20. In various embodiments, the AOP comprises about 20 amino acid residues, such as 20 amino acid residues.
  • the amino acids is aspartic acid (represented by the letter D), glutamic acid (represented by the letter E), or a mixture thereof.
  • the amino acid residues can have D chirality, L chirality, or a mixture thereof.
  • the amino acid residue has D chirality.
  • the amino acid residue has L chirality.
  • Z comprises at least 4 (e.g, acidic) amino acid residues (e.g, having the same chirality (e.g, D- or L- amino acid residues)).
  • each of the at least 4 (e.g, acidic) amino acid residue has D chirality.
  • the aspartic acid is D-aspartic acid or L-aspartic acid.
  • the glutamic acid is D-glutamic acid or L-glutamic acid.
  • Z comprises not less than 4 and not more than 20 D-glutamic acid residues or L-glutamic acid residues. In some embodiments, Z comprises not less than 4 and not more than 20 D-aspartic acid residues or L-aspartic acid residues.
  • Z comprises at least 4 (e.g, D-) glutamic acid amino acid residues (e.g, 4 to 20 D-glutamic acid amino acid residues) and/or at least 4 (e.g, D-) aspartic acid amino acid residues (e.g, 4 to 20 D-aspartic acid amino acid residues).
  • Z comprises a mixture of (e.g, D-) glutamic acid amino acid residues and (e.g, D-) aspartic acid amino acid residues.
  • Z comprises at least 4 repeating D-glutamic acid amino acid residues (e.g, DE4 or more, DE6 or more, DE8 or more, DE10 or more, DEI 5 or more, or DE20 or more, DE25 or more, DE30 or more, or DE35 or more). In some embodiments, Z comprises at least 10 repeating D-glutamic acid amino acid residues (e.g, DE4 or more, DE6 or more, DE8 or more, DE10 or more, DE15 or more, or DE20 or more, DE25 or more, DE30 or more, or DE35 or more). In some embodiments, X is abaloparatide or a derivative or fragment thereof (e.g, having bone anabolic activity) and Z is DE20.
  • Y is a non-releasable linker. In some embodiments, Y is a non- releasable linker containing at least one carbon-carbon bond. In some embodiments, Y is a non- releasable linker containing at least one amide bond. In some embodiments, Y is a non-releasable linker containing at least one carbon-carbon bond and at least one amide bond.
  • S-S disulfide
  • Y is a releasable linker containing at least one (e.g, protease-specific) amide bond.
  • Y is a linker described elsewhere herein (e.g, hereinabove).
  • Z is an osteotropic ligand described elsewhere herein (e.g, hereinabove).
  • X is abaloparatide or a derivative or fragment thereof (e.g, having bone anabolic activity)
  • Y is a non-releasable oligopeptide linker
  • Z is DE20.
  • the compound is SEQ ID NO: 11.
  • X is abaloparatide or a derivative or fragment thereof (e.g, having bone anabolic activity)
  • Y is a releasable oligopeptide linker comprising at least one proteasespecific amide bond
  • Z is DE20.
  • the compound is an imaging agent (e.g, a dye).
  • the compound is a single-photon emission computer tomography /computed tomography (SPEC/CT) imaging agent.
  • SPEC/CT single-photon emission computer tomography /computed tomography
  • the compound is described elsewhere herein (e.g, hereinabove).
  • the compound is SEQ ID NO: 3. In some embodiments, the compound is SEQ ID NO: 4.
  • a pharmaceutical composition comprising any compound provided herein (e.g, a compound having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4), or a pharmaceutically acceptable salt thereof (e.g, and at least one pharmaceutically acceptable carrier or excipient).
  • any compound provided herein e.g, a compound having a structure of Formula (I), SEQ ID NO: 3 or SEQ ID NO: 4
  • a pharmaceutically acceptable salt thereof e.g, and at least one pharmaceutically acceptable carrier or excipient.
  • the method comprises administering (e.g, subcutaneously) to a patient with a bone fracture an effective amount of a conjugate of formula X-Y-Z or a pharmaceutical composition comprising same, whereupon the bone fracture in the patient is treated.
  • the patient can have diabetes mellitus, osteoporosis, or a maxillofacial fracture, such as a mandibular osteotomy stabilized with a microplate.
  • the effective amount of the conjugate or the effective amount of the pharmaceutical composition can be administered by injection, such as subcutaneous injection.
  • Fig. 1A shows SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 (the structure for a targeted conjugate of dasatinib), and SEQ ID NO: 7.
  • Fig. IB shows SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, and SEQ ID NO: 15.
  • Fig. 2A shows chemical structures of a tetracycline, a mono-bisphosphonate, a polyphosphate, and an acidic oligopeptide conjugated to a radiolabeled tyrosyl cysteine.
  • Fig. 2B shows a graph of conjugate vs. fractured/healthy femurs ratio for bone-targeting ligands delivering 125 I tyrosyl cysteine payloads.
  • Fig. 3A shows a graph of tissue vs. percent injected dose/g of targeted SEQ ID NO: 1 compared to untargeted/free SEQ ID NO: 1.
  • Fig. 3B shows a graph of conjugate vs. percent injected dose/g of targeted SEQ ID NO: 1 and free SEQ ID NO: 1 in the fracture femurs of a mammal 24 hours post-injection.
  • Fig. 3C shows a graph of conjugate vs. fractured/healthy femurs ratio of targeted with SEQ ID NO: 1 as compared to untargeted/free SEQ ID NO: 1.
  • Fig. 4 shows a graph of tissue vs. percent injected dose/g of six different radio-iodinated pay loads coupled to (L)Aspw 24 hours post-injection.
  • Fig. 5 shows a graph of tissue vs. percent injected dose/g of radio-iodinated casein kinase 2.3 peptide (CK2.3) coupled to 10 (L) aspartic acids relative to untargeted CK2.3.
  • CK2.3 radio-iodinated casein kinase 2.3 peptide
  • Fig. 6 shows a graph of tissue vs. percent injected dose/gram of radio-iodinated CK2.3 coupled to 10 (L) aspartic acids, 10 (L) glutamic acids, or 10 (L) aminoadipic acids relative to untargeted CK2.3.
  • Fig. 7 shows a graph of tissue vs. percent injected dose/g of radio-iodinated CK2.3 coupled to 10 or 20 (L) glutamic acids relative to untargeted CK2.3.
  • Fig. 8 shows a graph of tissue vs. percent injected dose/g of radio-iodinated CK2.3 coupled to 20 L- or D-glutamic acids relative to untargeted CK2.3.
  • Fig. 9 shows a graph of hours post-injection vs. pg dye/mg tissue of S0456 (near-infrared (IR) fluorophore) coupled to 10 L- or D-aspartic acids in a mammal bearing midshaft femur fractures 10 days post-fracture at different time points post-injection.
  • IR near-infrared
  • Fig. 10 shows a graph of targeting ligands vs. percent injected dose/gram of radioiodinated CK2.3 coupled to different acidic oligopeptides relative to untargeted CK2.3.
  • Fig. 11A shows a single-photon emission computer tomography /computed tomography (SPEC/CT) image of the Tc chelator EC20 chelating 99Tc linked to (D)Gluio acid.
  • SPEC/CT single-photon emission computer tomography /computed tomography
  • Fig. 11B shows a SPEC/CT image of the Tc chelator EC20 chelating 99Tc linked to (D)Glu2o acid.
  • Fig. 11C shows a graph of tissue vs. percent injected dose/g of the labeled (D)Gluio and (D)Glu2o compounds in the different tissues.
  • Fig. 11D shows the structure of EC2O(D)Gluio chelating 99Tc.
  • Fig. 12 shows the structure of a tri-bisphosphonate targeting ligand.
  • Fig. 13 shows a graph of agent tested vs. bone volume (BV) of targeted anabolic conjugates on a mammal after four weeks.
  • Fig. 14 shows a graph of agent tested vs. bone volume/total volume (BV/TV) of targeted anabolic conjugates on a mammal after four weeks.
  • Fig. 15 shows a graph of agent tested vs. maximum (max) load (N) of targeted anabolic conjugates on a mammal after four weeks.
  • Fig. 16 shows a graph of agent tested vs. work to fracture (mJ) of targeted anabolic conjugates on a mammal after four weeks.
  • Fig. 17 shows a graph of agent tested vs. post-yield displacement (mm) of targeted anabolic conjugates on a mammal after four weeks.
  • Fig. 18 shows a graph of days vs. blood sugar (mg/dl) of a type I diabetic rodent during the four-week treatment period using a compound provided herein.
  • Fig. 19 shows a graph of days vs. average % change in body mass for a type I diabetic fracture mice treated groups throughout treatment.
  • Fig. 20A shows a graph of agent tested vs. bone volume of targeted anabolic conjugates on a mammal after four weeks.
  • Fig. 20B shows a graph of agent tested vs. bone volume/total volume of targeted anabolic conjugates on a mammal after four weeks.
  • Fig. 21A shows a graph of agent tested with insulin vs. trabecular thickness of targeted anabolic conjugates on a mammal after four weeks.
  • Fig. 21B shows a graph of agent tested with insulin vs. trabecular spacing of targeted anabolic conjugates on a mammal after four weeks.
  • Fig. 22 A shows a graph of agent tested with insulin vs. maximum force (N) of targeted anabolic conjugate on a mammal after four weeks.
  • Fig. 22B shows a graph of agent tested with insulin vs. work to fracture (mJ) of targeted anabolic conjugate on a mammal after four weeks.
  • Fig. 22C shows a graph of agent tested with insulin vs. modulus (MPa) of targeted anabolic conjugate on a mammal after four weeks.
  • Fig. 23A shows agraph of agenttested vs. BV oftargeted anabolic conjugate on amammal after four weeks.
  • Fig. 23B shows a graph of agent tested vs. bone volume/total volume (BV/TV) of targeted anabolic conjugate on a mammal after four weeks.
  • Fig. 24A shows a graph of agent tested vs. max load (N) of targeted anabolic conjugate on a mammal after four weeks.
  • Fig. 24B shows a graph of agent tested vs. work to fracture (mJ) of targeted anabolic conjugate on a mammal after four weeks.
  • Fig. 24C shows a graph of agent tested vs. stiffness (MPa) of targeted anabolic conjugate on a mammal after four weeks.
  • Fig. 25 shows a graph of agent tested vs. serum calcium concentration (mg/dl) of treatment on serum calcium in a mammal with a midshaft femur fracture model.
  • Fig. 26 shows a graph of days vs. distance traveled (cm) in locomotor open-field boxes for different treatment groups.
  • Fig. 27 shows a graph of days vs. time spent moving in locomotor open-field boxes for different treatment groups.
  • Fig. 28 shows a graph of days vs. mean velocity (cm/s) in locomotor open-field boxes for different treatment groups.
  • Fig. 29 shows graphs of agent vs. non-calcified area (mm 2 ) for defect and graft and cranial defect, agent vs. percent migrated (%) for screw, agent vs. gap diameter (mm) for mandibular osteotomy, and agent vs. max load (N) for mandibular osteotomy.
  • Fig. 30 shows a graph of hours vs. percent injected dose in blood (cpm/g) of compounds provided herein.
  • Fig. 31 shows a graph of hours vs. percent injected dose in bone (cpm/g) of compounds provided herein in fractured femurs and contralateral femurs.
  • Fig. 32 shows a graph of treatment of a compound provided herein vs. max load (N).
  • Fig. 33 shows a graph of treatment of a compound provided herein vs. work to fracture (mJ).
  • Fig. 34 shows a graph of treatment of a compound provided herein vs. max load (N).
  • Fig. 35 shows CT images of bone imaged three weeks after initiation of treatment with non-targeted abaloparatide.
  • the present disclosure relates to the preparation and use of compounds and compositions that treat bone fractures.
  • the compounds, compositions, and methods leverage strategies to (e.g, selectively) localize the therapeutic agents to a bone fracture or other bone injury of interest.
  • the compounds, compositions, and methods provided may comprise an osteotropic ligand.
  • the compounds and compositions are formulated to exhibit increased retention time (such as due to increased resistance to degradation, for example) such that the frequency at which the compound or composition is readministered to maintain a therapeutically effective concentration at the targeted site (e.g, a fracture site) is reduced.
  • the compounds, compositions, and methods hereof allow for significant advantages over conventional therapies used to treat bone fractures.
  • targeted therapies allow for a noninvasive way to maintain longer duration of therapeutic concentrations of drug relative to the traditional bolus administration used in local application of a therapeutic like in bone morphogenetic protein-2 (BMP2). This can result in more robust stimulation of healing and faster repair.
  • BMP2 bone morphogenetic protein-2
  • the noninvasive nature can further allow physicians to control when and how long a drug is administered such that they can affect different phases of fracture healing and adjust treatment strategies to meet variability in patient healing times. It also can reduce systemic exposure and side effects and can avoid leakage in to neighboring tissue like the local application of anabolics.
  • Bone fractures can present in patients with osteoporosis.
  • Osteoporosis can be a comorbidity that individuals have later in life (e.g., > 65 years old) and can be the result of a misbalance between the osteoblasts and the osteoclasts.
  • the misbalance can be triggered by the loss of estrogen during menopause.
  • the loss in bone density due to the misbalance can lead to fragile bones that break with a relatively reduced force (compared to earlier in life).
  • the misbalance in the bone basic unit can also slow the healing of fractures.
  • At least one in three women and one in five men over the age of 50 will suffer an osteoporotic fracture.
  • Osteoporotic patients are at least twice as likely to get a fracture (e.g, due to sarcopenia and weakened bone) and, as such, osteoporotic fractures can be a challenge to the at-risk population. This population would benefit from a noninvasive strategy to accelerate bone fracture healing.
  • Diabetic patients have six times as many fractures as patients without diabetes. Diabetic patients may have twice as many nonunion fractures as healthy patients. The increase in fractures, in some instances, occurs from microstructural changes (e.g, in the extracellular matrix of the bone). Hyperglycemia can lead to non-enzymatic crosslinks between collagen strands.
  • type I diabetes mellitus the loss of insulin production from the beta cells in the islets of Langerhans can lead to a reduction in bone mineral density (e.g, because insulin is anabolic for osteoblasts).
  • bone healing can be impaired from poor vascularization and neuropathy. Accelerating fracture repair in these patients may be important, since, for example, they may be more prone to co-morbidities when immobilized. Diabetic patients can be challenging orthopedic patients to treat with current bone healing treatment options.
  • maxillofacial bone fractures can consistently result in severe decrements in quality of life (e.g, that often persists until the damaged bones are substantially repaired). This decline in quality of life can be from pain arising from the high density of nerve endings in craniofacial regions, the concentration of all five major senses in these areas, and the loss of crucial functions of this area, such as, for example, communication and mastication.
  • osteogenic drugs approved to date are topically applied during surgery. For example, because surgery is not indicated for most fractures, the opportunity to employ these pharmacologic agents can be difficult.
  • leakage of locally applied anabolic drugs into surrounding tissues can lead to undesirable side effects including, for example, ectopic bone growth.
  • systemic administration of osteogenic agents stimulates unwanted anabolic processes in healthy tissues, such as, for example, nerves, muscles, and the vasculature.
  • hypercalcemia, hypertension, immunosuppression, and even cancer are concerns surrounding systemic administration of bone anabolic drugs.
  • bone targeting has primarily focused on delivering payloads to orthopedic pathologies not related to fractures, such as osteoporosis, osteomyelitis, and bone metastases. Most of these treatments are bisphosphonates to deliver compounds selectively to bone. However, when treating bone fractures, it is imperative to deliver compounds selectively to the fracture site to avoid ectopic ossification that can occur when a drug is delivered nonspecifically to all bone. While tetracycline may be moderately selective for fractured over healthy bone, tetracyclines can be toxic to bone, liver and kidney and are thus not an ideal solution.
  • bisphosphonates for fracture targeting, including that they inhibit osteoclasts, which are essential for both normal skeletal remodeling and resolving of fracture calluses from woven bone into laminar bone.
  • Another problem with using bisphosphonates as targeting ligands is that they have half-lives of up to 20 years in bone, which, depending on the stability of their therapeutic cargoes, can potentially lead to an undesirably prolonged stimulation of their molecular targets.
  • ranelates Similar targeting can be observed with ranelates. These compounds can be used as targeting molecules for many bone diseases and can be attached to anabolic agents to speed bone growth and healing. However, like bisphosphonates, they have a long bone half-life.
  • the osteotropic ligand can deliver an attached peptidic, therapeutic agent to a fracture, in particular a fracture callus.
  • Abaloparatide (SEQ ID NO: 2) is an anabolic, 34-amino acid, synthetic analog of parathyroid hormone-related protein (PTHrP) (SEQ ID NO: 1). It can help promote bone growth and conserve bone density and can be used to treat osteoporosis.
  • Abaloparatide (SEQ ID NO: 2) acts similarly to PTHrP (SEQ ID NO: 1) and targets, binds to, and activates the parathyroid hormone 1 (PTH1) receptor (PTH1R).
  • PTH1R is a G protein-coupled receptor (GPCR) expressed in osteoblasts and bone stromal cells. PTH1R, in turn, activates the cyclic adenosine monophosphate (cAMP) signaling pathway and the bone anabolic signaling pathway, leading to bone growth and increased bone mineral density and volume. The increase in bone mass and strength helps prevent/treat osteoporosis and decrease the risk of fractures.
  • GPCR G protein-coupled receptor
  • Management of broken bones may be improved by continuously applying bone anabolic agents to a fracture over the entire course of the healing process.
  • hydroxyapatite is exposed on a broken bone.
  • Molecules that bind with high affinity and specificity for hydroxyapatite may provide a treatment for targeting a bone anabolic agent to a fracture (e.g, and provide for continuous stimulation of fracture healing).
  • Patients with fractures can suffer a loss of function, for example, due to pain and lack of stability of a fracture.
  • Conventional treatments for skeletal loss of function include, for example, improved stability by surgically implanting plates and rods, pain relief with nonsteroidal antiinflammatory drugs (NSAIDS) and opioids, and locally applied anabolics.
  • Surgical implantation of rods and plates is invasive and can be painful.
  • Opioids can, in some instances, elicit cognitive impairment and are, for example, 1) the most commonly abused drug class (e.g, after orthopedic trauma in both young and aged populations) and 2) in some instances, responsible for the continuation of some pain syndromes following healing of the injury.
  • opioids can induce dizziness and vertigo, which can, for example, result in falls that can further exacerbate existing bone injuries or cause new bone injuries.
  • NSAID use for fracture pain is discouraged as it can compromise the healing process.
  • administration of NSAIDs to alleviate pain may result in reduced bone density, decreased cartilage formation during early fracture fixation and, ultimately, nonunion of the bone defect.
  • Mechanisms for this compromised healing may include, for example, delays in differentiation of stem cells and diminished BMP2 production.
  • patients continue to feel pain after treatment, resulting in a loss of function despite better radiographic outcomes.
  • BMP2 is an approved therapy for treating bone fractures that can improve fracture healing, but has also been reported to, in some instances, increase pain after surgery, which may delay the gain of function following a fracture.
  • AOPs acidic oligopeptides
  • AOPs effectively target spinal fusions.
  • 20-mers are more effective than 10-mers.
  • AOPs are highly selective compared to bisphosphonates and tetracyclines.
  • glutamic acid polymers and aspartic acid polymers have similar retention times at the delivery site.
  • oligo-aspartic acids while oligo-aspartic acids have reduced nonspecific retention in the kidneys, the slight increase in retention time observed with oligoglutamic acid is transient.
  • both aspartic acid oligopeptides and glutamic acid oligopeptides e.g, nearly quantitatively clear from the kidneys after 18 hours.
  • AOPs target peptides of all chemical classes (e.g, hydrophobic, neutral, cationic, anionic, short oligopeptides, and long polypeptides). In some embodiments, this targeting is particularly beneficial as it allows for the development and broad use of this platform to develop other targeted therapeutics (e.g, many bone anabolic agents are peptidic, but their physical properties can vary greatly).
  • non-natural D enantiomers of AOPs which can, in some instances, exhibit increased retention time on the fracture surface compared to the respective L enantiomers. This can be due to an increased resistance to degradation as compared to other compounds, for example.
  • increased retention time impacts the frequency that a therapeutic agent requires re-administration to maintain a therapeutically effective concentration at the targeted site of surgery (e.g, bone fracture).
  • increased retention time impacts the amount of a therapeutic agent required to be administered to elicit a targeted response (e.g, a therapeutic response).
  • linear AOPs are superior to branched AOPs (e.g. , due to a reduction in, or the absence of, interference).
  • targeted delivery of anabolic agents provides localization of therapeutic agents to bone fracture (e.g, via injection, such as, for example, subcutaneous injection, for example, at a distal site).
  • a compound provided herein is administered repeatedly to a patient (e.g, in need thereof).
  • a compound provided herein is administered at a relatively low dose to a patient (e.g, in need thereof).
  • a compound provided herein is administered at a safe dose to a patient (e.g. , in need thereof).
  • a compound provided herein is administered at a therapeutic dose to a patient (e.g, in need thereof).
  • targeted delivery minimizes (e.g, if not eliminates) drift of an anabolic agent (e.g, into other tissues and unwanted mineralization).
  • anabolic agent e.g, into other tissues and unwanted mineralization.
  • bone growth in the region is stimulated for a relatively long time (e.g, to achieve relatively fast results (e.g, so that patients can regain their post-surgery mobility more quickly as compared to non-targeted delivery approaches)).
  • X-Y-Z or a pharmaceutically acceptable salt thereof, wherein: X is a bone anabolic agent;
  • Y when present, is a linker, which can be either releasable or non-releasable;
  • Z is an osteotropic ligand.
  • the osteotropic ligand has an affinity for bone, e.g., hydroxyapatite. In some embodiments, the osteotropic ligand helps direct the compound (or a derivative or fragment thereof) to (e.g., healing) bone. In some embodiments, the osteotropic ligand has the potential to target the bone anabolic agent to a bone fracture or other bone injury. In some embodiments, the osteotropic ligand is a ligand with affinity for hydroxyapatite.
  • the osteotropic ligand is aranelate, a bisphosphonate (e.g, alendronate), a tetracycline, a polyphosphate, an acidic molecule (such as a molecule with two or more carboxylic acids), a calcium chelator, a metal chelator, or an AOP.
  • the osteotropic ligand is an AOP.
  • the osteotropic ligand is a bisphosphonate selected from the group consisting of monobisphosphonate, tribisphosphonate, and polybisphosphonate.
  • Z comprises at least 4 amino acid residues (e.g, 4 or more, 10 or more, 20 or more, 30 or more, 50 or more, 75 or more, or 100 or more). In some embodiments, Z comprises at most 100 amino acid residues (e.g, 100 or less, 75 or less, 50 or less, 30 or less, 20 or less, 10 or less, or 4 or less). In some embodiments, Z comprises not less than 4 and not more than 30 amino acids. In some embodiments, Z comprises not less than 4 and not more than 20 amino acids.
  • the AOP comprises from about 4 to about 20 amino acid residues (such as 4 to about 20 or about 4 to 20) or more amino acid residues, such as 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20. In various embodiments, the AOP comprises about 20 amino acid residues, such as 20 amino acid residues. In other embodiments, the AOP can comprise more than 20 amino acid residues, such as 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or as many as 100 amino acid residues.
  • the amino acids can be aspartic acid (represented by the letter D), glutamic acid (represented by the letter E), or a mixture thereof.
  • the amino acid residues can have D chirality, L chirality, or a mixture thereof.
  • the amino acid residue has D chirality.
  • the amino acid residue has L chirality.
  • the aspartic acid is D-aspartic acid or L-aspartic acid.
  • the glutamic acid is D-glutamic acid or L-glutamic acid.
  • Z comprises not less than 4 and not more than 20 D-glutamic acid residues or L-glutamic acid residues.
  • Z comprises not less than 4 and not more than 20 D-aspartic acid residues or L- aspartic acid residues.
  • the AOP comprises one or more neutral or basic amino acids (e.g, provided that the AOP functions effectively as an osteotropic ligand).
  • the AOP comprises one or more synthetic amino acids (e.g, which can be acidic, neutral or basic).
  • the AOP is linear (a linear chain) or branched (a branched chain).
  • a linear chain is used in various embodiments.
  • the AOP can be cyclized.
  • the osteotropic ligand (Z) can be a single unit, a polymer, a dendrimer, or multiple units.
  • the osteotropic ligand is a polymer.
  • the anabolic agent is cyclic.
  • the anabolic agent is a cyclic peptide.
  • a cyclic peptide is a compound (or radical thereof) consisting of two or more amino acids linked in a chain, wherein two portions of the compound combine to form a heterocyclic (e.g, peptide) molecule.
  • Examples of cyclic peptides include, but are not limited to, structures 101 and 102 (see, e.g., Figs. 1A and IB).
  • X is any suitable bone anabolic agent.
  • the bone anabolic agent is neutral, anionic, cationic, or hydrophobic.
  • the bone anabolic agent is an oligopeptide (e.g, comprising less than or equal to about 10 (or less than 10) amino acid residues, such as 10, 9, 8, 7, 6, 5 or 4 amino acid residues).
  • the bone anabolic agent comprises more than or equal to about 10 (or more than 10) amino acid residues, such as 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 amino acid residues.
  • anabolic agents include, but are not limited to, abaloparatide (SEQ ID NO: 2), SEQ ID NO: 5 (e.g, a 34-residue peptide hormone that is secreted by the [3-cells of the pancreatic islets; corresponds to Asp69-Leul02 of the E-peptide of proinsulin-like growth factor II (pro-IGF-II)), SEQ ID NO: 7 (e.g, ITGA conjugated with 10 glutamic acid residues (ITGA5)), SEQ ID NO: 6 (a conjugate with 10 glutamic acid residues), parathyroid hormone (PTH), parathyroid hormone related protein (PTHrP) (SEQ ID NO: 1), or a derivative of any of the foregoing (e.g, one or more amino acid mutations, such as insertions, deletions, and substitutions with a naturally occurring amino acid or a non-naturally occurring amino acid) having bone anabolic activity, or a fragment of any of the foregoing (e
  • a bone anabolic agent followed by the designation D# indicates that the bone anabolic agent is attached (or joined or connected, such as at an N-terminus or a C-terminus) to an osteotropic ligand (e.g, such as an orthotropic ligand having 20 aspartic acid residues).
  • a bone anabolic agent followed by the designation E# indicates that the bone anabolic agent is attached (or joined or connected, such as at an N-terminus or a C-terminus) to an osteotropic ligand (e.g., such as an orthotropic ligand having 20 glutamic acid residues).
  • SEQ ID NO: 1 is AVSEHQLLHD KGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQ ETNKVETYKE QPLKTP.
  • SEQ ID NO: 2 is
  • SEQ ID NO: 2 is AVSEHQLLHDKGKSIQDLRRRELLEKLLxKLHTA, wherein x is Aib, and the C-terminus is amidated.
  • SEQ ID NO: 15 is
  • SEQ ID NO: 3 further comprises “eeeeeeeeeee” where “e” signifies D- glutamic acid (e.g., SEQ ID NO: 3).
  • e signifies D- glutamic acid
  • EEEEEEEEEEE can be added to the end of SEQ ID NO: 15 to obtain SEQ ID NO: 14, where “E” indicates L-glutamic acid.
  • SEQ ID NO: 4 is
  • SEQ ID NO: 4 is AVSEHQLLHDKGKSIQDLRRRELLEKLLxKLHTAEIRATSEVSPNSeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee, wherein x is Aib, and “e” signifies D-glutamic acid.
  • the compound has at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more to SEQ ID NO: 3. In some embodiments, the compound has at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more to SEQ ID NO: 4. In some embodiments, the compound has at least 75% sequence identity or more, at least 85% sequence identity or more, at least 90% sequence identity or more, or at least 95% sequence identity or more to SEQ ID NO: 14.
  • S-S disulfide
  • the targeting molecule i.e., osteotropic ligand
  • the targeting molecule does not cleave from the drug/anabolic agent for the compound to be therapeutically effective in vivo.
  • This can be advantageous as it can allow for the use of osteotropic ligands and compositions comprising anabolic agents because only a negligible amount (if any) of the anabolic agent is released (e.g, systemically) prior to the targeted delivery of the compound to the bone fracture site or other targeted site.
  • tuning the releasing properties of active components is a difficult aspect of the preparation of effective pharmaceutical compositions.
  • the compounds comprising the non-releasable linkers provided herein avoid the difficulties of the preparation of effective pharmaceutical compositions (e.g, by removing the necessity of timing the release).
  • the anabolic agent of the compound provided herein is active when bound (e.g, conjugated to the osteotropic ligand).
  • the compounds comprising targeting molecules (e.g, Z) conjugated with a non-releasable linker (e.g, Y) can reduce systemic exposure and/or systemic adverse effects of the anabolic agents (X) linked therewith.
  • a conjugate comprising a non-releasable linker reduces or eliminates toxicity of a component released from the conjugate in its free form (e.g, a free form of a compound and/or ligand provided herein).
  • Both releasable and non-releasable linkers can be engineered to optimize biodistribution, bioavailability, and PK/PD (e.g, of the compound) and/or to increase uptake (e.g, of the compound) into the targeted tissue pursuant to methodologies commonly known in the art or hereinafter developed such as through PEGylation and the like.
  • the linkers can further be engineered in view of the molecular target (e.g. , whether the target is intracellular or extracellular) pursuant to concepts known in the art.
  • the linker is configured to avoid significant release of a pharmaceutically active amount of the anabolic agent in circulation prior to capture by a cell (e.g, a bone cell).
  • linkers can comprise one or more spacers (e.g, to facilitate a particular release time, facilitate an increase in uptake into a targeted tissue, and/or optimize biodistribution, bioavailability, and/or PK/PD of a compound).
  • a spacer can comprise one or more of alkyl chains, polyethylene glycols (PEGs), peptides, sugars, peptidoglycans, clickable linkers (e.g, triazoles), rigid linkers such as poly-prolines and poly -piperidines, and the like.
  • the one or more linkers of the compounds provided herein can comprise PEG, a PEG derivative, or any other linker known in the art or hereinafter developed that can achieve the purpose set forth herein.
  • the linker is repeated n times, where n is a positive integer.
  • Conjugates can be synthesized in accordance with methods known in the art and exemplified herein, such as solid phase peptide synthesis.
  • compositions generally refers to any product comprising more than one ingredient, including the compounds described herein. It is to be understood that the compositions described herein can be prepared from isolated compounds or from salts, solutions, hydrates, solvates, and other forms of the compounds. Certain functional groups, such as hydroxy, amino, and like groups, can form complexes with water and/or various solvents, in the various physical forms of the compounds.
  • compositions can be prepared from various amorphous, non-amorphous, partially crystalline, crystalline, and/or other morphological forms of the compounds, and the compositions can be prepared from various hydrates and/or solvates of the compounds. Accordingly, such pharmaceutical compositions that recite compounds include each of, or any combination of, or individual forms of, the various morphological forms and/or solvate or hydrate forms of the compounds.
  • One embodiment provides a pharmaceutical composition
  • a pharmaceutical composition comprising a compound of Formula (I) or any compound covered by such formulae, or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable excipient.
  • One embodiment provides a pharmaceutical composition
  • a pharmaceutical composition comprising an effective amount of a therapeutically (or prophylactically) effective compound of Formula (I) or any compound covered by such formulae, or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable excipient.
  • a pharmaceutical composition comprising a therapeutically effective amount of any compound provided herein that can be administered (e.g. , subcutaneously) to a patient in need thereof.
  • the composition is an injectable composition, such as a composition that is suitable for subcutaneous injection.
  • Compounds and/or compositions described herein may be administered in unit dosage forms and/or compositions containing one or more pharmaceutically acceptable carriers, adjuvants, diluents, excipients, and/or vehicles, and combinations thereof.
  • administering generally refers to any and all means of introducing compounds described herein to the host subject including, but not limited to, by oral, intravenous, intramuscular, subcutaneous, transdermal, inhalation, buccal, ocular, sublingual, vaginal, rectal, and like routes of administration.
  • salts can be appropriate.
  • acceptable salts include, without limitation, alkali metal (for example, sodium, potassium or lithium) or alkaline earth metals (for example, calcium) salts; however, any salt that is generally non-toxic and effective when administered to the subject being treated is acceptable.
  • the salt can be ammonium acetate salt.
  • pharmaceutically acceptable salt refers to those salts with counter ions which may be used in pharmaceuticals.
  • Such salts may include, without limitation: (1) acid addition salts, which can be obtained by reaction of the free base of the parent compound with inorganic acids, such as hydrochloric acid, hydrobromic acid, nitric acid, phosphoric acid, sulfuric acid, perchloric acid, and the like, or with organic acids, such as acetic acid, oxalic acid, (D) or (L) malic acid, maleic acid, methane sulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid, tartaric acid, citric acid, succinic acid, malonic acid, and the like; or (2) salts formed when an acidic proton present in the parent compound either is replaced by a metal ion, e.g., an alkali metal ion, an alkaline earth ion, or an aluminum ion, or coordinates with an organic base, such as ethanolamine, diethanolamine, triethanolamine, trimethamine, N
  • Acceptable salts are well- known to those skilled in the art, and any such pharmaceutically acceptable salts are contemplated.
  • Acceptable salts can be obtained using standard procedures known in the art, including (without limitation) reacting a sufficiently acidic compound with a suitable base, affording a physiologically acceptable anion.
  • Suitable acid addition salts are formed from acids that form nontoxic salts.
  • Illustrative, albeit nonlimiting, examples include the acetate, aspartate, benzoate, besylate, bicarbonate/carbonate, bisulphate/sulphate, borate, camsylate, citrate, edisylate, esylate, formate, fumarate, gluceptate, gluconate, glucuronate, hexafluorophosphate, hibenzate, hydrochi oride/chloride, hydrobromide/bromide, hydroiodide/iodide, isethionate, lactate, malate, maleate, malonate, mesylate, methylsulphate, naphthylate, 2-napsylate, nicotinate, nitrate, orotate, oxalate, palmitate, pamoate, phosphate/hydrogen phosphate/dihydrogen phosphate, saccharate, stearate, succinate, tartrate, tosylate and trifluoroacetate salts.
  • Suitable base salts of the compounds described herein are formed from bases that form non-toxic salts.
  • bases include the arginine, benzathine, calcium, choline, diethylamine, diolamine, glycine, lysine, magnesium, meglumine, olamine, potassium, sodium, tromethamine and zinc salts.
  • Hemi-salts of acids and bases, such as hemisulphate and hemicalcium salts also can be formed.
  • the compounds can be formulated as pharmaceutical compositions and administered to a mammalian host, such as a human patient, in a variety of forms adapted to the chosen route of administration.
  • the pharmaceutical composition can be formulated for and administered via intraosseous, intravenous, intraarterial, intraperitoneal, intracranial, intramuscular, topical, inhalation and/or subcutaneous routes.
  • a compound and/or composition can be administered directly (via inj ection, placement or otherwise) to a defect cavity in the impaired bone tissue and/or at a fracture site.
  • the compounds can be systemically administered in combination with a pharmaceutically acceptable vehicle, such as an inert diluent or an assimilable edible carrier.
  • the active compound can be combined with one or more excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
  • the percentage of the compositions and preparations can vary and may be between about 1 to about 99% weight of the active ingredient(s) and a binder, excipients, a disintegrating agent, a lubricant, and/or a sweetening agent (as are known in the art).
  • the amount of active compound in such therapeutically useful compositions is such that an effective dosage level will be obtained.
  • parenteral compounds/compositions under sterile conditions can readily be accomplished using standard pharmaceutical techniques well-known to those skilled in the art.
  • solubility of a compound used in the preparation of a parenteral composition can be increased by the use of appropriate formulation techniques, such as the incorporation of solubility-enhancing agents.
  • the compounds/compositions can also be administered via infusion or injection (e.g., using needle (including microneedle) injectors and/or needle-free injectors).
  • Solutions of the active composition can be aqueous, optionally mixed with a nontoxic surfactant and/or contain carriers or excipients, such as salts, carbohydrates and buffering agents (preferably at a pH of from 3 to 9), but, for some applications, they may be more suitably formulated as a sterile non-aqueous solution or as a dried form to be used in conjunction with a suitable vehicle, such as sterile, pyrogen-free water or phosphate-buffered saline.
  • a suitable vehicle such as sterile, pyrogen-free water or phosphate-buffered saline.
  • dispersions can be prepared in glycerol, liquid PEGs, triacetin, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations can further contain a preservative to prevent the growth of microorganisms.
  • the pharmaceutical dosage forms suitable for injection or infusion can include sterile aqueous solutions or dispersions or sterile powders comprising the active ingredients that are adapted for the extemporaneous preparation of sterile injectable or infusible solutions or dispersions, optionally encapsulated in liposomes.
  • the liquid carrier or vehicle can be a solvent or liquid dispersion medium comprising, for example and without limitation, water, ethanol, a polyol (e.g, glycerol, propylene glycol, liquid PEG(s), and the like), vegetable oils, nontoxic glyceryl esters, and/or suitable mixtures thereof.
  • the proper fluidity can be maintained by the formation of liposomes, by the maintenance of the required particle size in the case of dispersions or by the use of surfactants.
  • the action of microorganisms can be prevented by the addition of various antibacterial and antifungal agents, such as parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
  • Prolonged absorption of the injectable compositions can be brought about by the incorporation of agents formulated to delay absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable or infusible solutions can be prepared by incorporating the active compound and/or composition in the required amount of the appropriate solvent with one or more of the other ingredients set forth above, as required, followed by filter sterilization.
  • the preferred methods of preparations are vacuum drying and freeze-drying, which yield a powder of the active ingredient plus any additional desired ingredient present in the previously sterile-filtered solutions.
  • compositions or formulations in combination with an acceptable carrier, which may be a solid, a liquid, or a gel matrix.
  • an acceptable carrier which may be a solid, a liquid, or a gel matrix.
  • useful liquid carriers can comprise water, alcohols or glycols or water-alcohol/glycol blends, in which the compounds can be dissolved or dispersed at effective levels, optionally with the aid of non-toxic surfactants.
  • adjuvants such as antimicrobial agents, can be added to optimize the properties for a given use.
  • the resultant liquid compositions can be applied from absorbent pads, used to impregnate bandages and/or other dressings, sprayed onto the targeted area using pump-type or aerosol sprayers, or simply applied directly to a desired area of the subject (e.g, a fracture site).
  • Thickeners such as synthetic polymers, fatty acids, fatty acid salts and esters, fatty alcohols, modified celluloses or modified mineral materials can also be employed with liquid carriers to form spreadable pastes, gels, ointments, soaps, and the like for application directly to the skin of the subject.
  • the term “therapeutically effective dose” means (unless specifically stated otherwise) a quantity of a compound which, when administered either one time or over the course of a treatment cycle affects the health, well-being or mortality of a subject (e.g., and without limitation, supports or promotes the healing of bone fractures or bone growth).
  • the therapeutically effective amount of any compound or pharmaceutical composition provided herein is determined in accordance with methods known in the art (e.g, animal models, human data, and human data for compounds that exhibit similar pharmacological activities).
  • Useful dosages of the compounds can be determined by comparing their in vitro activity and the in vivo activity in animal models. Methods of the extrapolation of effective dosages in mice and other animals to human subjects are known in the art.
  • the dosage of the compound can vary significantly depending on the condition of the host subject, the bone fracture being treated, the route of administration of the compound and tissue distribution, and the possibility of co-usage of other therapeutic treatments (for example, in conjunction with the administration of other injectable compositions for promoting bone growth such as growth factors, stem cells, natural grafts, biologic- and synthetic- based tissue-engineered scaffolds and the like, hardware implantation, and/or ultrasound therapies and the like; and/or in conjunction with the administration of other therapeutics such as, for example, insulin).
  • other injectable compositions for promoting bone growth such as growth factors, stem cells, natural grafts, biologic- and synthetic- based tissue-engineered scaffolds and the like, hardware implantation, and/or ultrasound therapies and the like
  • other therapeutics such as, for example, insulin
  • the therapeutically effective amount of any compound or pharmaceutical composition provided herein is determined by taking into consideration, for example, the potency of X of Formula (I) (e.g, the type of anabolic agent employed), body weight, mode of administration (e.g, subcutaneously), disease or condition being treated, disease or condition its severity, the like, or any combination thereof.
  • the amount of the composition required for use in treatment e.g, the therapeutically effective amount or dose
  • the therapeutically effective amount of any compound or pharmaceutical composition provided herein is from about 0.01 mg/kg/day up to about 1,000 mg/kg/day.
  • therapeutically effective amounts or doses can range from about 0.05 mg/kg of patient body weight to about 30.0 mg/kg of patient body weight, or from about 0.01 mg/kg of patient body weight to about 5.0 mg/kg of patient body weight, including, but not limited to, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 1.0 mg/kg, 1.5 mg/kg, 2.0 mg/kg, 2.5 mg/kg, 3.0 mg/kg, 3.5 mg/kg, 4.0 mg/kg, 4.5 mg/kg, and 5.0 mg/kg, all of which are kg of patient body weight.
  • Intravenous doses can be several orders of magnitude lower.
  • the therapeutically effective amount of any compound or pharmaceutical composition provided herein is administered in 1 to 800 doses.
  • the therapeutically effective amount of the compound or pharmaceutical composition has a concentration of compound of at or between 0.01 mg/kg of patient body weight to 1 mg/kg of patient body weight.
  • the therapeutically effective amount (e.g, administered to the individual) of any compound or pharmaceutical composition provided herein is from about 0.01 mg/kg/day up to about 1,000 mg/kg/day.
  • the therapeutically effective amount (e.g, administered to the individual) of any compound or pharmaceutical composition provided herein is about 1 pg/dose to about 10 mg/dose.
  • the therapeutically effective amount (e.g, administered to the individual) of any compound or pharmaceutical composition provided herein is about 50 pg/dose to about 5 mg/dose. In some embodiments, the therapeutically effective amount (e.g, administered to the individual) of any compound or pharmaceutical composition provided herein (e.g, SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, etc.) is about 0.01 nmol/kg/dose to about 10 ng/kg/dose.
  • the therapeutically effective amount (e.g, administered to the individual) of any compound or pharmaceutical composition provided herein is about 0.1 nmol/kg/dose to about 5 ng/kg/dose.
  • the total therapeutically effective amount of the compound can be administered in single or divided doses and can, at the practitioner’s discretion, fall outside of the typical range given herein.
  • a therapeutically effective amount of any compound or pharmaceutical composition provided herein is administered once or twice weekly.
  • a therapeutically effective amount of any compound or pharmaceutical composition provided herein is administered once weekly.
  • a therapeutically effective amount of any compound or pharmaceutical composition provided herein is administered twice weekly.
  • the effective amount of an X-Y-Z conjugate can be administered by any suitable route.
  • An example of a suitable route is by injection, such as subcutaneous injection.
  • Other examples of suitable routes are parenterally and enterally.
  • a method of treating a bone fracture in a patient comprises administering (e.g, subcutaneously) to the patient a therapeutically effective amount of a compound (e.g, having a structure of Formula (I)) or a pharmaceutical composition provided herein, thereby treating the bone fracture in the patient.
  • a compound e.g, having a structure of Formula (I)
  • a pharmaceutical composition provided herein
  • administration of the therapeutically effective amount of the compound or pharmaceutical composition provided herein results in a reduction of pain in the patient within 2-3 weeks following administration. In some embodiments, administration of the therapeutically effective amount of the compound or pharmaceutical composition provided herein results in a reduction of pain in the patient within 3 weeks following administration.
  • the patient e.g, in need thereof
  • the patient is susceptible to a bone fracture.
  • the patient can have one or more comorbidities selected from the group consisting of mellitus, osteoporosis, a maxillofacial injury (e.g, a maxillofacial fracture), a maxillofacial deficiency, and a maxillofacial defect.
  • Methods for promoting bone growth in a patient comprise administering (e.g, subcutaneously) to the patient a therapeutically effective amount of a compound (e.g, having a structure of Formula (I)) or a pharmaceutical composition provided herein, thereby increasing a bone mineral density in a bone of the patient as compared to pre-treatment.
  • a compound e.g, having a structure of Formula (I)
  • a pharmaceutical composition provided herein, thereby increasing a bone mineral density in a bone of the patient as compared to pre-treatment.
  • the increased bone mineral density in the bone occurs at a fracture site.
  • the increased bone mineral density in the bone occurs at one or more resorption pits (e.g, where the patient is experiencing osteoporosis) present in the bone prior to the administering step.
  • the patient has diabetes mellitus.
  • the patient has diabetes mellitus and X is abaloparatide (SEQ ID NO: 2), SEQ ID NO: 7, SEQ ID NO: 8 (a conjugate with 10 glutamic acid residues), a derivative (e.g, one or more amino acid mutations, such as insertions, deletions, and substitutions with a naturally occurring amino acid or a non- naturally occurring amino acid) thereof having bone anabolic activity, or a fragment thereof having bone anabolic activity.
  • the patient has osteoporosis.
  • the patient has osteoporosis and X of Formula (I) is a parathyroid hormone, a derivative (e.g. , one or more amino acid mutations, such as insertions, deletions, and substitutions with a naturally occurring amino acid or a non-naturally occurring amino acid) thereof having bone anabolic activity, or a fragment thereof having bone anabolic activity.
  • a derivative e.g. , one or more amino acid mutations, such as insertions, deletions, and substitutions with a naturally occurring amino acid or a non-naturally occurring amino acid
  • the patient has a maxillofacial injury, such as, for example, a microplate stabilized mandibular osteotomy (i.e. a maxillofacial fracture).
  • the patient can have a defect filled with a bone graft (e.g., osseointegration), a prosthetic implant (e.g, plate, screw, and/or osseointegration), or a physician-induced bone defect (e.g, mandibular osteotomy, cranial defect, or a defect with graft).
  • the patient has a maxillofacial deficiency.
  • the method can further comprise administering a second therapy to the patient for treating the bone fracture (e.g, pain medication, bone grafts, implants (e.g, mesh), growth hormone and the like) or one or more comorbidities of the patient.
  • a second therapy can comprise administering a therapeutically effective amount of insulin to the patient.
  • administering the second therapy can comprise implantation of hardware (e.g, mesh or pins) or one or more therapeutic compounds at a bone fracture site.
  • the targeting ligands of certain compounds provided herein can accumulate with different specificities at the femur fracture site (see Fig. 2B).
  • Z of Formula (I) comprises hydroxyapatite targeting ligands
  • tetracycline, mono-bisphosphonate, polyphosphate and (L)Asp8 an acidic oligopeptide consisting of eight L-aspartic acids labeled with 125 I-tyrosine and injected intravenously into fracture-bearing mice accumulate with different specificities at the femur fracture site (Fig. 2B).
  • the selectivity ratio of 125 I-labeled tetracycline in the fractured to healthy femur is 2.6, which is significant because it supports the development of a drug that elicits its anabolic effect primarily at the fracture site instead of throughout the skeleton.
  • the fractured-to-healthy ratio continuously increases as the tetracycline ligand (Z of Formula (I)) was exchanged for alendronate, polyphosphate, and/or an acidic octa-aspartic acid.
  • octa-aspartic acid has the highest specificity (e.g, of the ligands tested) for fractured over healthy bone with a selectivity ratio of 11.2.
  • tetracycline has the highest specificity (e.g, of the ligands tested for Z of Formula (I)) for fractured over healthy bone with a selectivity ratio.
  • mono-bisphosphonate and polyphosphate exhibit reduced specificity for fractured bone.
  • mono-bisphosphonate and polyphosphate peptide-targeting abilities are compared with more specific osteotropic ligands.
  • aN-terminal 34 amino acids of PTHrP (SEQ ID NO: 1) is labeled with 125 I and tethered to a mono-bisphosphonate (e.g, alendronate), a tri -bisphosphonate (e.g, comprising of three alendronates attached to a central hub (Fig. 12)), a polyphosphate (e.g, consisting of 45 phosphates connected by anhydride linkages), or a deca-aspartic acid (e.g, similar to the octa-aspartic acid described herein).
  • Fig. 3A is a graph of tissue vs. percent injected dose/g.
  • the mono-bisphosphonate (e.g, alendronate) as the targeting ligand (e.g, Z of Formula (I)) enables delivery of an (e.g., moderate) amount of 125 I- SEQ ID NO: 1 (1- 34) to the fracture site.
  • the mono-bisphosphonate (e.g, alendronate) as the targeting ligand (e.g, Z of Formula (I)) has a specificity of about 2: 1 for broken bone over healthy bone (Fig. 3C).
  • Fig. 3C Provided in some instances herein, such as, for example Fig. 3C (e.g, a graph of conjugate vs. fractured/healthy femurs ratio), is the selectivity ratio of the fracture callus and the contralateral healthy femur targeted with a compound or composition described herein (e.g. , SEQ ID NO: 1).
  • a compound comprising one or more alendronate (e.g, at least one alendronate, at least two alendronate, at least three alendronate, or more).
  • a compound provided herein e.g, comprising three alendronates
  • a compound provided herein e.g, a polyphosphate
  • a compound provided herein e.g, an AOP (e.g, comprised of 10 aspartic acids)
  • AOP e.g, comprised of 10 aspartic acids
  • Fig. 3B mono-bisphosphonates
  • the bone fracture accumulation of targeted compound e.g, SEQ ID NO: 1
  • free compound e.g, SEQ ID NO: 1
  • an AOP described herein delivers an attached anabolic peptide described herein (e.g, X of Formula (I)) to a fracture surface.
  • (1) chemical characteristics of payload, (2) AOP side chain structure, (3) AOP length, (4) AOP branching, and/or (5) AOP stability affects the ability of an AOP to deliver an attached anabolic peptide to a fracture surface.
  • the characteristics of a therapeutic payload described herein e.g., size, charge, and hydrophobicity
  • CK2.3 e.g, a cationic peptide with a net charge of +5
  • ODP osteopontin-derived peptide
  • CTC chemotactic cryptic peptide
  • P4 e.g, a hydrophobic peptide with a hydrophobicity index (GRAVY) of 0.49 is the therapeutic payload.
  • F109 e.g.
  • the therapeutic payload is provided in Table 1.
  • the bone anabolic peptide is attached to L-Aspw, radiolabeled with iodogen 125 I (e.g, and injected into mice with fractured femurs and allowed to circulate for 18 hours before evaluation for tissue biodistribution).
  • the chemical properties of the peptides exerted little impact on the ability of L-Aspw to target them to fracture surfaces (see Fig. 4).
  • the 39-amino acid PACAP differed somewhat from the other anabolic peptides in fracture targetability.
  • neither payload size nor other major chemical/physical variables exerts a consistent impact on AOP-mediated bone targeting e.g., because a peptide of similar length (CK2.3) displayed no reduction in fracture accumulation.
  • other anabolic cargoes seem to target similarly (e.g., suggesting that an attached AOP may dominate the biodistribution of peptidic cargoes).
  • the interaction of an AOP described herein with a bone fracture surface is mediated by its interaction with exposed calcium.
  • calcium can chelate when the proximal anionic charges are separated by a distance of 8.6 A. Recognizing that the lengths of the anionic side chains of the AOPs could determine this separation distance between negative charges, the targeting abilities of aspartic acid, glutamic acid and aminoadipic acid were compared, where the side-chain carboxyls extend from the peptide backbone by one, two, and three carbons, respectively, allowing an increasing separation between the anionic charges of the oligopeptide side chains.
  • Fig. 6 shows a graph of tissue vs. percent injected dose/gram (e.g., which shows the biodistribution of radio-iodinated CK2.3 coupled to linear chains of 10 (L) aspartic acids, 10 (L) glutamic acids, or 10 (L) aminoadipic acids relative to untargeted CK2.3).
  • deca-glutamic and deca-aspartic acids exhibited the greatest uptake at the fracture site (e.g., with 6 times more accumulation than the nontargeted Ck2.3, and with aminoadipic acid promoting bone fracture retention not significantly different from nontargeted Ck2.3) (Fig. 6).
  • an AOP comprised of either glutamic or aspartic acids constitutes a peptide with optimal charge separation for calcium binding (e.g., explaining the branched peptide’s reduction in binding).
  • Fig- 7 shows a graph of tissue vs. percent injected dose/g, which shows the biodistribution of radio-iodinated CK2.3 coupled to linear chains of 10 or 20 (L) glutamic acids relative to untargeted CK2.3.
  • CK2.3 tethered to the longer oligo-glutamic acid accumulates (e.g., 3.3 times) more at the fracture site than the shorter oligo-glutamic acid. While the affinities of unconjugated acidic oligopeptides seem to maximize at chain lengths of only 8 amino acids (see, e.g., Sekido et al., “Novel drug delivery system to bone using acidic oligopeptide: pharmacokinetic characteristics and pharmacological potential,” doi.org/10.3109/10611860108997922 (2001)), the observed increased affinity of the 20-mer over 10-mer observed could have arisen because more extensive binding to hydroxyapatite is required to retain a payload of the size of CK2.3 at the fracture surface. The improved localization of the CK2.3 payload with the 20-mer may also be in part due to a relative reduction in steric hinderance from the payload on the targeting ligand.
  • acidic oligopeptides are not readily orally bioavailable (see, e.g., Shaji et al., “Oral protein and peptide drug delivery,” Indian J. Pharmaceutical Sci. 70: 189-200 (2005)); however, in some instances, frequent injection discourages patient compliance and, thus, can be problematic.
  • a long-lasting (e.g., injectable) formulation is provided in some instances herein.
  • the affinities of acidic oligopeptides comprised of D- and L-amino acids for hydroxyapatite hare similar (Sekido et al. (2001), supra).
  • a linear oligo-glutamate chain composed of (e.g., poorly- metabolizable) D-glutamic acids (e.g., rather than a readily digestible chain comprised of L- glutamic acids) provided longer drug retention at the fracture surface.
  • D-glutamic acids e.g., rather than a readily digestible chain comprised of L- glutamic acids
  • the abilities of the D and L enantiomers of glutamic acid 20-mers to accumulate and persist at the fracture site were compared herein.
  • Fig. 8 shows a graph of tissue vs. percent injected dose/g, which represents the biodistribution of radio-iodinated CK2.3 coupled to linear chains of 20 L- or D-glutamic acids relative to untargeted CK2.3.
  • the D enantiomer of Glu2o accumulated 4.7 times more than the L enantiomer at the fractured femur and 91.9 times as much as the nontargeted CK2.3.
  • the fluorescent dye, SO456 was attached to both D an L enantiomers of Aspio peptides (see Fig. 9). The accumulation of the differently labeled enantiomeric chains in both fractured and healthy contralateral femurs was quantified.
  • Fig. 9 is a graph of hours post-injection vs. pg dye/mg tissue, which shows the accumulation of S0456 (near-IR fluorophore) coupled to linear chains of 10 L- or D-aspartic acids in ND-4 Swiss-Webster mice bearing midshaft femur fractures 10 days post-fracture at different time points post-injection.
  • S0456 near-IR fluorophore
  • the accumulation of the labeled compounds in the healthy (e.g. , undamaged contralateral femur) and the broken femur were quantified as the amount of labeled dye that was extracted from dissolved femurs post-mortem.
  • the retention half-life of Aspio was estimated to be ⁇ 35 hours, whereas that of (D)Aspw was projected to be over 100 hours.
  • the difference was slightly smaller than that detected with radiolabeled peptide payloads, which may be due to the shorter half-life of the peptide payloads relative to the fluorescent payload.
  • the enhanced stability resulted in prolonged clearance through the kidneys, for example, which may be because the slowly degradable D-isomer released more slowly from the bone and other tissues than the L- isomer.
  • SPECT/CT imaging of both oligopeptides is performed and their biodistributions are visually examined.
  • Fig. 11A is a single-photon emission computer tomography /computed tomography (SPEC/CT) image of the Tc chelator EC20 chelating 99Tc linked to DE10 acid (structure of EC2O(D)Gluio chelating 99Tc is shown in Fig. 11D) and Fig.
  • SPEC/CT single-photon emission computer tomography /computed tomography
  • FIG. 11B is a SPEC/CT image of the Tc chelator EC20 chelating 99Tc linked to DE20 acid. As shown in Figs. 11A and 11B, both acidic oligopeptides yielded highly resolved images with the targeted radio-imaging agents almost exclusively concentrated at the fracture site. Signal to volume ratios were greater than 10-fold higher in the fracture than in other adsorption sites such as the growth plates. Still, in some instances, the adsorption to the growth plates may limit patients to adults.
  • DE20 exhibited the greatest fracturetargeting capacity of all ligands tested herein, and the DE20 oligopeptide displayed the greatest selectivity for fracture sites (e.g., of all targeting ligands tested herein).
  • Fig. 13 shows a graph of the agents tested (compounds comprising SEQ ID NO: 3, 5, 6, or 7 as compared to saline and insulin (controls)) vs. bone volume (BV).
  • max load represents the maximum force the healed femur withstood before it refractured in a post-mortem four-point bend analysis.
  • max load is a measure of how strong the bone is at the site of fracture repair.
  • work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a post-mortem four-point bend analysis.
  • work to fracture is a measure of how strong the bone is at the site of fracture repair.
  • post-yield displacement is a measure of how brittle a bone is (e.g, diabetes typically makes the bone more brittle).
  • a compound provided herein reduced the brittleness of bone (e.g, Fig. 17).
  • Fig. 18 is a graph of days vs. blood sugar (mg/dl), which shows the average blood sugar levels of the type I diabetic mice during the four-week treatment period of compounds comprising SEQ ID NO: 3, 5, 6, or 7 (and the insulin and saline controls).
  • longitudinal tracking of blood sugar of the different treated groups showed that only insulin had a significant impact on hyperglycemia, such as, for example, suggesting that the effect of a compound provided herein is not through blood sugar metabolism.
  • the attachment of a targeting ligand to SEQ ID NO: 5’s C-terminus interferes with SEQ ID NO: 5’s glucose-modulating effects.
  • the micro-CT scans of the callus illustrated that all the treatments except for SEQ ID NO: 7 favored an endochondral ossification.
  • Fig. 19 is a graph of days vs. average % change in body mass, which shows the mean weight change for the type I diabetic fracture mice treated groups throughout treatment.
  • the saline mice lost weight (as is expected with diabetes), as did the mice treated with an agent comprising SEQ ID NO: 6 (a targeted conjugate of dasatinib (e.g, D10-ester-dasatinib)), for example, which exhibited some toxicity at higher doses.
  • SEQ ID NO: 6 improved strength without improving the callus mineralization (e.g, which may be due to its senolytic effects).
  • a compound provided herein is non-toxic (e.g, regarding gross weight changes). Furthermore, administration of a compound provided herein can improve mineralization and strength (e.g, even though the hyperglycemic state was not controlled for in any group except for the insulin-treated group). In some instances, hyperglycemia is toxic to stem cells.
  • agents hereof comprising SEQ ID NO: 4, 8, or 9 tested as compared to saline and insulin (controls) vs. bone volume
  • bone volume represents the bone volume of the 100 thickest micro-CT slides of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair.
  • BV/TV represents the bone volume divided by total volume of the 100 thickest micro-CT slides of the fracture callus and is a measure of how dense the bone is at the site of fracture repair.
  • the compounds provided herein improved mineralization of the callus (e.g, as compared to treatment with insulin alone). In some instances, such compounds increased fracture callus density (e.g, more so than insulin alone).
  • maximum force represents the maximum force the healed femur withstood before it refractured.
  • Fig. 22B displays a graph of agents (e.g, SEQ ID NO: 4, 8, or 9) tested in conjunction with insulin administration (compared to saline and insulin alone) vs.
  • Stiffness is a measure of Young's modulus of the healed femur in a postmortem 4-point bend analysis and can be a measure of how resistant a bone is to deformation.
  • a compound provided herein comprising, for example, abaloparatide (SEQ ID NO: 2 which is within SEQ ID NO: 3) and SEQ ID NO: 8) (e.g., significantly) improves strength compared to the insulin control.
  • a compound provided herein e.g, abaloparatide (SEQ ID NO: 2) and SEQ ID NO: 8) improves strength and mineralization more than insulin alone.
  • a compound provided herein improves the mineralization and density of the fracture callus (e.g, relative to saline (e.g, and more so than estrogen replacement)) (Figs.
  • bone volume represents the bone volume of the 100 thickest micro-CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair.
  • Fig. 23B is a graph of agents tested vs.
  • BV/TV bone volume/total volume
  • BV/TV represents the bone volume divided by total volume of the 100 thickest micro-CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair.
  • a compound provided herein improves strength of a femur (see, e.g., Figs. 24A-C).
  • max load represents the maximum force the healed femur withstood before it refractured.
  • work to fracture represents a measure of how strong the bone is at the site of fracture repair.
  • stiffness is a measure of Young's modulus of the healed femur in a postmortem 4-point bend analysis and can be used as a measure of how resistant a bone is to deformation.
  • a compound provided herein improves the healing of fracture femurs (e.g. , in a hypoestrogenic state described herein (e.g. , far better than controlling the loss of estrogen with estrogen replacement).
  • a compound provided herein is administered to osteoporotic patients with bone fractures.
  • Fig. 25 is a graph of agents (comprising, for example, SEQ ID NO: 3, 6, 7 or 10) tested (as compared to saline or estrogen as controls) vs. serum calcium concentration (mg/dl), which shows the effect of 21 days of treatment on serum calcium in a Swiss Webster mouse with a midshaft femur fracture model.
  • a targeted anabolic described herein e.g. , as opposed to free anabolics
  • targeted anabolics hereof can limit the effects on the regulation of calcium metabolism that occurs in the kidneys for parathyroid hormones.
  • elevated accumulation of SEQ ID NO: 4 at the fracture site improves fracture healing (e.g, Figs. 26-30).
  • femur fracture healing times following administration of a starting dose calculated by allometric scaling of the human dose prescribed for abaloparatide (SEQ ID NO: 2) treatment of osteoporosis are compared.
  • CT images show that bone deposition imaged three weeks after initiation of treatment with nontargeted abaloparatide is concentrated on the periphery of the fracture, with minimal density bridging the opposing calluses (see, e.g, Fig. 35).
  • bone density is distributed (e.g., more) evenly across the fractured area subsequent to administration of a compound provided herein (e.g, with the overall size of the callus also exceeding that in the abaloparatide-treated mice).
  • Bone morphometric analyses confirmed a 1.5-fold increase in the ratio of mineralized volume (bone volume; BV) to total bone volume (total volume; TV) in the SEQ ID NO: 4-treated mice.
  • the force to fracture in the SEQ ID NO: 4-treated mice exceeded that required to fracture the contralateral healthy femurs in the same mice or similar, unmodified femurs in saline-treated mice. This suggests the repaired femurs at this time point were 30% stronger than the original unbroken femurs.
  • the work to fracture e.g. , in similar mechanical studies was averaged 3.5-fold higher in the SEQ ID NO: 4-treated femurs than in the abaloparatide-treated femurs (Fig. 33) of mice with midshaft femoral factures.
  • SEQ ID NO: 4 is more effective (e.g, at improving bone healing) than SEQ ID NO: 3.
  • SEQ ID NO: 3 While SEQ ID NO: 3, in some instances, is better than abaloparatide, its clinical relevance may be dramatically improved if patients required fewer doses.
  • the length of the targeting oligopeptide was increased to determine if it increased the drug’s affinity for broken bone sufficiently that retention of the anabolic pay load at the fracture site would be prolonged and less frequent dosing may be required.
  • Mice were doses once every three days, rather than daily. Visual inspection of CT scans revealed that more bone is deposited at three weeks post-fracture in mice treated with targeted abaloparatide vs. non-targeted abaloparatide. When comparing the maximum load achieved before breakage by abalode 10 vs. abalode 20, the trend demonstrated 20-30% greater strength.
  • Fig. 34 is a graph of treatment (saline, SEQ ID NO: 3 (0.1 nmol/mg (O.lx), 1 nmol/mg (lx), and 10 nmol/mg (lOx), and SEQ ID NO: 4 (0.1 nmol/mg (O.lx), 1 nmol/mg (lx), and 10 nmol/mg (10x)) vs. max load (N) of mice with midshaft femoral factures.
  • Percent (%) sequence identity with respect to a reference to a sequence is defined as the percentage of amino acid or nucleic acid residues, respectively, in a candidate sequence that are identical with the residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill of the art, for instance, using publicly available computer software.
  • determination of percent identity or similarity between sequences can be done, for example, by using the GAP program (Genetics Computer Group, software; now available via Accelrys on http://www.accelrys.com), and alignments can be done using, for example, the ClustalW algorithm (VNTI software, InforMax Inc., Gaithersburg, MD).
  • a sequence database can be searched using the nucleic acid or amino acid sequence of interest. Algorithms for database searching are typically based on the BLAST software (Altschul et al., 1990), but those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • the percent identity can be determined along the full-length of the nucleic acid or amino acid sequence.
  • certain compounds of the present disclosure can contain “optionally substituted” moieties.
  • substituted whether preceded by the term “optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent.
  • an “optionally substituted” group can have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent can be either the same or different at each position.
  • Combinations of substituents envisioned are preferably those that result in the formation of stable or chemically feasible compounds.
  • administering includes the individual administering the therapeutic agent to themselves, as well as a medical professional administering the therapeutic agent to the individual.
  • radical refers to a fragment of a molecule, wherein that fragment has an open valence which is an attachment point for bond formation.
  • a monovalent radical has one open valence such that it can form one bond with another chemical group.
  • a radical of a molecule e.g, a radical of a folate receptor binder
  • a radical is created by removal of one hydrogen atom from that molecule to create a monovalent radical with one open valence at the location where the hydrogen atom was removed.
  • a radical can be divalent, trivalent, etc., wherein two, three or more hydrogen atoms have been removed to create a radical which can bond to two, three, or more chemical groups.
  • a radical open valence can be created by removal of other than a hydrogen atom (e.g. , a halogen atom), or by removal of two or more atoms (e.g. , a hydroxyl group), as long as the atoms removed are a small fraction (about 20% or less of the atom count) of the total atoms in the molecule forming the radical.
  • a hydrogen atom e.g. , a halogen atom
  • two or more atoms e.g. a hydroxyl group
  • treat include reducing, alleviating, abating, ameliorating, relieving, or lessening the symptoms associated with a bone fracture, diabetes, osteoporosis in either a chronic or acute therapeutic scenario.
  • All payloads (e.g., Fig. 1A) were synthesized in a solid-phase peptide synthesis vial under a stream of argon.
  • Wang resin (0.6 mmol/g) was loaded with 3-fold excess of the first amino acid (cysteine), HOBt-Cl and DIC for 4 hours in 9: 1 v/v CFECn/dimethylformamide (DMF) using catalytic amounts of 4-dimethylaminopyridine (DMAP).
  • DMF 4-dimethylaminopyridine
  • the resin was then capped with two equivalents of acetic anhydride and pyridine for 30 minutes to block any unreacted hydroxyl groups on the resin. These steps were followed by three washes with methylene chloride (DCM) and DMF, consecutively.
  • DCM methylene chloride
  • tyrosine or the peptide sequence shown in Table 1 was added onto the peptide using the solid-phase procedures listed above using an automated peptide synthesizer (Focus XC, AAPPTec). Upon synthesis completion, the terminal Fmoc was removed using the aforementioned conditions, after which the resin was washed three times with DMF, three times with DCM, and twice with methanol, and then dried with argon gas. [0277] The dried resin with the peptide was cleaved using 95:2.5:2.5 trifluoroacetic acid/water/triisopropylsilane and excess TCEP for 2 hours.
  • the peptide was then precipitated from the cleavage solution using 10 times the volume of cold diethyl ether. The solution was spun at 2,000 relative centrifugal force (RCF) for five minutes and then decanted. The pellet was then desiccated and submitted to analytical liquid chromatography-mass spectrometry (1220 LC; 6130 MS, Agilent) for confirmation of synthesis.
  • the crude peptide was dissolved in a mixture of DMF and water and purified via preparative reversed-phase high-performance liquid chromatography (1290, Agilent, Santa Clara, CA).
  • TMP 2,2,6,6-tetramethylpiperidine
  • Targeting ligand peptides were all synthesized to achieve the appropriate length, amino acid composition and enantiomeric stereochemistry, as indicated by their names according to the solid phase synthesis methods described above. While still on the resin, the N-terminal amines were deprotected as described above, and the resin was reacted in DMF with 3-fold maleimide propionic acid, 3-fold excess benzotriazol- 1-yloxytripyrrolidinophosphonium hexafluorophosphate (PYBOP), HOBt-Cl and 5-fold excess N,N-diisopropylethylamine (DIPEA) for 4 hours.
  • PYBOP 3-fold maleimide propionic acid
  • HOBt-Cl 3-fold excess benzotriazol- 1-yloxytripyrrolidinophosphonium hexafluorophosphate
  • DIPEA 5-fold excess N,N-diisopropylethylamine
  • the peptides were then coupled to the cysteine-containing peptides using maleimide chemistry in phosphate-buffered saline (PBS) containing 10-fold excess tris(2- carboxyethyl)phosphine (TCEP) for 24 hours at room temperature.
  • PBS phosphate-buffered saline
  • TCEP tris(2- carboxyethyl)phosphine
  • branched targeting ligands were synthesized using solid-phase peptide synthesis under a stream of argon.
  • 2-chlorotrityl resin (0.6 mmol/g) was loaded at 0.6 mmol/g with Na,Ne- di-Fmoc-L-lysine for 60 minutes in DCM and DIPEA.
  • the resin was then capped with four washes of MeOH, followed by three washes with DCM and DMF, consecutively.
  • the branched chain was then synthesized as described above.
  • the N-terminal Fmoc was retained and the peptide was subjected to a soft cleavage in 1 : 1:8 mixture of acetic acid/tetrafluoroethylene (TFE)ZDCM for 30 minutes.
  • TFE acetic acid/tetrafluoroethylene
  • the cleavage solution was evaporated under reduced pressure and the terminal carboxylic acid was conjugated with 3-fold excess N-(2-aminoethyl)maleimide, 3-fold excess PYBOP and HOBt-Cl and 5 -fold excess DIPEA in DCM for 4 hours.
  • the acid-sensitive protecting groups were then deprotected by a two-hour incubation in 95:2.5:2.5 trifluoroacetic acid/water/triisopropylsilane.
  • the peptide was then precipitated with 10 volumes of cold diethyl ether, and the terminal Fmoc was deprotected by a 15-minute incubation with 20% (v/v) piperidine in DMF followed by a precipitation in cold diethyl ether.
  • the resulting crude product was purified via preparative reversed-phase high-performance liquid chromatography (1290, Agilent) as described above. Finally, the purified targeting ligand was conjugated with different payloads via maleimide coupling also as described above.
  • the resulting crude product was purified via preparative reversed-phase high-performance liquid chromatography (1290, Agilent, Santa Clara, CA) and the purified targeting ligand was conjugated with different pay loads via maleimide coupling as described above.
  • the structure of a tri-bisphosphonate is shown in Fig. 12.
  • R can represent any peptide or small molecule.
  • a phosphate glass polymer of 45 phosphates was dissolved in lOOmM MES at a concentration of lOmM. Sufficient EDC was then added to achieve a 100 mM concentration, and then three equivalents of DIPEA followed by five equivalents of N-(2-aminoethyl)-maleimide were added. The purified targeting ligand was conjugated with different payloads via maleimide coupling as described above.
  • m Tc chelators linked to D-GIU20 (DE20) and D-Gluw (DE10) were synthesized via standard Fmoc solid-phase peptide synthesis as described previously.
  • Wang resin loaded with Fmoc cysteine (TRT) was coupled to Fmoc aspartic acid (OtBu) then to A / “-Boc-A /
  • This chelator was then coupled via standard amide chemistry to 8-(Fmoc-amino)-3,6-dioxaoctanoic acid, which was then conjugated via standard amide coupling to a linear oligopeptide of either 10 or 20 D-glutamic acids.
  • the oligopeptide was then cleaved and purified as described previously.
  • a maleimide derivative of the near-infrared (NIR) fluorescent dye, S0456 was prepared for use in labeling of the bone fracture targeting ligands described above. It was synthesized as shown in Scheme I (below). For this purpose, S0456, N-Boc-tyramine and potassium hydroxide (KOH) were mixed in a flask containing dimethylsulfoxide (DMSO) to dissolve solids and the solution was stirred at 60 °C under argon for 1.2 hours. The resulting solution was precipitated with cold ethyl acetate and, after vigorous agitation, was centrifuged at 3,000 rpm for 3 minutes.
  • NIR near-infrared
  • Scheme I Synthesis of (L)Aspio-SO456 conjugate. Reagents and conditions: A) S0456-C1, DIPEA, DMSO, 60 °C; B) 40% TFA/DCM, rt; C) N-succinimidyl 3-maleimidopropionate, DIPEA, DMSO, rt; D) Aspio-Cys, DMSO.
  • Aseptic surgical techniques were used to insert a 23-gauge needle as an intramedullary nail into the femur of anesthetized 12-week-old female ND-4 Swiss-Webster age-matched mice for internal fixation on the bone prior to its fracture. No difference in targeting capacity was seen between inbred strains such as C57/BL6 and Swiss-Webster ND-4 mice. Briefly, the mouse hair surrounding the right knee of the hind paw was removed and the animal was anesthetized using 3% isoflurane with an anesthesia vaporizer (VetEqip, Livermore, CA). The skin was then cleaned with a scrub of betadine followed by a scrub of 70% ethanol.
  • L-Aspio- S0456 or D-Aspio-SO456 was dissolved in PBS, sterile filtered, and injected 10 days post-fracture subcutaneously to achieve a final dose of 250 nmol/mouse. Mice were then euthanized at 2, 24, 48, 72, and 96 hours post-injection, and fluorescence was quantified at the fracture site by resecting and dissolving the fracture callus in a 12% solution of neutral buffered ethylenediaminetetraacetic acid (EDTA).
  • EDTA neutral buffered ethylenediaminetetraacetic acid
  • the glass test tubes were sealed and placed on a shaker for 30 minutes and then purified via radio preparative reversed- phase high-performance liquid chromatography (1260 HPLC; Agilent Flow-RAM radiodectector, Lablogic Systems Ltd, Sheffield, UK) with a 0-100% gradient of 0.1% TFA in water: acetonitrile. Fractions with the correct retention time and radio signal were isolated and lyophilized. Payload peptides were radio-iodinated on endogenous tyrosine, tryptophan, or histidine residues, which remain stable in physiological conditions for the longest iodinated experiments (27 hours) (see Savoie et al., “Studies on mono- and diiodohistidine. I. The identification of iodohistidines from thyroidal iodoproteins and their peripheral metabolism in the normal man and rat,” J. Clin. Invest. 52: 106-115 (1973)).
  • m Tc labeling 0.6 mg of EDTA disodium dihydrate dissolved in nitrogen-sparged water (10 mg/ml) was added to 50 mg of sodium gluconate solution (100 mg/ml) in nitrogen- sparged water. To that mixture, a solution of 0.2 mg of tin chloride dihydrate (lOmg/ml) dissolved in nitrogen-sparged 0.2N HC1 was added. Then 4 pmol of " m Tc chelate-containing peptides were added to the solution, and the pH was adjusted to 6.8 using NaOH (Leamon et al. (2002), supra). The solution was flash-frozen in liquid nitrogen and lyophilized overnight.
  • mice were dissolved in PBS and injected subcutaneously into mice 10 days after induction of a midshaft femur fracture to ensure that blood flow had returned to the area.
  • Each mouse received a 0.25 mCi (12.5 nmol of peptide in 0.1 mL vehicle) dose of radio-iodinated peptide or 3 mCi (0.1ml) dose of " m Tc-labeled peptide, both administered subcutaneously. Eighteen hours later, blood was removed via cardiac puncture, and mice were sacrificed via CO2 asphyxiation.
  • Organs and tissues (heart, lungs, muscle, skin, liver, spleen, kidneys, fractured femur, and healthy femur) were resected and weighed, and their radioactivity was counted using a gamma counter (Cobra Auto-Gamma, Packard; GMI Corporation, Franklin, IN). Percent injected dose was calculated by:
  • Fractured to healthy ratio ——— — ; - — — - — — - — - — - — -
  • m Tc labeled D-Gluio-chelator and D-Glu2o-chelator were formulated to 7 mCi/100 .1 and injected via tail vein two weeks following femur fracture. After 18 hours, mice were euthanized via CO2 asphyxiation and imaged using a single-photon emission computer tomography/computed tomography (SPEC/CT) scanner (U-SPECT-II/CT, MiLabs, Houten, The Netherlands). CT images were collected using high-resolution, full-body, 12-minute scans and were followed by 1-hour SPECT scans using a 0.6 mm collimator. SPEC/CT images were reconstructed using the MiLabs software selecting the energy window of 140 keV and reconstruction parameters of 16 subsets and 4 iterations without post filter. 3-D reconstructions were performed using ImageJ software.
  • SPEC/CT single-photon emission computer tomography/computed tomography
  • Targeted conjugates of SEQ ID NO: 5, abaloparatide (SEQ ID NO: 2), SEQ ID NO: 6, and SEQ ID NO: 9 were synthesized using Fmoc solid-phase peptide synthesis. From SEQ ID NO: 5, amino acids 1-34 were used, and abaloparatide (SEQ ID NO: 2) is a stabilized version of amino acids 1-36 of SEQ ID NO: 1. Diabetes was induced in 40 8-week-old male CD-I mice via seven subcutaneous injections of streptozotocin (STZ) until blood sugar readings were above 250 mg/dL. The mice were left in this confirmed diabetic state for 2 months to allow the diabetes to take effect on the bones.
  • STZ streptozotocin
  • mice received buprenorphine for three days post-fracture. They were dosed subcutaneously with a positive control of insulin, a negative control of vehicle, SEQ ID NO: 5, or abaloparatide (SEQ ID NO: 2) each day for 4 weeks. Fracture healing was assessed qualitatively using micro-CT (Scanco Medical Ag).
  • Abaloparatide (SEQ ID NO: 2) is a stabilized version of parathyroid-related protein hormone. Dasatinib is an SRC kinase with off-target effects on both osteoblasts and osteoclasts that improve overall bone density. Dasatinib has also proven to be a senolytic. ITGA is a fibronectin mimetic that promotes intramembranous bone fracture healing. SEQ ID NO: 5 was included in this study because Preptin 1-16 had a moderate bone anabolic activity. It was also shown that the full-length compound (see Fig. 1A and Fig. IB) also improved glucose sensitivity.
  • glucose regulating properties of full-length SEQ ID NO: 5 may be beneficial in healing type I diabetic fractures as a dual-action compound that may improve healing via two mechanisms.
  • the compounds were compared against insulin as a positive control and saline as a negative control.
  • BV represents the bone volume of the 100 thickest micro-CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair.
  • BV/TV represents the BV divided by TV of the 100 thickest micro-CT slides of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. Insulin was dosed as 2 lU/day.
  • Doses of O.lx, 50x, and lOx are 0.1 nmol, 50 nmol, and 10 nmol, respectively, of the conjugate delivered daily by subcutaneous injection.
  • SEQ ID NO: 6 was dosed at 10 pmol/kg every other day.
  • Insulin was dosed at 2 lU/day. Doses of O.lx, 50x, and lOx, are 0.1 nmol, 50 nmol, and 10 nmol, respectively, of the conjugate delivered daily by subcutaneous injection. SEQ ID NO: 6 was dosed at 10 pmol/kg every other day.
  • Figs. 20A and 20B insulin was dosed at 2 lU/day and doses of O.lx, lOx, and lOOx, are 0.1 nmol, 10 nmol, and 100 nmol, respectively, of the conjugate delivered daily by subcutaneous injection.
  • SEQ ID NO: 8 improved the mineralization of the callus better than insulin, and all the experimental therapeutics led to increases in fracture callus density, more so than insulin alone.
  • Figs. 21A and 21B insulin was dosed at 2 lU/day and doses of O.lx, lOx, and lOOx, are 0.1 nmol, 10 nmol, and 100 nmol, respectively, of the conjugate delivered daily by subcutaneous injection.
  • the figures show no significant changes were observed in the trabecular bone.
  • Figs. 22A-22C insulin was dosed at 2 lU/day in all groups, except for saline.
  • Doses of O.lx, lOx, and lOOx are 0.1 nmol, 10 nmol, and 100 nmol, respectively, of the conjugate delivered daily by subcutaneous injection.
  • the figures show that abaloparatide (SEQ ID NO: 2) and SEQ ID NO: 8 significantly improved the strength compared to the insulin control. All significance levels were calculated relative to the insulin-treated group, not the saline control group. Overall, SEQ ID NO: 9 did not significantly improve fracture healing in diabetics. However, abaloparatide (SEQ ID NO: 2) and SEQ ID NO: 8 improved the strength and mineralization more than insulin alone, and they show promise as potential therapeutics.
  • Mice were anesthetized using 2-3% isoflurane. Buprenorphine (0.03mg/kg) was administered subcutaneously for postoperative pain relief A 3 cm x 2.5 cm area was shaved dorsally from the iliac crest. The area was washed with betadine followed by 70% ethanol and then draped. A 2-cm midline incision was made, and the skin was dissected from the underlying fascia. A 1-cm lateral incision of the midline was made through the fascia, reaching the abdominal cavity. The adipose tissue surrounding the ovary in the abdominal cavity was pulled back and gently pulled out.
  • the ovary was isolated and the uterine horns and vessels 0.5 cm proximally of this structure were ligated. The ovary was removed, and the process was repeated on the contralateral side. The peritoneal cavity was closed, followed by the skin using a monofilament suture. The mouse was placed in a clean recovery cage and allowed to awake from anesthesia. Mice were dosed every 12 hours with buprenorphine for 3-5 days. Osteoporosis was expected to develop within 4-6 weeks, at which point the mice underwent a stabilized femoral fracture, as described above.
  • Bone mineral density was measured before ovariectomy and eight weeks after ovariectomy to confirm development of osteoporosis. After 8 weeks of prolonged exposure to low estrogen levels, the mice had intermedullary nails placed in their femurs and then an Einhorn fracture model was induced via a drop weight and confirmed by X-ray. The mice were dosed daily for 4 weeks. The structural changes were quantified via micro-CT, and the mechanical properties were assessed via a 4-point-bend-to-failure test.
  • Dio-Cys was synthesized as follows. For the initial loading of the SPPS resin, 2-chlorotrityl chloride resin (0.4 g, 1.4 mmol/g) was swollen in DCM (10 mL/g resin) followed by the addition of Fmoc-L-Asp(OtBu)-OH (1.15 g, 2.8 mmol) and DIPEA (1.66 mL, 9.5 mmol) dissolved in DCM (14 mL).
  • the resin was then subjected to standard washing procedures, which consisted of washes with DMF (3 times), DCM (3 times), and IPA (3 times) following each coupling reaction, and washes with DMF (3 times) following each deprotection.
  • the 11-mer peptidic product was cleaved off the resin using a cleavage cocktail consisting of 90% TFA, 3.3% TIPS, 3.3% water, and 3.3% EDT. Following cleavage, the crude product was concentrated under reduced pressure to remove most TFA, water, TIPS, and EDT, and then washed 3x with Et20 and dried under reduced pressure for 24 hours to produce Dio-Cys 1 as a white powder (680 mg, 81.3% overall yield, 98.1% average coupling efficiency).
  • Dio-SO456 conjugate was synthesized as follows. S0456-maleimide (100 mg) was dissolved in 2 mL DMSO in a flask degassed with argon, followed by the addition of Dio-Cys to the solution with stirring. The mixture was stirred at room temperature for 2.5 hours before purification with prep-HPLC. The purified and lyophilized product appeared as a green fluffy solid (57 mg).
  • the serum was removed from the cell pellet and stored at -80°C until calcium concentration quantification.
  • the standard was diluted to 10 mg/dL Ca 2+ by mixing 125 pL 20 mg/dL standard and 125 pL dFLO.
  • a whole blood sample (5 pL) was transferred to a well.
  • 200 pL of working reagent were added, and the plate was tapped lightly to mix.
  • the samples were incubated for 3 minute at room temperature and optical density at 570-650 nm (peak absorbance at 612 nm) was read to obtain the ODSAMPLE.
  • 10 mg/dL standard (5 pL) was transferred to the sample well.
  • the plate was tapped to mix and optical density was measured at the same wavelength to get ODSTANDARD.
  • 5 pL of 20 mM EDTA were added to the same well from earlier and the plate was tapped to mix.
  • Optical density was read at the same wavelength measurement to get ODBLANK.
  • the whole blood sample concentration
  • [Ca2+] (ODSAMPLE - ODBLANK) / (ODSTANDARD - ODSAMPLE) x 10 x n (mg/dL)
  • ODSAMPLE, ODBLANK, and ODSTANDARD are the OD readings of the Sample, Sample Blank, and the Sample plus Standard respectively
  • 10 is the concentration of the standard in mg/dL
  • n is the sample dilution factor. If the calculated calcium concentration was greater than 10 mg/dL, the sample was diluted in dlLO and the assay was repeated. We then multiplied the result by the dilution factor n.
  • SEQ ID NO: 3 SEQ ID NO: 6, and SEQ ID NO: 7 had all repeatedly accelerated healing in healthy femur fractures, with abaloparatide (SEQ ID NO: 2) being a stabilized version of parathyroid-related protein hormone.
  • Dasatinib is an SRC kinase with off-target effects on both osteoblasts and osteoclasts that improve overall bone density. It has also been shown to be a senolytic.
  • ITGA is a fibronectin mimetic that promotes intramembranous bone fracture healing.
  • All targeted compounds, except for SEQ ID NO: 10 (a conjugate with 20 glutamic acid residues), improved the mineralization and density of the fracture callus relative to saline and more so than estrogen replacement (Figs. 23A-B).
  • estrogen benzoate was dosed at 30 pg/kg weekly. Doses of 0. lx, lx, and lOx are 0.1 nmol, 1 nmol, and 10 nmol, respectively, of the conjugate delivered daily by subcutaneous injection. SEQ ID NO: 6 was dosed at 10 pmol/kg every other day.
  • estrogen benzoate was dosed at 30 pg/kg weekly.
  • the doses 0. lx, lx, and lOx are 0.1 nmol, 1 nmol, and 10 nmol of the conjugate, respectively, delivered daily by subcutaneous injection.
  • SEQ ID NO: 6 was dosed at 10 pmol/kg every other day.
  • Targeted and free therapies improved BMD of the treated mice.
  • Other metrics will need to be evaluated to determine the benefit of targeted drugs in the treatment of osteoporosis by itself. If both are valid in improving, the targeted drug could still be desirable in terms of reducing side effects.
  • the free osteoporotic drugs are limited by their systemic side effects.
  • the parathyroid family in particular is limited by its effects on blood calcium. But as evidenced in Fig. 25, the targeted form of Forteo® (SEQ ID NO: 13) did not increase the blood calcium significantly in comparison to the free form.
  • Free PTH (targeted form of Forteo®) at 0.1 nmol was compared to targeted PTH (SEQ ID NO: 13) using saline as control. So even though osteoporosis is a systemic disease, there are advantages to using targeted anabolics as opposed to free anabolics, because targeted anabolics can limit the effects on the regulation of calcium metabolism that occurs in the kidneys for parathyroid hormones.
  • Fig. 29 shows graphs of agent vs. non-calcified area (mm 2 ) for defect and graft, and cranial defect, agent vs. percent migrated (%) for screw, agent vs. gap diameter (mm) for mandibular osteotomy, and agent vs. max load (N) for mandibular osteotomy.
  • mice were habituated to the behavior room for 30-60 minutes before testing locomotor activity. Animals were habituated once for 10 minutes to the locomotor boxes prior to the start of the experiment. They were then placed individually in a locomotor box with infrared light tracking beams for 10 minutes before being removed and placed back in their home cage. The mice were tracked via EthoVision using 3-point directionality testing. Mice were measured for two weeks prior to the experiment. They then underwent the midshaft femur fracture model and were assigned to one of three treatment groups: 1) abaloparatide DE20 twice a week; 2) phosphate buffered saline twice a week; or 3) ibuprofen (0.6 g/L) in their water. The mice were treated for 5 weeks post-fracture and measured once a week.
  • mice In their baseline state, all mice ran everywhere in their box — an indication that they felt fine. However, after the fracture, the mice treated with saline and ibuprofen preferred to stay on the edge and in the comer, which indicated that they were feeling unwell and anxious. The abaloparatide-treated mice returned to their previous state of well-being and ran everywhere. It is interesting that the ibuprofen mice did not improve their pain/function outcomes. Ibuprofen is known to inhibit bone fracture repair, so the analgesia received might be overcome by the decreased healing of the animal. However, the accelerated healing of the fracture by the SEQ ID NO: 4 mice did lead to more functionality and better well-being. Not only did the mice localize to regions that indicate they had better well-being, but they also quantitatively improved their functionality metrics in the locomotor portion of this test as shown in Figs. 26-28.
  • day 0 represents the baseline data pre-fracture.
  • Saline and SEQ ID NO: 4 (1 nmol) were injected twice/week.
  • Ibuprofen was administered constantly in the mice’s water at a concentration of 0.6 g/L.
  • Fig. 26 shows that the abaloparatide-treated mice began to run farther, whereas Fig. 27 shows that they began to run for longer periods of time and Fig. 28 shows that the abaloparatide- treated mice began to run faster. All these metrics indicate increased functionality and better performance, which indicates that the increase in structural and mechanical healing quantified via micro-CT and biomechanical testing also corresponds to improved functionality and reduced pain. These results exceed what reportedly has been seen with BMP treatment, i.e., that BMP does not improve pain or functionality, despite being approved for bone fracture repair. So, by dosing an animal with SEQ ID NO: 4, a targeted bone anabolic agent that returns bones to their previous unbroken strength between two and three weeks post-fracture, a reduction in pain can be realized by that time.
  • SEQ ID NO: 4 was subcutaneously injected into fracture-bearing mice. No significant differences were observed in either the circulation half-life (4.2 hours vs. 3.7 hours) or cumulative systemic exposure (AUC; 24.4 hours and 20 hours, respectively) of 125 I-labeled abaloparatide and SEQ ID NO: 4, indicating that any off-target exposure or resulting systemic toxicity should be similar between targeted and non-targeted drugs.
  • Fig. 30, is a graph of hours vs. percent injected dose in blood (cpm/g) of mice with midshaft femoral factures.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Endocrinology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Immunology (AREA)
  • Rheumatology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Toxicology (AREA)
  • Diabetes (AREA)
  • Physics & Mathematics (AREA)
  • Optics & Photonics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicinal Preparation (AREA)
PCT/US2021/047824 2020-10-26 2021-08-26 Compounds,compositions and methods of use to treat bone fractures Ceased WO2022093373A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
US18/033,665 US20230399374A1 (en) 2020-10-26 2021-08-26 Compounds, Compositions and Methods of Use to Treat Bone Fractures
MX2023004796A MX2023004796A (es) 2020-10-26 2021-08-26 Compuestos, composiciones y metodos de uso para tratar fracturas oseas.
CN202180087681.8A CN116801900A (zh) 2020-10-26 2021-08-26 用于治疗骨折的化合物、组合物和使用方法
EP21887113.5A EP4232074A4 (en) 2020-10-26 2021-08-26 COMPOUNDS, COMPOSITIONS AND METHODS OF USE FOR THE TREATMENT OF BONE FRACTURES
AU2021370296A AU2021370296A1 (en) 2020-10-26 2021-08-26 Compounds,compositions and methods of use to treat bone fractures
JP2023525002A JP2024506435A (ja) 2020-10-26 2021-08-26 化合物、組成物、および骨折を処置するための使用方法
CA3194776A CA3194776A1 (en) 2020-10-26 2021-08-26 Compounds,compositions and methods of use to treat bone fractures

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202063105669P 2020-10-26 2020-10-26
US63/105,669 2020-10-26
US202163193748P 2021-05-27 2021-05-27
US63/193,748 2021-05-27

Publications (1)

Publication Number Publication Date
WO2022093373A1 true WO2022093373A1 (en) 2022-05-05

Family

ID=81383093

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/047824 Ceased WO2022093373A1 (en) 2020-10-26 2021-08-26 Compounds,compositions and methods of use to treat bone fractures

Country Status (7)

Country Link
US (1) US20230399374A1 (https=)
EP (1) EP4232074A4 (https=)
JP (1) JP2024506435A (https=)
AU (1) AU2021370296A1 (https=)
CA (1) CA3194776A1 (https=)
MX (1) MX2023004796A (https=)
WO (1) WO2022093373A1 (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN117373681A (zh) * 2023-10-30 2024-01-09 中国航天科工集团七三一医院 一种基于血糖调节系统作用的骨折愈合仿真方法及系统
EP4274556A4 (en) * 2021-01-05 2024-12-11 Radius Health, Inc. Treatment of long bone fractures with abaloparatide
EP4232075A4 (en) * 2020-10-26 2024-12-18 Purdue Research Foundation Compounds,compositions and methods of use to treat spinal fusions
US12319721B2 (en) 2018-05-30 2025-06-03 Purdue Research Foundation Targeting anabolic drugs for accelerated fracture repair

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018102616A1 (en) * 2016-11-30 2018-06-07 Purdue Research Foundation Fracture targeted bone regeneration through parathyroid hormone receptor stimulation

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018102616A1 (en) * 2016-11-30 2018-06-07 Purdue Research Foundation Fracture targeted bone regeneration through parathyroid hormone receptor stimulation

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2883707A1 (en) * 2012-08-28 2014-03-06 The Governors Of The University Of Alberta Parathyroid hormone, insulin, and related peptides conjugated to bone targeting moieties and methods of making and using thereof
WO2019232285A1 (en) * 2018-05-30 2019-12-05 Purdue Research Foundation Targeting anabolic drugs for accelerated fracture repair
WO2022093374A1 (en) * 2020-10-26 2022-05-05 Purdue Research Foundation Compounds,compositions and methods of use to treat spinal fusions

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018102616A1 (en) * 2016-11-30 2018-06-07 Purdue Research Foundation Fracture targeted bone regeneration through parathyroid hormone receptor stimulation
US20200317745A1 (en) * 2016-11-30 2020-10-08 Purdue Research Foundation Fracture targeted bone regeneration through parathyroid hormone receptor stimulation

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12319721B2 (en) 2018-05-30 2025-06-03 Purdue Research Foundation Targeting anabolic drugs for accelerated fracture repair
EP4232075A4 (en) * 2020-10-26 2024-12-18 Purdue Research Foundation Compounds,compositions and methods of use to treat spinal fusions
EP4274556A4 (en) * 2021-01-05 2024-12-11 Radius Health, Inc. Treatment of long bone fractures with abaloparatide
CN117373681A (zh) * 2023-10-30 2024-01-09 中国航天科工集团七三一医院 一种基于血糖调节系统作用的骨折愈合仿真方法及系统
CN117373681B (zh) * 2023-10-30 2024-04-26 中国航天科工集团七三一医院 一种基于血糖调节系统作用的骨折愈合仿真方法及系统

Also Published As

Publication number Publication date
EP4232074A4 (en) 2025-03-05
AU2021370296A1 (en) 2023-06-22
CA3194776A1 (en) 2022-05-05
JP2024506435A (ja) 2024-02-14
AU2021370296A9 (en) 2024-09-12
MX2023004796A (es) 2023-07-18
EP4232074A1 (en) 2023-08-30
US20230399374A1 (en) 2023-12-14

Similar Documents

Publication Publication Date Title
US20230399374A1 (en) Compounds, Compositions and Methods of Use to Treat Bone Fractures
JP7059195B2 (ja) Ｐｔｈプロドラッグ
JP7434419B2 (ja) ピーク対トラフ比が小さいｐｔｈ化合物
EP4275677B1 (en) Dosage regimen for a controlled-release pth compound
CA2658511C (en) Use of fgf-18 compound to treat cartilage disorders
JP2023029957A (ja) 副甲状腺ホルモン受容体刺激を介する、骨折をターゲティングした骨再生
US20230390363A1 (en) Compounds, Compositions and Methods of Use to Treat Spinal Fusions
US7820179B2 (en) Pegylated PTH as PTH receptor modulators and uses thereof
NZ574216A (en) Treatment of cartilage disorders with fgf-18
CN110139665A (zh) 包含其中骨组织选择性肽与甲状旁腺激素(pth)或其片段结合的融合肽的药物组合物和生物材料
Low et al. An engineered dual function peptide to repair fractured bones
CN116801900A (zh) 用于治疗骨折的化合物、组合物和使用方法
EP2168602A1 (en) Site-specific pegylated linear salmon calcitonin derivatives
US20240156973A1 (en) Osteotropic compositions and uses thereof
CN116710068A (zh) 用于治疗脊柱融合的化合物、组合物和方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21887113

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3194776

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 202317028172

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2023525002

Country of ref document: JP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023007709

Country of ref document: BR

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021887113

Country of ref document: EP

Effective date: 20230526

ENP Entry into the national phase

Ref document number: 2021370296

Country of ref document: AU

Date of ref document: 20210826

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202180087681.8

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 112023007709

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230424