WO2022069942A2 - Methods for treating eye diseases using lipid binding protein-based complexes - Google Patents

Methods for treating eye diseases using lipid binding protein-based complexes Download PDF

Info

Publication number
WO2022069942A2
WO2022069942A2 PCT/IB2021/000674 IB2021000674W WO2022069942A2 WO 2022069942 A2 WO2022069942 A2 WO 2022069942A2 IB 2021000674 W IB2021000674 W IB 2021000674W WO 2022069942 A2 WO2022069942 A2 WO 2022069942A2
Authority
WO
WIPO (PCT)
Prior art keywords
binding protein
lipid binding
based complex
lipid
cer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2021/000674
Other languages
English (en)
French (fr)
Other versions
WO2022069942A3 (en
Inventor
Cyrille TUPIN
Jérôme MARTINEZ
Frédéric Lallemand
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Abionyx Pharma SA
Original Assignee
Abionyx Pharma SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Abionyx Pharma SA filed Critical Abionyx Pharma SA
Priority to US18/247,465 priority Critical patent/US20240000948A1/en
Priority to AU2021354095A priority patent/AU2021354095A1/en
Priority to EP21811456.9A priority patent/EP4221686A2/en
Priority to IL301769A priority patent/IL301769A/en
Priority to MX2023003877A priority patent/MX2023003877A/es
Priority to JP2023519881A priority patent/JP2023543498A/ja
Priority to CA3197168A priority patent/CA3197168A1/en
Priority to CN202180067629.6A priority patent/CN116322646A/zh
Priority to KR1020237014173A priority patent/KR20230079132A/ko
Publication of WO2022069942A2 publication Critical patent/WO2022069942A2/en
Publication of WO2022069942A3 publication Critical patent/WO2022069942A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/543Lipids, e.g. triglycerides; Polyamines, e.g. spermine or spermidine
    • A61K47/544Phospholipids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/10Dispersions; Emulsions
    • A61K9/127Synthetic bilayered vehicles, e.g. liposomes or liposomes with cholesterol as the only non-phosphatidyl surfactant
    • A61K9/1275Lipoproteins or protein-free species thereof, e.g. chylomicrons; Artificial high-density lipoproteins [HDL], low-density lipoproteins [LDL] or very-low-density lipoproteins [VLDL]; Precursors thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/56Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
    • A61K31/57Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of two carbon atoms, e.g. pregnane or progesterone
    • A61K31/573Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of two carbon atoms, e.g. pregnane or progesterone substituted in position 21, e.g. cortisone, dexamethasone, prednisone or aldosterone
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/56Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
    • A61K31/58Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids containing heterocyclic rings, e.g. danazol, stanozolol, pancuronium or digitogenin
    • A61K31/585Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids containing heterocyclic rings, e.g. danazol, stanozolol, pancuronium or digitogenin containing lactone rings, e.g. oxandrolone, bufalin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/12Cyclic peptides, e.g. bacitracins; Polymyxins; Gramicidins S, C; Tyrocidins A, B or C
    • A61K38/13Cyclosporins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0048Eye, e.g. artificial tears
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0048Eye, e.g. artificial tears
    • A61K9/0051Ocular inserts or implants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/08Solutions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/10Dispersions; Emulsions
    • A61K9/127Synthetic bilayered vehicles, e.g. liposomes or liposomes with cholesterol as the only non-phosphatidyl surfactant
    • A61K9/1271Non-conventional liposomes, e.g. PEGylated liposomes or liposomes coated or grafted with polymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00

Definitions

  • the vertebrate eye is a complex sensory organ consisting of multiple, distinct tissues, each having its own unique biochemical composition, structure, and physiological function. Key among these are the retina, lens, and cornea, working in concert to bring photons of light into the eye, focus them correctly on the retina, and convert their energy into electrochemical signals that are conveyed to the brain where, ultimately, they are processed into a coherent visual image.
  • Lipids and lipid-soluble compounds are essential constituents of the cells and tissues that comprise the eye, and defects in their synthesis, intracellular and extracellular transport, and turnover underlie a variety of significant, common, and often severely debilitating eye diseases. [0004] Diseases of the eye can have various causes, for example genetics, infection and aging.
  • Some eye diseases are associated with lipid accumulation in the eye or near the eye, for example, fish-eye disease, dry eye diseases, for example associated with Meibomian gland dysfunction or lacrimal gland dysfunction, blepharitis, uveitis, diseases of the cornea such as lipid keratopathy, dry macular degeneration (dry AMD), Stargardt disease and Leber’s idiopathic stellate neuroretinitis.
  • Lecithin cholesterol acyl transferase [0005] Lecithin cholesterol acyl transferase (LCAT) is an enzyme produced by the liver and is the key enzyme in the reverse cholesterol transport (RCT) pathway.
  • the RCT pathway functions to eliminate cholesterol from most extrahepatic tissues and is crucial to maintaining the structure and function of most cells in the body.
  • RCT consists mainly of three steps: (a) cholesterol efflux, i.e., the initial removal of cholesterol from various pools of peripheral cells; (b) cholesterol esterification by the action of lecithin:cholesterol acyltransferase (LCAT), preventing a re-entry of effluxed cholesterol into cells; and (c) uptake of high density lipoprotein (HDL)-cholesterol and cholesteryl esters to liver cells for hydrolysis, then recycling, storage, excretion in bile or catabolism to bile acids.
  • LCAT circulates in plasma associated with the HDL fraction.
  • LCAT converts cell-derived cholesterol to cholesteryl esters, which are sequestered in HDL destined for removal (see Jonas 2000, Biochim. Biophys. Acta 1529(1-3):245-56).
  • Cholesteryl ester transfer protein CETP and phospholipid transfer protein (PLTP) contribute to further remodeling of the circulating HDL population.
  • CETP moves cholesteryl esters made by LCAT to other lipoproteins, particularly ApoB-comprising lipoproteins, such as very low density lipoprotein (VLDL) and low density lipoprotein (LDL).
  • VLDL very low density lipoprotein
  • LDL low density lipoprotein
  • HDL triglycerides are catabolized by the extracellular hepatic triglyceride lipase, and lipoprotein cholesterol is removed by the liver via several mechanisms.
  • a deficiency of LCAT causes accumulation of unesterified cholesterol in certain body tissues. Cholesterol effluxes from cells as free cholesterol and is transported in HDL as esterified cholesterol. LCAT is the enzyme that esterifies the free cholesterol on HDL to cholesterol ester and allows the maturation of HDL. LCAT deficiency does not allow for HDL maturation resulting in its rapid catabolism of circulating apoA-1 and apoA-2. The remaining form of HDL resembles nascent HDL.
  • LCAT deficiency is a rare genetic disorder in which sufferers lack LCAT activity and are of risk of progressive chronic kidney disease and in some cases renal failure.
  • Fish eye disease is a partial LCAT deficiency in which LCAT cannot esterify, or make the acid into an alkyl, cholesterol in HDL particles. However, LCAT remains active on the cholesterol particles in VLDL and LDL. 3.3.
  • Fish-eye disease also called partial LCAT deficiency, is a disorder that causes the clear front surface of the eyes (the corneas) to gradually become cloudy.
  • the cloudiness which generally first appears in adolescence or early adulthood, consists of small grayish dots of cholesterol (opacities) distributed across the corneas.
  • Fish-eye disease is characterized by abnormalities like visual impairment, plaques of fatty material, and dense opacification. Fish-eye disease is an autosomal recessive disorder caused by mutations of the LCAT gene located on chromosome 16q22.1.
  • LCAT gene mutations that cause fish-eye disease impair alpha-LCAT activity, reducing the enzyme's ability to attach cholesterol to HDL. Impairment of this mechanism for reducing cholesterol in the body leads to cholesterol-containing opacities in the corneas. It is not known why the cholesterol deposits affect only the corneas in this disorder.
  • the present disclosure provides methods for treating eye diseases, for example, eye diseases associated with lipid accumulation (e.g., in subjects having ocular lipid deposits), using lipid binding protein-based complexes, for example CER- 001.
  • lipid binding protein-based complexes for example CER- 001.
  • Other lipid binding protein-based complexes that can be used in the methods of the disclosure include Apomers, Cargomers, and HDL based complexes or HDL mimetic- based complexes such as CSL-111, CSL-112, ETC-216 or delipidated HDL.
  • lipids may accumulate in the eye or near the eye (e.g., lipids may accumulate in a subject’s Meibomian gland or lacrimal gland).
  • Exemplary eye diseases associated with lipid accumulation that can be treated by the methods of the disclosure include dry eye disease, such as dry eye disease associated with Meibomian gland dysfunction or lacrimal gland dysfunction, blepharitis, uveitis, diseases of the cornea such as lipid keratopathy, dry macular degeneration (dry AMD), Stargardt disease, Leber’s idiopathic stellate neuroretinitis, and eye diseases associated with LCAT deficiency such as fish-eye disease.
  • dry eye disease such as dry eye disease associated with Meibomian gland dysfunction or lacrimal gland dysfunction, blepharitis, uveitis, diseases of the cornea such as lipid keratopathy, dry macular degeneration (dry AMD), Stargardt disease, Leber’s idiopathic stellate neuroretinitis, and eye diseases associated with LCAT deficiency such as fish-eye disease.
  • dry eye disease such as dry eye disease associated with Meibomian gland dysfunction or lacrimal gland dysfunction, blepharitis
  • a lipid binding protein complex can reduce ocular lipid deposits, for example by solubilizing the lipids accumulated in the ocular deposits, leading to their elimination.
  • the present disclosure provides methods of delivering ophthalmic drugs to the eye of a subject having an eye disease using a lipid binding protein-based complex (e.g., CER-001) as a drug carrier, thereby treating the eye disease.
  • a lipid binding protein-based complex e.g., CER-001
  • the subject can be a subject suffering from an anterior ocular condition or a posterior ocular condition, for example uveitis, macular edema, macular degeneration, retinal detachment, an ocular tumor, a fungal or viral infection, multifocal choroiditis, diabetic retinopathy, proliferative vitreoretinopathy (PVR), sympathetic ophthalmia, Vogt Koyanagi-Harada (VKH) syndrome, histoplasmosis, uveal diffusion, vascular occlusion, endophthalmitis, or glaucoma.
  • an anterior ocular condition or a posterior ocular condition for example uveitis, macular edema, macular degeneration, retinal detachment, an ocular tumor, a fungal or viral infection, multifocal choroiditis, diabetic retinopathy, proliferative vitreoretinopathy (PVR), sympathetic ophthalmia, Vogt
  • compositions comprising a lipid binding protein-based complex (e.g., CER-001) and one or more ophthalmic drugs complexed thereto.
  • a lipid binding protein-based complex e.g., CER-001
  • the lipid binding protein-based complex can be administered systemically (e.g., by infusion).
  • the lipid binding protein-based complex e.g., CER-001
  • Intraocular administration can be by, for example, intraocular injection, for example intra-vitreal injection, sub-conjuctival injection, parabulbar injection, peribulbar injection or retro-bulbar injection.
  • the lipid binding protein-based complex (e.g., CER-001) can be administered, for example, as an eye drop.
  • the present disclosure provides dosing regimens for lipid binding protein-based complexes (e.g., CER-001) for treating subjects with eye diseases associated with lipid accumulation.
  • the dosing regimens described herein can also be applied to deliver ophthalmic drugs to the eye using a lipid binding protein-based complex (e.g., CER-001) as a drug carrier.
  • the dosing regimens of the disclosure in some embodiments entail administering a lipid binding protein-based complex (e.g., CER-001) to a subject according to an initial “induction” regimen, followed by administering the lipid binding protein-based complex (e.g., CER-001) to the subject according to a “consolidation” regimen, followed by administering the lipid binding protein-based complex (e.g., CER- 001) to the subject according to a “maintenance” regimen.
  • a lipid binding protein-based complex e.g., CER-001
  • dosing regimens can entail administering a lipid binding protein-based complex (e.g., CER- 001) to the subject according to a “maintenance” regimen without a preceding “induction” regimen or “consolidation” regimen.
  • dosing regimens can entail administering a lipid binding protein-based complex (e.g., CER- 001) to the subject according to an “induction” regimen followed by a “maintenance” regimen without an intervening “consolidation” regimen.
  • the induction regimen typically comprises administering multiple doses of a lipid binding protein-based complex (e.g., CER-001) to the subject with a period of 1 day or greater between each dose.
  • the induction regimen comprises three or more doses of a lipid binding protein-based complex (e.g., CER- 001). In some embodiments, the induction regimen comprises three doses a week of a lipid binding protein-based complex (e.g., CER-001). In some embodiments, the induction regimen comprises three doses a week of a lipid binding protein-based complex (e.g., CER-001) for a period of more than one week e.g., a period of two weeks or greater. In some embodiments the induction regimen comprises three doses a week of a lipid binding protein-based complexes (e.g., CER-001) for a period of three weeks.
  • a lipid binding protein-based complex e.g., CER-001
  • the consolidation regimen typically comprises administering multiple doses of a lipid binding protein-based complex (e.g., CER-001) to the subject on a less frequent basis than during the induction regimen.
  • the consolidation regimen typically comprises administering multiple doses of a lipid binding protein-based complex (e.g., CER-001) to the subject with a period of 1 day or greater between each dose e.g., 2 days or greater between each dose.
  • the consolidation regimen comprises two or more doses of a lipid binding protein-based complex (e.g., CER-001).
  • the consolidation regimen comprises two doses a week of a lipid binding protein-based complex (e.g., CER-001).
  • the consolidation regimen comprises two doses a week of a lipid binding protein-based complex (e.g., CER-001) for a period of more than one week e.g., a period of two weeks or greater. In some embodiments the consolidation regimen comprises two doses a week of a lipid binding protein-based complex (e.g., CER-001) for a period of three weeks.
  • the maintenance regimen typically comprises administering one or more doses of a lipid binding protein-based complex (e.g., CER-001) to the subject on a less frequent basis than during the consolidation regimen, for example a period of 5 days or greater, e.g., a period of one week, between doses.
  • the multiple doses of a lipid binding protein-based complex are administered once every week during the maintenance regimen.
  • the disclosure provides methods of treating a subject with lipid binding protein-based complexes (e.g., CER-001) using an induction regimen comprising administering three doses of the lipid binding protein-based complexes (e.g., CER-001) to the subject within one week for three weeks with at least 1 day between each dose followed by a consolidation regimen comprising administering two doses of the lipid binding protein-based complex (e.g., CER-001) to the subject within one week for three weeks with at least 2 days between each dose followed by a maintenance regimen comprising administering one dose of the lipid binding protein-based complex (e.g., CER-001) to the subject every week.
  • an induction regimen comprising administering three doses of the lipid binding protein-based complexes (e.g., CER-001) to the subject within one week for three weeks with at least 1 day between each dose followed by a consolidation regimen compris
  • the disclosure provides methods of treating a subject with a lipid binding protein-based complex (e.g., CER-001) in accordance with a dosage regimen described herein.
  • the lipid binding protein-based complex e.g., CER-001
  • the lipid binding protein-based complex is diluted with saline before intravenous administration such as intravenous infusion using an infusion pump.
  • the dose of the lipid binding protein-based complex (e.g., CER-001) for infusion is based on subject weight, for example 10 mg / kg on a protein weight basis.
  • the disclosure provides methods of treating a subject having an eye disease (e.g., associated with lipid accumulation) with a lipid binding protein- based complex (e.g., CER-001) according to a dosage regimen comprising: - 3 doses per week for 3 weeks (induction regimen) followed by - 2 doses per week for 3 weeks (consolidation regimen), followed by - 1 dose per week until the end of treatment (maintenance regimen).
  • a dosage regimen comprising: - 3 doses per week for 3 weeks (induction regimen) followed by - 2 doses per week for 3 weeks (consolidation regimen), followed by - 1 dose per week until the end of treatment (maintenance regimen).
  • an antihistamine e.g., dexchlorpheniramine, hydroxyzine, diphenhydramine, cetirizine, fexofenadine, or loratadine
  • the lipid binding protein-based complex e.g., CER-001
  • the antihistamine can reduce the likelihood of allergic reactions.
  • the subject treated according to the dosing regimens of the disclosure can be any subject suffering from an eye disease associated with lipid accumulation, for example a subject having LCAT deficiency.
  • the LCAT deficiency may be full LCAT deficiency or partial LCAT deficiency.
  • the subject treated according to the dosing regimens of the disclosure has fish-eye disease.
  • subjects treated according to the dosing regimens of the disclosure can also be any subject in need of treatment with an ophthalmic drug, where the drug is delivered to the eye using a lipid binding protein-based complex (e.g., CER-001) as a drug carrier.
  • CER-001 lipid binding protein-based complex
  • FIG. 1A-1D show the ability of CER-001 to act as a drug carrier for ophthalmic drugs azithromycin (FIG. 1A), spironolactone (FIG. 1B), dexamethasone palmitate (FIG. 1C) and cyclosporine (FIG. 1D).
  • FIGS. 2A-2C show tolerance scores from rabbits administered CER-001, with or without complexed dexamethasone palmitate (Example 4).
  • FIG. 2A plot of tolerance at 6 and 24 hours;
  • FIG. 2B tolerance at 6 hours;
  • FIG. 2C tolerance at 24 hours.
  • FIGS. 3A-3B show cell infiltration (FIG. 3A) and protein (FIG. 3B) in aqueous humor of rabbits administered CER-001, with or without complexed dexamethasone palmitate (Example 4). 6.
  • the disclosure provides methods for treating eye diseases (e.g., eye diseases associated with lipid accumulation) using a lipid binding protein-based complex (e.g., CER-001).
  • the methods of the disclosure can reduce the severity of a subject's eye disease.
  • the lipid binding protein-based complex is an Apomer, a Cargomer, a HDL based complex, or a HDL mimetic based complex.
  • the lipid binding protein-based complex can be used as a drug carrier to deliver one or more ophthalmic drugs to the eye, e.g., one or more ophthalmic drugs which are hydrophobic and/or poorly water soluble or water insoluble.
  • the lipid binding protein-based complex (e.g., CER-001) (e.g., when used as a drug carrier or not used as a drug carrier) does not comprise and is not administered with a cell-penetrating peptide (CPP) (e.g., a CPP as described in WO 2019/018350), chemical penetration enhancer (CPE) (e.g., a CPE as described in WO 2019/018350) or a cytophilic peptide (e.g., a cytophilic peptide as described in EP 3238 746 A1).
  • CPP cell-penetrating peptide
  • CPE chemical penetration enhancer
  • a cytophilic peptide e.g., a cytophilic peptide as described in EP 3238 746 A1
  • WO 2019/018350 and EP 3 238 746 A1 are incorporated herein by reference in their entireties.
  • the disclosure provides lipid binding protein-based complexes such as CER-001 for use as a carrier for one or more ophthalmic drugs. Accordingly, in some aspects, the disclosure provides compositions comprising a lipid binding protein-based complex (e.g., CER-001) with one or more ophthalmic drugs (e.g., as described in Section 6.1.8) complexed thereto. Such compositions can be used in the methods of the disclosure.
  • lipid binding protein-based complexes e.g., CER-001
  • ophthalmic drugs e.g., as described in Section 6.1.8
  • Lipid binding protein-based complexes can be administered peripherally or locally.
  • a lipid binding protein-based complex is administered peripherally, for example by infusion.
  • a lipid binding protein- based complex is administered locally (e.g., by intraocular or topical administration).
  • methods of the disclosure comprise administering a lipid binding protein-based complex (e.g., CER-001) to a subject in three phases. First, the lipid binding protein-based complex (e.g., CER-001) is administered in an initial, intense “induction” regimen. The induction regimen is followed by a less intense “consolidation” regimen. The consolidation regimen is followed by a “maintenance” regimen.
  • a lipid binding protein-based complex (e.g., CER-001) is administered in two phases (e.g., an induction regimen followed by a maintenance regiment) or a single phase (e.g., a maintenance regimen).
  • Induction regimens that can be used in the methods of the disclosure are described in Section 6.3
  • consolidation regimens that can be used in the methods of the disclosure are described in Section 6.4
  • maintenance regimens that can be used in the methods of the disclosure are described in Section 6.5.
  • the dosing regimens of the disclosure comprise administering a lipid binding protein-based complex (e.g., CER-001) as monotherapy or as part of a combination therapy with one or more medications.
  • Combination therapies are described in Section 6.6. 6.1.
  • the lipid binding protein-based complexes comprise HDL or HDL mimetic-based complexes.
  • complexes can comprise a lipoprotein complex as described in U.S. Patent No. 8,206,750, PCT publication WO 2012/109162, PCT publication WO 2015/173633 A2 (e.g., CER-001), PCT publication WO 2004/073684, or US 2004/0229794 A1, the contents of each of which are incorporated herein by reference in their entireties.
  • Lipoproteins and “apolipoproteins” are used interchangeably herein, and unless required otherwise by context, the term “lipoprotein” encompasses lipoprotein mimetics.
  • lipid binding protein and “lipid binding polypeptide” are also used interchangeably herein, and unless required otherwise by context, the terms do not connote an amino acid sequence of particular length.
  • Lipoprotein complexes can comprise a protein fraction (e.g., an apolipoprotein fraction) and a lipid fraction (e.g., a phospholipid fraction).
  • the protein fraction includes one or more lipid-binding protein molecules, such as apolipoproteins, peptides, or apolipoprotein peptide analogs or mimetics, for example one or more lipid binding protein molecules described in Section 6.1.4.
  • the lipid-binding protein molecule(s) comprise apolipoprotein molecule(s) (e.g., ApoA-I molecule(s)), but not apolipoprotein mimetic molecule(s).
  • the lipid fraction typically includes one or more phospholipids which can be neutral, negatively charged, positively charged, or a combination thereof. Exemplary phospholipids and other amphipathic molecules which can be included in the lipid fraction are described in Section 6.1.5.
  • the lipid fraction contains at least one neutral phospholipid (e.g., a sphingomyelin (SM)) and, optionally, one or more negatively charged phospholipids.
  • SM sphingomyelin
  • the neutral and negatively charged phospholipids can have fatty acid chains with the same or different number of carbons and the same or different degree of saturation.
  • the neutral and negatively charged phospholipids will have the same acyl tail, for example a C16:0, or palmitoyl, acyl chain.
  • the weight ratio of the apolipoprotein fraction: lipid fraction ranges from about 1:2.7 to about 1:3 (e.g., 1:2.7).
  • Any phospholipid that bears at least a partial negative charge at physiological pH can be used as the negatively charged phospholipid.
  • Non-limiting examples include negatively charged forms, e.g., salts, of phosphatidylinositol, a phosphatidylserine, a phosphatidylglycerol and a phosphatidic acid.
  • the negatively charged phospholipid is 1,2-dipalmitoyl-sn-glycero-3-[phospho-rac-(1-glycerol)], or DPPG, a phosphatidylglycerol.
  • Preferred salts include potassium and sodium salts.
  • a lipoprotein complex used in the compositions and methods of the disclosure is a lipoprotein complex as described in U.S. Patent No. 8,206,750 or WO 2012/109162 (and its U.S. counterpart, US 2012/0232005), the contents of each of which are incorporated herein in its entirety by reference.
  • the protein component of the lipoprotein complex is as described in Section 6.1 and preferably in Section 6.1.1 of WO 2012/109162 (and US 2012/0232005), the lipid component is as described in Section 6.2 of WO 2012/109162 (and US 2012/0232005), which can optionally be complexed together in the amounts described in Section 6.3 of WO 2012/109162 (and US 2012/0232005).
  • Section 6.1 preferably in Section 6.1.1 of WO 2012/109162 (and US 2012/0232005)
  • the lipid component is as described in Section 6.2 of WO 2012/109162 (and US 2012/0232005)
  • the contents of each of these sections are incorporated by reference herein.
  • a lipoprotein complex of the disclosure is in a population of complexes that is at least 85%, at least 90%, at least 95%, at least 97%, or at least 99% homogeneous, as described in Section 6.4 of WO 2012/109162 (and US 2012/0232005), the contents of which are incorporated by reference herein.
  • a lipoprotein complex that can be used in the compositions and methods of the disclosure comprises 2-4 ApoA-I equivalents, 2 molecules of charged phospholipid, 50-80 molecules of lecithin and 20-50 molecules of SM.
  • a lipoprotein complex that can be used in the compositions and methods of the disclosure comprises 2-4 ApoA-I equivalents, 2 molecules of charged phospholipid, 50 molecules of lecithin and 50 molecules of SM.
  • a lipoprotein complex that can be used in the compositions and methods of the disclosure comprises 2-4 ApoA-I equivalents, 2 molecules of charged phospholipid, 80 molecules of lecithin and 20 molecules of SM.
  • a lipoprotein complex that can be used in the compositions and methods of the disclosure comprises 2-4 ApoA-I equivalents, 2 molecules of charged phospholipid, 70 molecules of lecithin and 30 molecules of SM.
  • a lipoprotein complex that can be used in the compositions and methods of the disclosure comprises 2-4 ApoA-I equivalents, 2 molecules of charged phospholipid, 60 molecules of lecithin and 40 molecules of SM.
  • a lipoprotein complex that can be used in the compositions and methods of the disclosure consists essentially of 2-4 ApoA-I equivalents, 2 molecules of charged phospholipid, 50-80 molecules of lecithin and 20- 50 molecules of SM.
  • a lipoprotein complex that can be used in the compositions and methods of the disclosure consists essentially of 2-4 ApoA-I equivalents, 2 molecules of charged phospholipid, 50 molecules of lecithin and 50 molecules of SM.
  • a lipoprotein complex that can be used in the compositions and methods of the disclosure consists essentially of 2-4 ApoA-I equivalents, 2 molecules of charged phospholipid, 80 molecules of lecithin and 20 molecules of SM.
  • a lipoprotein complex that can be used in the compositions and methods of the disclosure consists essentially of 2-4 ApoA-I equivalents, 2 molecules of charged phospholipid, 70 molecules of lecithin and 30 molecules of SM.
  • a lipoprotein complex that can be used in the compositions and methods of the disclosure consists essentially of 2-4 ApoA-I equivalents, 2 molecules of charged phospholipid, 60 molecules of lecithin and 40 molecules of SM.
  • a lipoprotein complex that can be used in the methods of the disclosure consists essentially of about 90 to 99.8 wt % lecithin and about 0.2 to 10 wt % negatively charged phospholipid, for example, about 0.2-1 wt %, 0.2-2 wt %, 0.2-3 wt %, 0.2-4 wt %, 0.2-5 wt %, 0.2-6 wt %, 0.2-7 wt %, 0.2-8 wt %, 0.2-9 wt % or 0.2-10 wt % total negatively charged phospholipid(s).
  • HDL-based or HDL mimetic-based complexes can include a single type of lipid- binding protein, or mixtures of two or more different lipid-binding proteins, which may be derived from the same or different species.
  • the complexes will preferably comprise lipid-binding proteins that are derived from, or correspond in amino acid sequence to, the animal species being treated, in order to avoid inducing an immune response to the therapy.
  • lipid-binding proteins of human origin are preferably used for treatment of human patients.
  • the use of peptide mimetic apolipoproteins may also reduce or avoid an immune response.
  • the lipid component includes two types of phospholipids: a sphingomyelin (SM) and a negatively charged phospholipid.
  • SM sphingomyelin
  • Exemplary SMs and negatively charged lipids are described in Section 6.1.5.1.
  • Lipid components including SM can optionally include small quantities of additional lipids. Virtually any type of lipids may be used, including, but not limited to, lysophospholipids, galactocerebroside, gangliosides, cerebrosides, glycerides, triglycerides, and cholesterol and its derivatives.
  • the optional lipids When included, such optional lipids will typically comprise less than about 15 wt% of the lipid fraction, although in some instances more optional lipids could be included. In some embodiments, the optional lipids comprise less than about 10 wt%, less than about 5 wt%, or less than about 2 wt%. In some embodiments, the lipid fraction does not include optional lipids.
  • the phospholipid fraction contains egg SM or palmitoyl SM or phytosphingomyelin and DPPG in a weight ratio (SM: negatively charged phospholipid) ranging from 90:10 to 99:1, more preferably ranging from 95:5 to 98:2. In one embodiment, the weight ratio is 97:3.
  • the molar ratio of the lipid component to the protein component of complexes of the disclosure can vary, and will depend upon, among other factors, the identity(ies) of the apolipoprotein comprising the protein component, the identities and quantities of the lipids comprising the lipid component, and the desired size of the complex. Because the biological activity of apolipoproteins such as ApoA-I are thought to be mediated by the amphipathic helices comprising the apolipoprotein, it is convenient to express the apolipoprotein fraction of the lipid:apolipoprotein molar ratio using ApoA-I protein equivalents.
  • ApoA-I contains 6-10 amphipathic helices, depending upon the method used to calculate the helices.
  • Other apolipoproteins can be expressed in terms of ApoA-I equivalents based upon the number of amphipathic helices they contain.
  • ApoA-IM which typically exists as a disulfide-bridged dimer, can be expressed as 2 ApoA-I equivalents, because each molecule of ApoA-IM contains twice as many amphipathic helices as a molecule of ApoA-I.
  • a peptide apolipoprotein that contains a single amphipathic helix can be expressed as a 1/10-1/6 ApoA-I equivalent, because each molecule contains 1/10-1/6 as many amphipathic helices as a molecule of ApoA-I.
  • the lipid:ApoA-I equivalent molar ratio of the lipoprotein complexes (defined herein as “Ri”) will range from about 105:1 to 110:1.
  • the Ri is about 108:1. Ratios in weight can be obtained using a MW of approximately 650-800 for phospholipids.
  • the molar ratio of lipid : ApoA-I equivalents ranges from about 80:1 to about 110:1, e.g., about 80:1 to about 100:1.
  • the RSM for complexes can be about 82:1.
  • lipoprotein complexes used in the methods of the disclosure are negatively charged complexes which comprise a protein fraction which is preferably mature, full-length ApoA-I, and a lipid fraction comprising a neutral phospholipid, sphingomyelin (SM), and negatively charged phospholipid.
  • SM sphingomyelin
  • the lipid component contains SM (e.g., egg SM, palmitoyl SM, phytoSM, or a combination thereof) and negatively charged phospholipid (e.g., DPPG) in a weight ratio (SM : negatively charged phospholipid) ranging from 90:10 to 99:1, more preferably ranging from 95:5 to 98:2, e.g., 97:3.
  • SM negatively charged phospholipid
  • the ratio of the protein component to lipid component can range from about 1:2.7 to about 1:3, with 1:2.7 being preferred. This corresponds to molar ratios of ApoA-I protein to lipid ranging from approximately 1:90 to 1:140.
  • the molar ratio of protein to lipid in the complex is about 1:90 to about 1:120, about 1:100 to about 1:140, or about 1:95 to about 1:125.
  • the complex comprises CER-001, CSL-111, CSL- 112, CER-522 or ETC-216.
  • the complex is CER-001.
  • CER-001 as used in the literature and in the Examples below refers to a complex described in Example 4 of WO 2012/109162.
  • WO 2012/109162 refers to CER-001 as a complex having a 1:2.7 lipoprotein weight:total phospholipid weight ratio with a SM:DPPG weight:weight ratio of 97:3.
  • Example 4 of WO 2012/109162 also describes a method of its manufacture.
  • CER-001 refers to a lipoprotein complex whose individual constituents can vary from CER-001 as described in Example 4 of WO 2012/109162 by up to 20%.
  • the constituents of the lipoprotein complex vary from CER-001 as described in Example 4 of WO 2012/109162 by up to 10%.
  • the constituents of the lipoprotein complex are those described in Example 4 of WO 2012/109162 (plus/minus acceptable manufacturing tolerance variations).
  • the SM in CER-001 can be natural or synthetic.
  • the SM is a natural SM, for example a natural SM described in WO 2012/109162, e.g., chicken egg SM.
  • the SM is a synthetic SM, for example a synthetic SM described in WO 2012/109162, e.g., synthetic palmitoylsphingomyelin, for example as described in WO 2012/109162. Methods for synthesizing palmitoylsphingomyelin are known in the art, for example as described in WO 2014/140787.
  • the lipoprotein in CER-001, apolipoprotein A-I preferably has an amino acid sequence corresponding to amino acids 25 to 267 of SEQ ID NO:1 of WO 2012/109162 (said SEQ ID NO:1 of WO 2012/109162 disclosed herein as SEQ ID NO:2).
  • ApoA-I can be purified by animal sources (and in particular from human sources) or produced recombinantly.
  • the ApoA-I in CER-001 is recombinant ApoA-I.
  • CER-001 used in a dosing regimen of the disclosure is preferably highly homogeneous, for example at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% homogeneous, as reflected by a single peak in gel permeation chromatography. See, e.g., Section 6.4 of WO 2012/109162.
  • CSL-111 is a reconstituted human ApoA-I purified from plasma complexed with soybean phosphatidylcholine (SBPC) (Tardif et al., 2007, JAMA 297:1675-1682).
  • CSL-112 is a formulation of ApoA-I purified from plasma and reconstituted to form HDL suitable for intravenous infusion (Diditchenko et al., 2013, DOI 10.1161/ ATVBAHA.113.301981).
  • ETC-216 also known as MDCO-216 is a lipid-depleted form of HDL containing recombinant ApoA-IMilano. See Nicholls et al., 2011, Expert Opin Biol Ther. 11(3):387-94. doi: 10.1517/14712598.2011.557061.
  • a complex that can be used in the methods of the disclosure is CER-522.
  • CER-522 is a lipoprotein complex comprising a combination of three phospholipids and a 22 amino acid peptide, CT80522:
  • the phospholipid component of CER-522 consists of egg sphingomyelin,1,2- dipalmitoyl-sn-glycero-3-phosphocholine (Dipalmitoylphosphatidylcholine, DPPC) and 1,2–dipalmitoyl-sn-glycero-3-[phospho-rac-(1-glycerol)] (Dipalmitoylphosphatidyl- glycerol, DPPG) in a 48.5:48.5:3 weight ratio.
  • the ratio of peptide to total phospholipids in the CER-522 complex is 1:2.5 (w/w).
  • the lipoprotein complex is delipidated HDL.
  • lipids in HDL can be depleted, for example partially and/or selectively depleted, e.g., to reduce its cholesterol content.
  • the delipidated HDL can resemble small ⁇ , pre ⁇ -1, and other pre ⁇ forms of HDL.
  • a process for selective depletion of HDL is described in Sacks et al., 2009, J Lipid Res. 50(5): 894–907.
  • a lipoprotein complex comprises a bioactive agent delivery particle as described in US 2004/0229794.
  • a bioactive agent delivery particle can comprise a lipid binding polypeptide (e.g., an apolipoprotein as described previously in this Section or in Section 6.1.4), a lipid bilayer (e.g., comprising one or more phospholipids as described previously in this Section or in Section 6.1.5.1), and a bioactive agent (e.g., an anti-cancer agent), wherein the interior of the lipid bilayer comprises a hydrophobic region, and wherein the bioactive agent is associated with the hydrophobic region of the lipid bilayer.
  • a bioactive agent delivery particle as described in US 2004/0229794.
  • a bioactive agent delivery particle does not comprise a hydrophilic core.
  • a bioactive agent delivery particle is disc shaped (e.g., having a diameter from about 7 to about 29 nm).
  • Bioactive agent delivery particles include bilayer-forming lipids, for example phospholipids (e.g., as described previously in this Section or in Section 6.1.5.1).
  • a bioactive agent delivery particle includes both bilayer-forming and non-bilayer-forming lipids.
  • the lipid bilayer of a bioactive agent delivery particle includes phospholipids.
  • the phospholipids incorporated into a delivery particle include dimyristoylphosphatidylcholine (DMPC) and dimyristoylphosphatidylglycerol (DMPG).
  • the lipid bilayer includes DMPC and DMPG in a 7:3 molar ratio.
  • the lipid binding polypeptide is an apolipoprotein (e.g., as described previously in this Section or in Section 6.1.4).
  • the predominant interaction between lipid binding polypeptides, e.g., apolipoprotein molecules, and the lipid bilayer is generally a hydrophobic interaction between residues on a hydrophobic face of an amphipathic structure, e.g., an ⁇ -helix of the lipid binding polypeptide and fatty acyl chains of lipids on an exterior surface at the perimeter of the particle.
  • Bioactive agent delivery particles may include exchangeable and/or non-exchangeable apolipoproteins.
  • the lipid binding polypeptide is ApoA-I.
  • bioactive agent delivery particles include lipid binding polypeptide molecules, e.g., apolipoprotein molecules, that have been modified to increase stability of the particle.
  • the modification includes introduction of cysteine residues to form intramolecular and/or intermolecular disulfide bonds.
  • bioactive agent delivery particles include a chimeric lipid binding polypeptide molecule, e.g., a chimeric apolipoprotein molecule, with one or more bound functional moieties, for example one or more targeting moieties and/or one or more moieties having a desired biological activity, e.g., antimicrobial activity, which may augment or work in synergy with the activity of a bioactive agent incorporated into the delivery particle.
  • Apomer based complexes [0086]
  • lipid binding protein-based complexes that can be used in the methods and compositions of the disclosure comprise Apomers.
  • Apomers generally comprise an apolipoprotein in monomeric or multimeric form complexed with amphipathic molecules.
  • Apomers comprise one or more apolipoprotein molecules, each complexed with one or more amphipathic molecules.
  • the amphipathic molecules together contribute a net charge of at least +1 or -1 per apolipoprotein molecule in an Apomer.
  • Exemplary apolipoproteins that can be used in Apomers are described in Section 6.1.4.1.
  • Exemplary amphipathic molecules are described in Section 6.1.5. 6.1.3.
  • Cargomers generally comprise an apolipoprotein in monomeric or multimeric form (e.g., 2, 4, or 8 apolipoprotein molecules) and one or more cargo moieties.
  • Cargo moieties can be amphipathic or non-amphipathic.
  • Amphipathic cargo moieties can solubilize the apolipoprotein and prevent it from aggregating. Where the cargo moieties are not amphipathic or insufficient to solubilize the apolipoprotein molecule(s), the Cargomers can also comprise one or more additional amphipathic molecules to solubilize the apolipoprotein.
  • reference to amphipathic molecules in the context of the Cargomers encompasses amphipathic molecules that are cargo moieties, amphipathic molecules that are not cargo moieties, or some combination thereof.
  • Cargomers are not discoidal, for example as determined using NMR spectroscopy.
  • Cargo moieties can include biologically active molecules (e.g., drugs, biologics, and/or immunogens) or other agents, for example agents used in diagnostics.
  • biologically active molecules e.g., drugs, biologics, and/or immunogens
  • molecule and “agent” also include complexes and conjugates (for example, antibody-drug conjugates).
  • biologically active diagnostics
  • diagnostics for example, antibodies, antibodies, or fragments.
  • biologically active molecules e.g., drugs, biologics, and/or immunogens
  • agents for example agents used in diagnostics.
  • the terms “molecule” and “agent” also include complexes and conjugates (for example, antibody-drug conjugates).
  • biologically active “diagnostically useful” and the like are not limited to substances with direct pharmacological or biological activity, and may include substances that become active following administration, for example due to metabolism of a prodrug or cleavage of a linker.
  • biologically active and diagnostically useful also includes substances that become biologically active or diagnostically useful after administration, through creation or metabolites or other cleavage products that exert a pharmacological or a biological effect and/or are detectable in a diagnostic test.
  • Amphipathic molecules in a Cargomer can solubilize the apolipoprotein and/or reduce or minimize apolipoprotein aggregation, and can also have other functions in the Cargomer.
  • amphipathic molecules can have therapeutic utility, and thus may be cargo moieties intended for delivery by the Cargomer upon administration to a subject.
  • amphipathic molecules can be used to anchor a non-amphipathic cargo moiety to the apolipoprotein in the Cargomer.
  • a cargo moiety and an amphipathic molecule in a Cargomer are the same.
  • an anchor moiety and an amphipathic molecule in a Cargomer are the same.
  • cargo moieties, anchor moieties and amphipathic molecules in a Cargomer are the same (for example, where an amphipathic molecule has therapeutic activity and also anchors another biologically active molecule to the apolipoprotein molecule(s)).
  • Anchor and/or linker moieties are particularly useful for a Cargomer having a cargo moiety that is not an amphipathic molecule.
  • at least one of the cargo moieties, a majority of the cargo moieties, or all of the cargo moieties in a Cargomer of the disclosure are coupled to the Cargomer via anchors.
  • at least one of the cargo moieties in a Cargomer is coupled to the Cargomer via an anchor.
  • a majority of the cargo moieties in a Cargomer are coupled to the Cargomer via anchors.
  • all of the cargo moieties in a Cargomer are coupled to the Cargomer via anchors.
  • Each anchor in a Cargomer can be the same or, alternatively, different types of anchors can be included in a single Cargomer (e.g., one type of cargo moiety can be coupled to the Cargomer via one type of anchor and a second type of cargo moiety can be coupled to the Cargomer via a second type of anchor).
  • the amphipathic molecules, the cargo, and, if present, the anchors and/or linkers together contribute a net charge of at least +1 or -1 per apolipoprotein molecule in the Cargomer (e.g., +1, +2, +3, -1, -2, or -3). In some embodiments, the net charge is a negative charge.
  • the net charge is a positive charge.
  • charge is measured at physiological pH.
  • the molar ratio of apolipoprotein molecules to amphipathic molecules in a Cargomer can be but does not necessarily have to be in integers or reflect a one to one relationship between the apolipoprotein and amphipathic molecules.
  • a Cargomer can have an apolipoprotein to amphipathic molecule molar ratio of 2:5, 8:7, 3:2, or 4:7.
  • a Cargomer comprises apolipoprotein molecules complexed with amphipathic molecules in an apolipoprotein:amphipathic molecule molar ratio ranging from 8:1 to 1:15 (e.g., from 8:1 to 1:15, from 7:1 to 1:15, from 6:1 to 1:15, from 5:1 to 1:15, from 4:1 to 1:15, from 3:1 to 1:15, from 2:1 to 1:15, from 1:1 to 1:15, from 8:1 to 1:14, from 7:1 to 1:14, from 6:1 to 1:14, from 5:1 to 1:14, from 4:1 to 1:14, from 3:1 to 1:14, from 2:1 to 1:14, from 1:1 to 1:14, from 8:1 to 1:13, from 7:1 to 1:13, from 6:1 to 1:13, from 5:1 to 1:13, from 4:1 to 1:13, from 3:1 to 1:13, from 2:1 to 1:13, from 1:1 to 1:13, from 8:1 to 1:12, from 7:1 to 1:12, from 6:1 to 1:12, from 5:1 to 1:12, from 4:1 to 1:12, from 3:1 to 1:12, from 2:1 to 1:12, from 2:1 to 1:12, from 1:12, from 1:1 to
  • the apolipoprotein to amphipathic molecule molar ratio in the Cargomer ranges from 6:1 to 1:6. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:6. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:6. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:6. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:6.
  • the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:5. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:5. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:5. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:5. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:4. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:4.
  • the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:4. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:4. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:3. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:3. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:3. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:3.
  • the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:2. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:2. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:2. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:2. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:1. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:1.
  • the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:1. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:1. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:6. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:5. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:4. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:3.
  • the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:2. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:2 to 1:6. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:2 to 1:5. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:2 to 1:4. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:2 to 1:3. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:3 to 1:6.
  • the apolipoprotein to amphipathic molecule molar ratio ranges from 1:3 to 1:5. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:3 to 1:4. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:4 to 1:6. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:4 to 1:5. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 1:5 to 1:6.
  • the apolipoprotein to amphipathic molecule molar ratio ranges from 1.5:1 to 1:2. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 5:4 to 4:5. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 5:3 to 3:5. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 5:2 to 2:5. In some embodiments, the apolipoprotein to amphipathic molecule molar ratio ranges from 3:2 to 2:3.
  • the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:1. In other embodiments, the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:2. In yet other embodiments, the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:3. In yet other embodiments, the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:4. In yet other embodiments, the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:5. In yet other embodiments, the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:6.
  • a Cargomer comprises 1 apolipoprotein molecule.
  • a Cargomer comprises 2 apolipoprotein molecules. Cargomers comprising 2 apolipoprotein molecules preferably have a Stokes radius of 3 nm or less.
  • a Cargomer can comprise 2 apolipoprotein molecules and 1, 2, or 3 negatively charged amphipathic molecules (e.g., negatively charged phospholipid molecules) per apolipoprotein molecule.
  • a Cargomer comprises 4 apolipoprotein molecules. Cargomers comprising 4 apolipoprotein molecules preferably have a Stokes radius of 4 nm or less.
  • a Cargomer can comprise 4 apolipoprotein molecules and 1, 2, or 3 negatively charged amphipathic molecules (e.g., negatively charged phospholipid molecules) per apolipoprotein molecule.
  • a Cargomer comprises 8 apolipoprotein molecules.
  • Cargomers comprising 8 apolipoprotein molecules preferably have a Stokes radius of 5 nm or less.
  • a Cargomer can comprise 8 apolipoprotein molecules and 1, 2, or 3 negatively charged amphipathic molecules (e.g., negatively charged phospholipid molecules) per apolipoprotein molecule.
  • the Cargomers of the disclosure do not contain cholesterol and/or a cholesterol derivative (e.g., a cholesterol ester).
  • a Cargomer comprises an apolipoprotein to phospholipid ratio in the range of about 1:2 to about 1:3 by weight.
  • a Cargomer comprises an apolipoprotein to phospholipid ratio of 1:2.7 by weight.
  • the Cargomers can be soluble in a biological fluid, for example one or more of lymph, cerebrospinal fluid, vitreous humor, aqueous humor, and blood or a blood fraction (e.g., serum or plasma).
  • Cargomers may include a targeting functionality, for example to target the Cargomers to a particular cell or tissue type.
  • the Cargomer includes a targeting moiety attached to an apolipoprotein molecule or an amphipathic molecule.
  • one or more cargo moieties that are incorporated into the Cargomer has a targeting capability.
  • Lipid Binding Protein Molecules [0107] Lipid binding protein molecules that can be used in the complexes described herein include apolipoproteins such as those described in Section 6.1.4.1 and apolipoprotein mimetic peptides such as those described in Section 6.1.4.2.
  • the complex comprises a mixture of lipid binding protein molecules.
  • the complex comprises a mixture of one or more lipid binding protein molecules and one or more apolipoprotein mimetic peptides. In some embodiments, the complex comprises one or more apolipoprotein molecules (e.g., ApoA-I molecules), and not one or more apolipoprotein mimetic peptides. [0108] In some embodiments, the complex comprises 1 to 8 ApoA-I equivalents (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 1 to 2, 2 to 8, 2 to 6, 2 to 4, 4 to 6, or 4 to 8 ApoA-I equivalents).
  • 1 to 8 ApoA-I equivalents e.g., 1, 2, 3, 4, 5, 6, 7, 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 1 to 2, 2 to 8, 2 to 6, 2 to 4, 4 to 6, or 4 to 8 ApoA-I equivalents.
  • Lipid binding proteins can be expressed in terms of ApoA-I equivalents based upon the number of amphipathic helices they contain.
  • ApoA-IM which typically exists as a disulfide-bridged dimer
  • 2 ApoA-I equivalents because each molecule of ApoA-I M contains twice as many amphipathic helices as a molecule of ApoA-I.
  • a peptide mimetic that contains a single amphipathic helix can be expressed as a 1/10-1/6 ApoA-I equivalent, because each molecule contains 1/10-1/6 as many amphipathic helices as a molecule of ApoA-I. 6.1.4.1.
  • Suitable apolipoproteins that can be included in the lipid binding protein-based complexes include apolipoproteins ApoA-I, ApoA-II, ApoA-IV, ApoA-V, ApoB, ApoC-I, ApoC-II, ApoC-III, ApoD, ApoE, ApoJ, ApoH, and any combination of two or more of the foregoing.
  • Apolipoproteins Polymorphic forms, isoforms, variants and mutants as well as truncated forms of the foregoing apolipoproteins, the most common of which are Apolipoprotein A-I Milano (ApoA-I M ), Apolipoprotein A-I Paris (ApoA-I P ), and Apolipoprotein A-IZaragoza (ApoA-IZ), can also be used.
  • Apolipoproteins mutants containing cysteine residues are also known, and can also be used (see, e.g., U.S. Publication No. 2003/018132).
  • the apolipoproteins may be in the form of monomers or dimers, which may be homodimers or heterodimers.
  • apolipoproteins can be modified in their primary sequence to render them less susceptible to oxidations, for example, as described in U.S. Publication Nos. 2008/0234192 and 2013/0137628, and U.S. Patent Nos. 8,143,224 and 8,541,236.
  • the apolipoproteins can include residues corresponding to elements that facilitate their isolation, such as His tags, or other elements designed for other purposes.
  • the apolipoprotein in the complex is soluble in a biological fluid (e.g., lymph, cerebrospinal fluid, vitreous humor, aqueous humor, blood, or a blood fraction (e.g., serum or plasma).
  • a biological fluid e.g., lymph, cerebrospinal fluid, vitreous humor, aqueous humor, blood, or a blood fraction (e.g., serum or plasma).
  • the complex comprises covalently bound lipid-binding protein monomers, e.g., dimeric apolipoprotein A-IMilano, which is a mutated form of ApoA-I containing a cysteine.
  • the cysteine allows the formation of a disulfide bridge which can lead to the formation of homodimers or heterodimers (e.g., ApoA-I Milano- ApoA-II).
  • the apolipoprotein molecules comprise ApoA-I, ApoA-II, ApoA-IV, ApoA-V, ApoB, ApoC-I, ApoC-II, ApoC-III, ApoD, ApoE, ApoJ, or ApoH molecules or a combination thereof.
  • the apolipoprotein molecules comprise or consist of ApoA-I molecules.
  • said ApoA-I molecules are human ApoA-I molecules.
  • said ApoA-I molecules are recombinant. In some embodiments, the ApoA-I molecules are not ApoA-IMilano. [0114] In some embodiments, the ApoA-I molecules are Apolipoprotein A-I Milano (ApoA-IM), Apolipoprotein A-IParis (ApoA-IP), or Apolipoprotein A-IZaragoza (ApoA-IZ) molecules. [0115] Apolipoproteins can be purified from animal sources (and in particular from human sources) or produced recombinantly as is well-known in the art, see, e.g., Chung et al., 1980, J. Lipid Res.
  • the apolipoprotein can be in prepro- form, pro- form, or mature form.
  • a complex can comprise ApoA-I (e.g., human ApoA-I) in which the ApoA-I is preproApoA-I, proApoA-I, or mature ApoA-I.
  • the complex comprises ApoA-I that has at least 90% sequence identity to SEQ ID NO:1: PPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVT STFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKK WQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDAL RTHLAPYSDELRQRLAARLEALKENGGARLAEY (SEQ ID NO:1) [0117]
  • the complex comprises ApoA-I that has at least 95% sequence identity to SEQ ID NO:1.
  • the complex comprises ApoA-I that has at least 98% sequence identity to SEQ ID NO:1. In other embodiments, the complex comprises ApoA-I that has at least 99% sequence identity to SEQ ID NO:1. In other embodiments, the complex comprises ApoA-I that has 100% sequence identity to SEQ ID NO:1. [0118] In other embodiments, the complex comprises ApoA-I that has at least 95% sequence identity to amino acids 25 to 267 of SEQ ID NO:2. In other embodiments, the complex comprises ApoA-I that has at least 98% sequence identity to amino acids 25 to 267 of SEQ ID NO:2. In other embodiments, the complex comprises ApoA-I that has at least 99% sequence identity to amino acids 25 to 267 of SEQ ID NO:2.
  • the complex comprises ApoA-I that has 100% sequence identity to amino acids 25 to 267 of SEQ ID NO:2.
  • the complex comprises 1 to 8 apolipoprotein molecules (e.g., 1 to 6, 1 to 4, 1 to 2, 2 to 8, 2 to 6, 2 to 4, 4 to 8, 4 to 6, or 6 to 8 apolipoprotein molecules).
  • the complex comprises 1 apolipoprotein molecule.
  • the complex comprises 2 apolipoprotein molecules.
  • the complex comprises 3 apolipoprotein molecules.
  • the complex comprises 4 apolipoprotein molecules.
  • the complex comprises 5 apolipoprotein molecules.
  • the complex comprises 6 apolipoprotein molecules. In some embodiments, the complex comprises 7 apolipoprotein molecules. In some embodiments, the complex comprises 8 apolipoprotein molecules.
  • the apolipoprotein molecule(s) can comprise a chimeric apolipoprotein comprising an apolipoprotein and one or more attached functional moieties, such as for example, one or more CER-001 complex(es), one or more targeting moieties, a moiety having a desired biological activity, an affinity tag to assist with purification, and/or a reporter molecule for characterization or localization studies.
  • An attached moiety with biological activity may have an activity that is capable of augmenting and/or synergizing with the biological activity of a compound or cargo moiety incorporated into a complex of the disclosure.
  • a moiety with biological activity may have antimicrobial (for example, antifungal, antibacterial, anti-protozoal, bacteriostatic, fungistatic, or antiviral) activity.
  • an attached functional moiety of a chimeric apolipoprotein is not in contact with hydrophobic surfaces of the complex.
  • an attached functional moiety is in contact with hydrophobic surfaces of the complex.
  • a functional moiety of a chimeric apolipoprotein may be intrinsic to a natural protein.
  • a chimeric apolipoprotein includes a ligand or sequence recognized by or capable of interaction with a cell surface receptor or other cell surface moiety.
  • a chimeric apolipoprotein includes a targeting moiety that is not intrinsic to the native apolipoprotein, such as for example, S. cerevisiae ⁇ -mating factor peptide, folic acid, transferrin, or lactoferrin.
  • a chimeric apolipoprotein includes a moiety with a desired biological activity that augments and/or synergizes with the activity of a compound or cargo moiety incorporated into a complex of the disclosure.
  • a chimeric apolipoprotein may include a functional moiety intrinsic to an apolipoprotein.
  • an apolipoprotein intrinsic functional moiety is the intrinsic targeting moiety formed approximately by amino acids 130-150 of human ApoE, which comprises the receptor binding region recognized by members of the low density lipoprotein receptor family.
  • Other examples of apolipoprotein intrinsic functional moieties include the region of ApoB-100 that interacts with the low density lipoprotein receptor and the region of ApoA-I that interacts with scavenger receptor type B 1.
  • a functional moiety may be added synthetically or recombinantly to produce a chimeric apolipoprotein.
  • apolipoprotein with the prepro or pro sequence from another preproapolipoprotein (e.g., prepro sequence from preproapoA-II substituted for the prepro sequence of preproapoA-I).
  • apolipoprotein for which some of the amphipathic sequence segments have been substituted by other amphipathic sequence segments from another apolipoprotein.
  • chimeric refers to two or more molecules that are capable of existing separately and are joined together to form a single molecule having the desired functionality of all of its constituent molecules.
  • the constituent molecules of a chimeric molecule may be joined synthetically by chemical conjugation or, where the constituent molecules are all polypeptides or analogs thereof, polynucleotides encoding the polypeptides may be fused together recombinantly such that a single continuous polypeptide is expressed.
  • a chimeric molecule is termed a fusion protein.
  • a "fusion protein” is a chimeric molecule in which the constituent molecules are all polypeptides and are attached (fused) to each other such that the chimeric molecule forms a continuous single chain.
  • the various constituents can be directly attached to each other or can be coupled through one or more linkers.
  • One or more segments of various constituents can be, for example, inserted in the sequence of an apolipoprotein, or, as another example, can be added N-terminal or C-terminal to the sequence of an apolipoprotein.
  • a fusion protein can comprise an antibody light chain, an antibody fragment, a heavy-chain antibody, or a single-domain antibody.
  • a chimeric apolipoprotein is prepared by chemically conjugating the apolipoprotein and the functional moiety to be attached. Means of chemically conjugating molecules are well known to those of skill in the art. Such means will vary according to the structure of the moiety to be attached, but will be readily ascertainable to those of skill in the art.
  • Polypeptides typically contain a variety of functional groups, e.g., carboxylic acid (--COOH), free amino (--NH2), or sulfhydryl (--SH) groups, that are available for reaction with a suitable functional group on the functional moiety or on a linker to bind the moiety thereto.
  • a functional moiety may be attached at the N-terminus, the C-terminus, or to a functional group on an interior residue (i.e., a residue at a position intermediate between the N- and C-termini) of an apolipoprotein molecule.
  • the apolipoprotein and/or the moiety to be tagged can be derivatized to expose or attach additional reactive functional groups.
  • fusion proteins that include a polypeptide functional moiety are synthesized using recombinant expression systems. Typically, this involves creating a nucleic acid (e.g., DNA) sequence that encodes the apolipoprotein and the functional moiety such that the two polypeptides will be in frame when expressed, placing the DNA under the control of a promoter, expressing the protein in a host cell, and isolating the expressed protein.
  • a nucleic acid encoding a chimeric apolipoprotein can be incorporated into a recombinant expression vector in a form suitable for expression in a host cell.
  • an "expression vector” is a nucleic acid which, when introduced into an appropriate host cell, can be transcribed and translated into a polypeptide.
  • the vector may also include regulatory sequences such as promoters, enhancers, or other expression control elements (e.g., polyadenylation signals).
  • regulatory sequences are known to those skilled in the art (see, e.g., Goeddel, 1990, Gene Expression Technology: Meth. Enzymol.
  • an apolipoprotein has been modified such that when the apolipoprotein is incorporated into a complex of the disclosure, the modification will increase stability of the complex, confer targeting ability or increase capacity.
  • the modification includes introduction of cysteine residues into apolipoprotein molecules to permit formation of intramolecular or intermolecular disulfide bonds, e.g., by site-directed mutagenesis.
  • a chemical crosslinking agent is used to form intermolecular links between apolipoprotein molecules to enhance stability of the complex. Intermolecular crosslinking prevents or reduces dissociation of apolipoprotein molecules from the complex and/or prevents displacement by endogenous apolipoprotein molecules within an individual to whom the complexes are administered.
  • an apolipoprotein is modified either by chemical derivatization of one or more amino acid residues or by site directed mutagenesis, to confer targeting ability to or recognition by a cell surface receptor.
  • Complexes can be targeted to a specific cell surface receptor by engineering receptor recognition properties into an apolipoprotein.
  • complexes may be targeted to a particular cell type known to harbor a particular type of infectious agent, for example by modifying the apolipoprotein to render it capable of interacting with a receptor on the surface of the cell type being targeted.
  • complexes may be targeted to macrophages by altering the apolipoprotein to confer recognition by the macrophage endocytic class A scavenger receptor (SR-A).
  • SR-A macrophage endocytic class A scavenger receptor
  • SR-A binding ability can be conferred to a complex by modifying the apolipoprotein by site directed mutagenesis to replace one or more positively charged amino acids with a neutral or negatively charged amino acid.
  • SR-A recognition can also be conferred by preparing a chimeric apolipoprotein that includes an N- or C-terminal extension having a ligand recognized by SR-A or an amino acid sequence with a high concentration of negatively charged residues.
  • Complexes comprising apoplipoproteins can also interact with apolipoprotein receptors such as, but not limited to, ABCA1 receptors, ABCG1 receptors, Megalin, Cubulin and HDL receptors such as SR-B1.
  • a complex can comprise a lipid binding protein (e.g., an apolipoprotein molecule) which anchors a cargo moiety to a Cargomer.
  • a lipid binding protein e.g., an apolipoprotein molecule
  • the apolipoprotein molecule is coupled to a cargo moiety by a direct bond.
  • the apolipoprotein molecule is coupled to the cargo moiety by a linker, e.g., as described in Section 6.1.7. 6.1.4.2.
  • Apolipoprotein mimetics Peptides, peptide analogs, and agonists that mimic the activity of an apolipoprotein (collectively referred to herein as “apolipoprotein peptide mimetics”) can also be used in the complexes described herein, either alone, in combination with one or more other lipid binding proteins.
  • apolipoprotein peptide mimetics can also be used in the complexes described herein, either alone, in combination with one or more other lipid binding proteins.
  • Non-limiting examples of peptides and peptide analogs that correspond to apolipoproteins, as well as agonists that mimic the activity of ApoA-I, ApoA-IM, ApoA-II, ApoA-IV, and ApoE, that are suitable for inclusion in the complexes and compositions described herein are disclosed in U.S. Pat. Nos.
  • WO/2010/093918 to Dasseux et al., the disclosures of which are incorporated herein by reference in their entireties.
  • These peptides and peptide analogues can be composed of L-amino acid or D-amino acids or mixture of L- and D-amino acids. They may also include one or more non-peptide or amide linkages, such as one or more well-known peptide/amide isosteres.
  • Such apolipoprotein peptide mimetic can be synthesized or manufactured using any technique for peptide synthesis known in the art, including, e.g., the techniques described in U.S. Pat. Nos. 6,004,925, 6,037,323 and 6,046,166.
  • the lipid binding protein molecules comprise apolipoprotein peptide mimetic molecules and optionally one or more apolipoprotein molecules such as those described above.
  • the apolipoprotein peptide mimetic molecules comprise an ApoA-I peptide mimetic, ApoA-II peptide mimetic, ApoA-IV peptide mimetic, or ApoE peptide mimetic or a combination thereof.
  • a complex of the disclosure can comprise an apolipoprotein peptide mimetic molecule which anchors a cargo moiety to the complex.
  • the apolipoprotein peptide mimetic molecule is coupled to the cargo moiety by a direct bond. In other embodiments, the apolipoprotein peptide mimetic molecule is coupled to the cargo moiety by a linker, e.g., as described in Section 6.1.7. 6.1.5.
  • Amphipathic molecules [0133] An amphipathic molecule is a molecule that possesses both hydrophobic (apolar) and hydrophilic (polar) elements.
  • Amphipathic molecules that can be used in complexes described herein include lipids (e.g., as described in Section 6.1.5.1), detergents (e.g., as described in Section 6.1.5.2), fatty acids (e.g., as described in Section 6.1.5.3), and apolar molecules and sterols covalently attached to polar molecules such as, but not limited to, sugars or nucleic acids (e.g., as described in Section 6.1.5.4).
  • the complexes can include a single class of amphipathic molecule (e.g., a single species of phospholipids or a mixture of phospholipids), or can contain a combination of classes of amphipathic molecules (e.g., phospholipids and detergents).
  • the complex can contain one species of amphipathic molecules or a combination of amphipathic molecules configured to facilitate solubilization of the lipid binding protein molecule(s).
  • Apomer and/or Cargomer-based complexes comprise only an amount of amphipathic molecules sufficient to solubilize the lipid binding protein molecules.
  • an Apomer and/or Cargomer-based complex can comprise the minimum amount of one or more amphipathic molecules necessary to solubilize the lipid binding protein molecules.
  • the amphipathic molecules included in comprise a phospholipid, a detergent, a fatty acid, an apolar moiety or sterol covalently attached to a sugar, or a combination thereof (e.g., selected from the types of amphipathic molecules discussed above).
  • the amphipathic molecules comprise or consist of phospholipid molecules.
  • the phospholipid molecules comprise negatively charged phospholipids, neutral phospholipids, positively charged phospholipids or a combination thereof.
  • the phospholipid molecules contribute a net charge of 1-3 per apolipoprotein molecule in the complex. In some embodiments, the net charge is a negative net charge.
  • the net charge is a positive net charge.
  • the phospholipid molecules consist of a combination of negatively charged and neutral phospholipids.
  • the molar ratio of negatively charge phospholipid to neutral phospholipid ranges from 1:1 to 1:3, for example, about 1:1, about 1:2, or about 1:3.
  • the molar ratio of negatively charged phospholipid to neutral phospholipid is about 1:1 or about 1:2.
  • the weight ratio of neutral phospholipids to negatively charged phospholipids ranges from 95:5 to 99:1.
  • a complex comprises at least one amphipathic molecule which is an anchor.
  • the amphipathic molecules comprise neutral phospholipids and negatively charged phospholipids in a weight ratio of 95:5 to 99:1.
  • Lipid binding protein-based complexes can include one or more lipids.
  • one or more lipids can be saturated and/or unsaturated, natural and/or synthetic, charged or not charged, zwitterionic or not.
  • the lipid molecules e.g., phospholipid molecules
  • the lipid comprises a phospholipid.
  • Phospholipids can have two acyl chains that are the same or different (for example, chains having a different number of carbon atoms, a different degree of saturation between the acyl chains, different branching of the acyl chains, or a combination thereof).
  • the lipid can also be modified to contain a fluorescent probe (e.g., as described at yorkilipids.com/product-category/products/fluorescent-lipids/).
  • the lipid comprises at least one phospholipid.
  • Phospholipids can have unsaturated or saturated acyl chains ranging from about 6 to about 24 carbon atoms (e.g., 6-20, 6-16, 6-12, 12-24, 12-20, 12-16, 16-24, 16-20, or 20-24).
  • a phospholipid used in a complex of the disclosure has one or two acyl chains of 12, 14, 16, 18, 20, 22, or 24 carbons (e.g., two acyl chains of the same length or two acyl chains of different length).
  • Non-limiting examples of acyl chains present in commonly occurring fatty acids that can be included in phospholipids are provided in Table 1, below:
  • Lipids that can be present in the complexes of the disclosure include, but are not limited to, small alkyl chain phospholipids, egg phosphatidylcholine, soybean phosphatidylcholine, dipalmitoylphosphatidylcholine, dimyristoylphosphatidylcholine, distearoylphosphatidylcholine 1-myristoyl-2-palmitoylphosphatidylcholine, 1- palmitoyl-2-myristoylphosphatidylcholine, 1-palmitoyl-2-stearoylphosphatidylcholine, 1-stearoyl-2-palmitoylphosphatidylcholine, dioleoylphosphatidylcholine dioleophosphatidylethanolamine, dilauroylphosphatidylglycerol phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, phosphatidylinositol
  • Synthetic lipids such as synthetic palmitoylsphingomyelin or N-palmitoyl-4-hydroxysphinganine-1-phosphocholine (a form of phytosphingomyelin) can be used to minimize lipid oxidation.
  • a lipid binding protein-based complex includes two types of phospholipids: a neutral lipid, e.g., lecithin and/or sphingomyelin (abbreviated SM), and a charged phospholipid (e.g., a negatively charged phospholipid).
  • SM lecithin and/or sphingomyelin
  • a “neutral” phospholipid has a net charge of about zero at physiological pH.
  • neutral phospholipids are zwitterions, although other types of net neutral phospholipids are known and can be used.
  • the molar ratio of the charged phospholipid (e.g., negatively charged phospholipid) to neutral phospholipid ranges from 1:1 to 1:3, for example, about 1:1, about 1:2, or about 1:3.
  • the neutral phospholipid can comprise, for example, one or both of the lecithin and/or SM, and can optionally include other neutral phospholipids.
  • the neutral phospholipid comprises lecithin, but not SM. In other embodiments, the neutral phospholipid comprises SM, but not lecithin.
  • the neutral phospholipid comprises both lecithin and SM. All of these specific exemplary embodiments can include neutral phospholipids in addition to the lecithin and/or SM, but in many embodiments do not include such additional neutral phospholipids.
  • SM includes sphingomyelins derived or obtained from natural sources, as well as analogs and derivatives of naturally occurring SMs that are impervious to hydrolysis by LCAT, as is naturally occurring SM.
  • SM is a phospholipid very similar in structure to lecithin, but, unlike lecithin, it does not have a glycerol backbone, and hence does not have ester linkages attaching the acyl chains.
  • SM has a ceramide backbone, with amide linkages connecting the acyl chains.
  • SM can be obtained, for example, from milk, egg or brain.
  • SM analogues or derivatives can also be used.
  • Non-limiting examples of useful SM analogues and derivatives include, but are not limited to, palmitoylsphingomyelin, N-palmitoyl-4- hydroxysphinganine-1-phosphocholine (a form of phytosphingomyelin), palmitoylsphingomyelin, stearoylsphingomyelin, D-erythro-N-16:0-sphingomyelin and its dihydro isomer, D-erythro-N-16:0-dihydro-sphingomyelin.
  • Synthetic SM such as synthetic palmitoylsphingomyelin or N-palmitoyl-4-hydroxysphinganine-1- phosphocholine (phytosphingomyelin) can be used in order to produce more homogeneous complexes and with fewer contaminants and/or oxidation products than sphingolipids of animal origin. Methods for synthesizing SM are described in U.S. Publication No. 2016/0075634. [0148] Sphingomyelins isolated from natural sources can be artificially enriched in one particular saturated or unsaturated acyl chain.
  • milk sphingomyelin (Avanti Phospholipid, Alabaster, Ala.) is characterized by long saturated acyl chains (i.e., acyl chains having 20 or more carbon atoms).
  • egg sphingomyelin is characterized by short saturated acyl chains (i.e., acyl chains having fewer than 20 carbon atoms).
  • milk sphingomyelin comprises C16:0 (16 carbon, saturated) acyl chains
  • egg sphingomyelin comprises C16:0 acyl chains.
  • the composition of milk sphingomyelin can be enriched to have an acyl chain composition comparable to that of egg sphingomyelin, or vice versa.
  • the SM can be semi-synthetic such that it has particular acyl chains.
  • milk sphingomyelin can be first purified from milk, then one particular acyl chain, e.g., the C16:0 acyl chain, can be cleaved and replaced by another acyl chain.
  • the SM can also be entirely synthesized, by e.g., large-scale synthesis. See, e.g., Dong et al., U.S. Pat. No.
  • SM can be fully synthetic, e.g., as described in U.S. Publication No. 2014/0275590.
  • the lengths and saturation levels of the acyl chains comprising a semi-synthetic or a synthetic SM can be selectively varied.
  • the acyl chains can be saturated or unsaturated, and can contain from about 6 to about 24 carbon atoms. Each chain can contain the same number of carbon atoms or, alternatively each chain can contain different numbers of carbon atoms.
  • the semi-synthetic or synthetic SM comprises mixed acyl chains such that one chain is saturated and one chain is unsaturated.
  • the chain lengths can be the same or different.
  • the acyl chains of the semi-synthetic or synthetic SM are either both saturated or both unsaturated. Again, the chains can contain the same or different numbers of carbon atoms.
  • both acyl chains comprising the semi-synthetic or synthetic SM are identical.
  • the chains correspond to the acyl chains of a naturally-occurring fatty acid, such as for example oleic, palmitic or stearic acid.
  • SM with saturated or unsaturated functionalized chains is used.
  • both acyl chains are saturated and contain from 6 to 24 carbon atoms.
  • Non-limiting examples of acyl chains present in commonly occurring fatty acids that can be included in semi- synthetic and synthetic SMs are provided in Table 1, above.
  • the SM is palmitoyl SM, such as synthetic palmitoyl SM, which has C16:0 acyl chains, or is egg SM, which includes as a principal component palmitoyl SM.
  • functionalized SM such as phytosphingomyelin, is used.
  • Lecithin can be derived or isolated from natural sources, or it can be obtained synthetically.
  • suitable lecithins isolated from natural sources include, but are not limited to, egg phosphatidylcholine and soybean phosphatidylcholine.
  • lecithins include, dipalmitoylphosphatidylcholine, dimyristoylphosphatidylcholine, distearoylphosphatidylcholine 1-myristoy1-2-palmitoylphosphatidylcholine, 1- palmitoy1-2-myristoylphosphatidylcholine, 1-palmitoy1-2-stearoylphosphatidylcholine, 1-stearoy1-2-palmitoylphosphatidylcholine, 1-palmitoy1-2-oleoylphosphatidylcholine, 1-oleoy1-2-palmitylphosphatidylcholine, dioleoylphosphatidylcholine and the ether derivatives or analogs thereof.
  • Lecithins derived or isolated from natural sources can be enriched to include specified acyl chains.
  • identity(ies) of the acyl chains can be selectively varied, as discussed above in connection with SM.
  • both acyl chains on the lecithin are identical.
  • the acyl chains of the SM and lecithin are all identical.
  • the acyl chains correspond to the acyl chains of myristitic, palmitic, oleic or stearic acid.
  • the complexes of the disclosure can include one or more negatively charged phospholipids (e.g., alone or in combination with one or more neutral phospholipids).
  • negatively charged phospholipids are phospholipids that have a net negative charge at physiological pH.
  • the negatively charged phospholipid can comprise a single type of negatively charged phospholipid, or a mixture of two or more different, negatively charged, phospholipids.
  • the charged phospholipids are negatively charged glycerophospholipids.
  • Suitable negatively charged phospholipids include, but are not limited to, a 1,2-dipalmitoyl-sn-glycero-3- [phospho-rac-(1-glycerol)], a phosphatidylglycerol, a phospatidylinositol, a phosphatidylserine, a phosphatidic acid, and salts thereof (e.g., sodium salts or potassium salts).
  • the negatively charged phospholipid comprises one or more of phosphatidylinositol, phosphatidylserine, phosphatidylglycerol and/or phosphatidic acid.
  • the negatively charged phospholipid comprises or consists of a salt of a phosphatidylglycerol or a salt of a phosphatidylinositol.
  • the negatively charged phospholipid comprises or consists of 1,2-dipalmitoyl-sn-glycero-3-[phospho-rac-(1- glycerol)], or DPPG, or a salt thereof.
  • the negatively charged phospholipids can be obtained from natural sources or prepared by chemical synthesis. In embodiments employing synthetic negatively charged phospholipids, the identities of the acyl chains can be selectively varied, as discussed above in connection with SM.
  • both acyl chains on the negatively charged phospholipids are identical.
  • the acyl chains all types of phospholipids included in a complex of the disclosure are all identical.
  • the complex comprises negatively charged phospholipid(s), and/or SM all having C16:0 or C16:1 acyl chains.
  • the fatty acid moiety of the SM is predominantly C16:1 palmitoyl.
  • the acyl chains of the charged phospholipid(s), lecithin and/or SM correspond to the acyl chain of palmitic acid.
  • the acyl chains of the charged phospholipid(s), lecithin and/or SM correspond to the acyl chain of oleic acid.
  • positively charged phospholipids that can be included in the complexes of the disclosure include N1-[2-((1S)-1-[(3-aminopropyl)amino]-4-[di(3- amino-propyl)amino]butylcarboxamido)ethyl]-3,4-di[oleyloxy]-benzamide, 1,2-di-O- octadecenyl-3-trimethylammonium propane, 1,2-dimyristoleoyl-sn-glycero-3- ethylphosphocholine, 1-palmitoyl-2-oleoyl-sn-glycero-3-ethylphosphocholine, 1,2- dioleoyl-sn-glycero-3-ethylphosphocholine,
  • the lipids used are preferably at least 95% pure, and/or have reduced levels of oxidative agents (such as but not limited to peroxides).
  • Lipids obtained from natural sources preferably have fewer polyunsaturated fatty acid moieties and/or fatty acid moieties that are not susceptible to oxidation.
  • the level of oxidation in a sample can be determined using an iodometric method, which provides a peroxide value, expressed in milli-equivalent number of isolated iodines per kg of sample, abbreviated meq O/kg.
  • the level of oxidation, or peroxide level is low, e.g., less than 5 meq O/kg, less than 4 meq O/kg, less than 3 meq O/kg, or less than 2 meq O/kg.
  • Complexes can in some embodiments include small quantities of additional lipids.
  • lipids can be used, including, but not limited to, lysophospholipids, galactocerebroside, gangliosides, cerebrosides, glycerides, triglycerides, and sterols and sterol derivatives (e.g., a plant sterol, an animal sterol, such as cholesterol, or a sterol derivative, such as a cholesterol derivative).
  • a complex of the disclosure can contain cholesterol or a cholesterol derivative, e.g., a cholesterol ester.
  • the cholesterol derivative can also be a substituted cholesterol or a substituted cholesterol ester.
  • the complexes of the disclosure can also contain an oxidized sterol such as, but not limited to, oxidized cholesterol or an oxidized sterol derivative (such as, but not limited to, an oxidized cholesterol ester). In some embodiments, the complexes do not include cholesterol and/or its derivatives (such as a cholesterol ester or an oxidized cholesterol ester).
  • oxidized sterol such as, but not limited to, oxidized cholesterol or an oxidized sterol derivative (such as, but not limited to, an oxidized cholesterol ester).
  • the complexes do not include cholesterol and/or its derivatives (such as a cholesterol ester or an oxidized cholesterol ester).
  • Detergents [0160]
  • the complexes can contain one or more detergents.
  • the detergent can be zwitterionic, nonionic, cationic, anionic, or a combination thereof.
  • Exemplary zwitterionic detergents include 3-[(3-Cholamidopropyl)dimethylammonio]-1- propanesulfonate (CHAPS), 3-[(3-Cholamidopropyl)dimethylammonio]-2-hydroxy-1- propanesulfonate (CHAPSO), and N,N-dimethyldodecylamine N-oxide (LDAO).
  • CHAO 3-[(3-Cholamidopropyl)dimethylammonio]-1- propanesulfonate
  • CHAO N,N-dimethyldodecylamine N-oxide
  • nonionic detergents include D-(+)-trehalose 6-monooleate, N-octanoyl-N- methylglucamine, N-nonanoyl-N-methylglucamine, N-decanoyl-N-methylglucamine, 1- (7Z-hexadecenoyl)-rac-glycerol, 1-(8Z-hexadecenoyl)-rac-glycerol, 1-(8Z- heptadecenoyl)-rac-glycerol, 1-(9Z-hexadecenoyl)-rac-glycerol, 1-decanoyl-rac- glycerol.
  • Exemplary cationic detergents include (S)-O-methyl-serine dodecylamide hydrochloride, dodecylammonium chloride, decyltrimethylammonium bromide, and cetyltrimethylammonium sulfate.
  • Exemplary anionic detergents include cholesteryl hemisuccinate, cholate, alkyl sulfates, and alkyl sulfonates.
  • 6.1.5.3. Fatty Acids [0161]
  • the complexes can contain one or more fatty acids.
  • the one or more fatty acids can include short-chain fatty acids having aliphatic tails of five or fewer carbons (e.g.
  • butyric acid, isobutyric acid, valeric acid, or isovaleric acid medium-chain fatty acids having aliphatic tails of 6 to 12 carbons (e.g., caproic acid, caprylic acid, capric acid, or lauric acid), long-chain fatty acids having aliphatic tails of 13 to 21 carbons (e.g., myristic acid, palmitic acid, stearic acid, or arachidic acid) , very long chain fatty acids having aliphatic tails of 22 or more carbons (e.g., behenic acid, lignoceric acid, or cerotic acid), or a combination thereof.
  • medium-chain fatty acids having aliphatic tails of 6 to 12 carbons e.g., caproic acid, caprylic acid, capric acid, or lauric acid
  • long-chain fatty acids having aliphatic tails of 13 to 21 carbons e.g., myristic acid, palmitic acid, stearic acid
  • the one or more fatty acids can be saturated (e.g., caprylic acid, capric acid, lauric acid, myristic acid, palmitic acid, stearic acid, arachidic acid, behenic acid, lignoceric acid, or cerotic acid), unsaturated (e.g., myristoleic acid, palmitoleic acid, sapienic acid, oleic acid, elaidic acid, vaccenic acid, linoleic acid, linoelaidic acid, ⁇ -linolenic acid, arachidonic acid, eicosapentaenoic acid, erucic acid, or docosahexaenoic acid) or a combination thereof.
  • saturated e.g., caprylic acid, capric acid, lauric acid, myristic acid, palmitic acid, stearic acid, arachidic acid, behenic acid, lignoceric acid, or cerotic acid
  • unsaturated
  • Unsaturated fatty acids can be cis or trans fatty acids.
  • unsaturated fatty acids used in the complexes of the disclosure are cis fatty acids.
  • Apolar molecules and sterols attached to a sugar can contain one or more amphipathic molecules that comprise an apolar molecule or moiety (e.g., a hydrocarbon chain, an acyl or diacyl chain) or a sterol (e.g., cholesterol) attached to a sugar (e.g., a monosaccharide such as glucose or galactose, or a disaccharide such as maltose or trehalose).
  • the sugar can be a modified sugar or a substituted sugar.
  • Exemplary amphipathic molecules comprising an apolar molecule attached to a sugar include dodecan-2-yloxy-ß-D-maltoside, tridecan-3-yloxy- ß-D-maltoside, tridecan-2-yloxy-ß-D-maltoside, n-dodecyl-ß-D-maltoside (DDM), n- octyl-ß-D-glucoside, n-nonyl-ß-D-glucoside, n-decyl-ß-D-maltoside, n-dodecyl- ⁇ -D- maltopyranoside, 4-n-Dodecyl- ⁇ , ⁇ trehalose, 6-n-dodecyl- ⁇ , ⁇ trehalose, and 3-n- dodecyl- ⁇ , ⁇ trehalose.
  • DDM dodecan-2-yloxy-ß-D-maltoside
  • DDM tridecan-3-yloxy- ß-D-mal
  • the apolar moiety is an acyl or a diacyl chain.
  • the sugar is a modified sugar or a substituted sugar. 6.1.6.
  • Anchors [0165] A cargo moiety can be covalently bound to an amphipathic or apolar moiety to facilitate coupling of the cargo moiety to a lipid binding protein-based complex. Amphipathic and apolar moieties can interact with apolar regions in lipid binding protein-based complexes, thereby anchoring cargo moieties attached to amphipathic and apolar moieties to the complexes.
  • Amphipathic moieties that can be used as anchors include lipids (e.g., as described in Section 6.1.5.1) and fatty acids (e.g., as described in Section 6.1.5.3).
  • the anchors comprise a sterol or a sterol derivative e.g., a plant sterol, an animal sterol, or a sterol derivative such as a vitamin).
  • sterols such as cholesterol can be covalently bound to a cargo moiety (e.g., via the hydroxyl group at the 3-position of the A-ring of the sterol) and used to anchor a cargo moiety to a complex.
  • Apolar moieties that can be used as anchors include alkyl chains, acyl chains, and diacyl chains.
  • Cargo moieties can be covalently bound to anchor moieties directly or indirectly via a linker (e.g., via a difunctional peptide or other linker described in Section 6.1.7).
  • Cargo moieties that are biologically active may retain their biological activity while covalently bound to the anchor (or linker attached to the anchor), while others may require cleavage of the covalent bond (e.g., by hydrolysis) attaching the cargo moiety to the anchor (or linker attached to the anchor) to regain biological activity.
  • at least one cargo moiety is coupled to an anchor.
  • the anchor comprises an amphipathic and/or apolar moiety. In some embodiments, the anchor comprises an amphipathic moiety. In some embodiments, the amphipathic moiety comprises one of the amphipathic molecules in the complex. In some embodiments, the amphipathic moiety comprises a lipid, a detergent, a fatty acid, an apolar molecule attached to a sugar, or a sterol attached to a sugar. [0168] In some embodiments, the amphipathic moiety comprises a sterol. In some embodiments, the sterol comprises an animal sterol or a plant sterol. In some embodiments, the sterol comprises cholesterol. [0169] In other embodiments, the anchor comprises an apolar moiety.
  • the apolar moiety comprises an alkyl chain, an acyl chain, or a diacyl chain.
  • a cargo moiety is coupled to the anchor by a direct bond.
  • a cargo moiety is coupled to the anchor by a linker. 6.1.7.
  • Linkers comprise a chain of atoms that covalently attach cargo moieties to other moieties in a cargo-carrying complex such as a Cargomer, for example to apolipoprotein molecules, amphipathic molecules, and anchors. A number of linker molecules are commercially available, for example from ThermoFisher Scientific.
  • Suitable linkers are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, and peptide linkers.
  • a linker can be a bifunctional linker, which is either homobifunctional or heterobifunctional.
  • Suitable linkers include cleavable and non-cleavable linkers.
  • a linker may be a cleavable linker, facilitating release of a cargo moiety in vivo.
  • Cleavable linkers include acid-labile linkers (e.g., comprising hydrazine or cis-aconityl), protease-sensitive (e.g., peptidase-sensitive) linkers, photolabile linkers, or disulfide- containing linkers (Chari et al., 1992, Cancer Research 52:127-131; U.S. Patent No. 5,208,020).
  • a cleavable linker is typically susceptible to cleavage under intracellular conditions.
  • Suitable cleavable linkers include, for example, a peptide linker cleavable by an intracellular protease, such as lysosomal protease or an endosomal protease.
  • the linker can be a dipeptide linker, such as a valine-citrulline (val-cit) or a phenylalanine-lysine (phe-lys) linker.
  • a cleavable linker can be pH-sensitive, i.e., sensitive to hydrolysis at certain pH values. Typically, a pH-sensitive linker is hydrolyzable under acidic conditions.
  • an acid-labile linker that is hydrolyzable in the lysosome e.g., a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like
  • a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like can be used.
  • a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like can be used.
  • the hydrolyzable linker is a thioether linker (such as, e.g., a thioether attached to the cargo moiety via an acylhydrazone bond (see, e.g., U.S. Patent No. 5,622,929).
  • the linker is cleavable under reducing conditions (e.g., a disulfide linker).
  • disulfide linkers are known in the art, including, for example, those that can be formed using SATA (N-succinimidyl-5-acetylthioacetate), SPDP (N-succinimidyl-3-(2-pyridyldithio)propionate), SPDB (N-succinimidyl-3-(2- pyridyldithio)butyrate) and SMPT (N-succinimidyloxycarbonyl-alpha-methyl-alpha-(2- pyridyl-dithio)toluene), SPDB and SMPT (see, e.g., Thorpe et al., 1987, Cancer Res.
  • SATA N-succinimidyl-5-acetylthioacetate
  • SPDP N-succinimidyl-3-(2-pyridyldithio)propionate
  • SPDB N-succinimidyl-3-(2- pyr
  • the linker is cleavable by a cleaving agent, e.g., an enzyme, that is present in the intracellular environment (e.g., within a lysosome or endosome or caveolea).
  • a cleaving agent e.g., an enzyme
  • the linker can be, e.g., a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including, but not limited to, a lysosomal or endosomal protease.
  • the peptidyl linker is at least two amino acids long or at least three amino acids long.
  • Cleaving agents can include cathepsins B and D and plasmin, all of which are known to hydrolyze dipeptide drug derivatives resulting in the release of active drug inside target cells (see, e.g., Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123).
  • the peptidyl linker cleavable by an intracellular protease is a Val-Cit linker or a Phe-Lys linker.
  • the linker is a malonate linker (Johnson et al., 1995, Anticancer Res. 15:1387-93), a maleimidobenzoyl linker (Lau et al., 1995, Bioorg-Med- Chem. 3(10):1299-1304), or a 3′-N-amide analog (Lau et al., 1995, Bioorg-Med- Chem. 3(10): 1305-12).
  • the linker unit is not cleavable and the cargo moiety is released, for example, by complex degradation.
  • exemplary non-cleavable linkers include maleimidocaproyl, N-succinimidyl 4- (maleimidomethyl)cyclohexanecarboxylate (SMCC) and N-succinimidyl-4- (iodoacetyl)-aminobenzoate (SIAB).
  • SMCC maleimidomethyl)cyclohexanecarboxylate
  • SIAB N-succinimidyl-4- (iodoacetyl)-aminobenzoate
  • a cargo moiety is coupled to an anchor (e.g., as described in Section 6.1.6) by a linker.
  • the linker coupling the cargo moiety to the anchor is a bifunctional linker.
  • the linker coupling the cargo moiety to the anchor is a cleavable linker.
  • the cleavable linker is a dipeptide linker such as a valine-citrulline (val-cit) or a phenylalanine-lysine (phe-lys) linker.
  • the linker coupling the cargo moiety to the anchor is a non-cleavable linker.
  • non-cleavable linkers include maleimidocaproyl, N-succinimidyl 4- (maleimidomethyl)cyclohexanecarboxylate (SMCC) and N-succinimidyl-4- (iodoacetyl)-aminobenzoate (SIAB). 6.1.8.
  • Ophthalmic drugs [0181]
  • a lipid binding protein- based complex e.g., CER-001
  • CER-001 can be used as a carrier to deliver one or more ophthalmic drugs to a subject’s eye.
  • the one or more ophthalmic drugs can be considered cargo moieties, and can be complexed to a lipid binding protein-based complex (e.g., CER-001) either non-covalently or covalently to a component of the complex (e.g., via an anchor or linker).
  • a lipid binding protein-based complex e.g., CER-001
  • the one or more ophthalmic drugs are not covalently linked to the complex.
  • One or more ophthalmic drugs can be added to a pre-formed complex, e.g., pre-formed CER-001, to make a complex which further comprises the one or more ophthalmic drugs.
  • Complexation between the one or more ophthalmic drugs and a pre-formed complex can be promoted by performing one or more heating and cooling cycles, for example as described in Example 1.
  • one or more ophthalmic drugs can be included during the process used to make a complex, e.g., included in a starting suspension comprising lipid binding protein and lipid components subjected to thermal cycling. Thermal cycling processes for making lipid binding protein-based complexes are described in WO 2012/109162 and WO/2019/030574.
  • the one or more ophthalmic drugs comprise a steroid, a kinase inhibitor, an angiotensin II receptor antagonist, an aldose reductase inhibitor, an immunosuppressant, a carbonic anhydrase inhibitor, an antimicrobial agent, an antiviral agent, an antihistamine, an anti-inflammatory, a prostaglandin analog, or a combination thereof.
  • ophthalmic drugs that can be used include but are not limited to, steroids such as dexamethasone, dexamethasone palmitate, difluprednate, estradiol, fluocinolone, fluorometholone, hydrocortisone, loteprednol etabonate, prednisolone, triamcinolone, rimexolone, and spironolactone; kinase inhibitors such as axitinib, BMS- 794833 (N-(4-((2-amino-3-chloropyridin-4-yl)oxy)-3-fluorophenyl)-5-(4-fluorophenyl)- 4-oxo-1,4-dihydropyridine-3-carboxamide), carbozantinib, cediranib, dovitinib, lapatinib, lenvatinib, motesanib, nintedanib, orantinib
  • steroids such as
  • a lipid binding protein based-complex includes a prostaglandin analog such as latanoprost, travaprost, bimatoprost, tafluprost, or a combination thereof.
  • a lipid binding protein based-complex includes latanoprost.
  • a lipid binding protein-based complex includes travaprost.
  • a lipid binding protein-based complex includes bimatoprost.
  • a lipid binding protein-based complex includes tafluprost.
  • a lipid binding protein based-complex includes dexamethasone, axitinib, cediranib, dovitinib, motesanib, pazopanib, regorafenib, losartan, olmesartan, dorzolamide, diclofenac, nepafenac, or a combination thereof.
  • a lipid binding protein based-complex includes azithromycin.
  • a lipid binding protein based-complex includes spironolactone.
  • a lipid binding protein based-complex includes dexamethasone palmitate.
  • a lipid binding protein based-complex includes cyclosporine.
  • a lipid binding protein based-complex includes dexamethasone.
  • a lipid binding protein based-complex includes loteprednol etabonate.
  • a lipid binding protein based-complex includes triamcinolone.
  • a lipid binding protein based-complex includes acyclovir.
  • a lipid binding protein based-complex includes pazopanib.
  • a lipid binding protein based-complex includes sirolimus.
  • a lipid binding protein based-complex includes tacrolimus.
  • a lipid binding protein based-complex includes nepafenac. 6.1.8.1.
  • CER-001 and ophthalmic drug combinations [0198] As disclosed herein, CER-001 can be used as a drug carrier to deliver one or more ophthalmic drugs to a subject’s eye. Accordingly, the disclosure provides compositions comprising CER-001 and one or more ophthalmic drugs, e.g., one or more drugs which are hydropobic and/or poorly water soluble or insoluble.
  • the composition comprises CER-001 and a steroid. In some embodiments, the composition comprises CER-001 and dexamethasone. In some embodiments, the composition comprises CER-001 and dexamethasone palmitate. In some embodiments, the composition comprises CER-001 and loteprednol etabonate. In some embodiments, the composition comprises CER-001 and triamcinolone. [0200] In another embodiment, the composition comprises CER-001 and an antimicrobial, antifungal, or antiviral agent. In some embodiments, the composition comprises CER-001 and azithromycin. In some embodiments, the composition comprises CER-001 and acyclovir.
  • the composition comprises CER-001 and a prostaglandin analog. In some embodiments, the composition comprises CER-001 and latanoprost. In some embodiments, the composition comprises CER-001 and travaprost. In some embodiments, the composition comprises CER-001 and bimatoprost. In some embodiments, the composition comprises CER-001 and tafluprost. [0202] In another embodiment, the composition comprises CER-001 and a kinase inhibitor. In some embodiments, the composition comprises CER-001 and pazopanib. [0203] In another embodiment, the composition comprises CER-001 and an immunosuppressant. In some embodiments, the composition comprises CER-001 and sirolimus.
  • the composition comprises CER-001 and tacrolimus. [0204] In another embodiment, the composition comprises CER-001 and non-steroidal anti-inflammatory drugs. In some embodiments, the composition comprises CER-001 and nepafenac. [0205] In a further embodiment, the composition comprises CER-001 and spironolactone. [0206] In another embodiment, the composition comprises CER-001 and cyclosporin. [0207] Compositions described in this Section 6.1.8.1 can be prepared by any suitable means, for example as described in Section 6.1.9, e.g., by thermal cycling a mixture comprising CER-001 and the ophthalmic drug(s).
  • compositions can be suitably formulated for the intended route of administration such as local administration for example topical administration or intraocular administration.
  • Compositions for intraocular administration can be formulated for administration by, for example, intraocular injection, for example intra-vitreal injection, sub-conjuctival injection, parabulbar injection, peribulbar injection or retro-bulbar injection.
  • intraocular injection for example intra-vitreal injection, sub-conjuctival injection, parabulbar injection, peribulbar injection or retro-bulbar injection.
  • topical administration the composition may be formulated for administration, for example, as an eye drop. 6.1.9.
  • Lipid binding protein-based complexes can be formulated for the intended route of administration, for example according to techniques known in the art (e.g., as described in Allen et al., eds., 2012, Remington: The Science and Practice of Pharmacy, 22nd Edition, Pharmaceutical Press, London, UK).
  • a formulation comprises a lipid binding protein-based complex, such as CER-001, and one or more ophthalmic drugs, e.g., one or more ophthalmic drugs described in Section 6.1.8.
  • CER-001 intended for administration by infusion can be formulated in a phosphate buffer with sucrose and mannitol excipients, for example as described in WO 2012/109162.
  • Formulations of lipid binding protein-based complexes intended for topical administration can include, for example, carriers, stabilizers, excipients, and combinations thereof.
  • a topical formulation e.g., eye drops
  • a topical formulation comprises an osmolarity adjusting agent.
  • a topical formulation comprises a preservative.
  • the preservative is benzalkonium chloride, cetrimonium, sodium perborate, stabilized oxychloro complex, SofZia, polyquaternium-1, chlorobutanol, edetate disodium, polyhexamethylene biguanide, or a combination thereof.
  • a topical formulation comprises a buffer agent.
  • the buffer agent is selected from borates, borate-polyol complexes, succinate, phosphate buffering agents, citrate buffering agents, acetate buffering agents, carbonate buffering agents, organic buffering agents, amino acid buffering agents, and combinations thereof.
  • a topical formulation comprises a tonicity adjusting agent.
  • the tonicity adjusting agent is selected from sodium chloride, sodium nitrate, sodium sulfate, sodium bisulfate, potassium chloride, calcium chloride, magnesium chloride, zinc chloride, potassium acetate, sodium acetate, sodium bicarbonate, sodium carbonate, sodium thiosulfate, magnesium sulfate, disodium hydrogen phosphate, sodium dihydrogen phosphate, potassium dihydrogen phosphate, dextrose, mannitol, sorbitol, dextrose, sucrose, urea, propylene glycol, glycerin, trehalose, and combinations thereof.
  • Formulations of lipid binding protein-based complexes intended for intraocular administration can include, for example, carriers, stabilizers, viscosifiers, osmolarity adjusting agents, buffers, and combinations thereof.
  • an intraocular formulation comprises an osmolarity adjusting agent.
  • An example of osmolarity adjusting agent is sodium chloride.
  • an intraocular formulation comprises a buffer agent.
  • buffer agents include borates, borate-polyol complexes, succinate, phosphate buffering agents, citrate buffering agents, acetate buffering agents, carbonate buffering agents, organic buffering agents, amino acid buffering agents, and combinations thereof.
  • a formulation comprising CER-001 (optionally where the CER-001 is used as a carrier for one or more ophthalmic drugs) can comprise CER-001 at a concentration of 0.5 mg/ml to 8 mg/ml on a protein weight basis (e.g., 0.5 mg/ml, 0.8 mg/ml, 1 mg/ml, 2 mg/ml, 3 mg/ml, 4 mg/ml, 5 mg/ml, 6 mg/ml, 7 mg/ml, 8 mg/ml, any range bounded by any two of the foregoing values).
  • a concentration of 0.5 mg/ml to 8 mg/ml on a protein weight basis (e.g., 0.5 mg/ml, 0.8 mg/ml, 1 mg/ml, 2 mg/ml, 3 mg/ml, 4 mg/ml, 5 mg/ml, 6 mg/ml, 7 mg/ml, 8 mg/ml, any range bounded by any two of the foregoing values).
  • a formulation comprising CER-001 can comprise CER-001 at a concentration of at least 1 mg/ml, at least 2 mg/ml, at least 3 mg/ml, at least 4 mg/ml, at least 5 mg/ml, at least 6 mg/ml, at least 7 mg/ml, or at least 8 mg/ml (on a protein weight basis).
  • Formulations of a lipid binding protein-based complex (e.g., CER-001) and one or more ophthalmic drugs can be produced, for example, by thermal cycling a mixture comprising the lipid binding protein-based complex and the one or more ophthalmic drugs.
  • the mixture can be (a) heated from a temperature in a first temperature range to a temperature in a second temperature range, then (b) cooled from a temperature in the second temperature range to a temperature in the first temperature range, then (c) optionally subjected to one or more additional heating and cooling cycles, e.g., for a total of two, three, four, five, or six heating and cooling cycles.
  • the mixture can be (a) cooled from a temperature in the second temperature range to a temperature in the first temperature range, then (b) heated from a temperature in the first temperature range to a temperature in the second temperature range, then (c) optionally subjected to one or more additional cooling and heating cycles, e.g., for a total of two, three, four, five, or six cooling and heating cycles.
  • the first temperature range can in some embodiments include temperatures from 30°C to 45°C (e.g., 35°C to 45°C, 30°C to 35°C, 35°C to 40°C, or 40°C to 45°C).
  • the second temperature range can in some embodiments include temperatures from 50°C to 65°C (e.g., 50°C to 60°C, 50°C to 55°C, or 55°C to 60°C).
  • the thermal cycling comprises thermal cycling between 37°C and 55°C, for example as described in Example 1. Accordingly, in some aspects, the disclosure provides compositions comprising a lipid binding protein-based complex, such as CER-001, and one or more ophthalmic drugs produced by a process comprising thermal cycling a mixture comprising the lipid binding protein-based complex and one or more ophthalmic drugs.
  • Subject populations [0217] Subjects who can be treated according to the methods described herein are preferably mammals, most preferably human.
  • the subject can be a subject in need of therapy for an eye disease, for example an eye disease associated with lipid accumulation, e.g., ocular lipid deposits.
  • lipid accumulation e.g., ocular lipid deposits.
  • the lipids may accumulate in the eye or near the eye.
  • Exemplary eye diseases associated with lipid accumulation that can be treated by the methods of the disclosure include dry eye disease, such as dry eye disease associated with Meibomian gland dysfunction or lacrimal gland dysfunction, blepharitis, uveitis, diseases of the cornea such as lipid keratopathy (e.g., secondary lipid keratopathy, for example lipid keratopathy secondary to previous ocular disease or injury) and corneal dystrophy (e.g., an inherited corneal dystrophy, an anterior or superficial corneal dystrophy, a stromal corneal dystrophy, or a posterior corneal dystrophy), eye diseases associated with LCAT deficiency such as fish-eye disease, dry macular degeneration (dry AMD), Stargardt disease and Leber’s idiopathic stellate neuroretinitis.
  • dry eye disease such as dry eye disease associated with Meibomian gland dysfunction or lacrimal gland dysfunction, blepharitis, uveitis
  • diseases of the cornea such as lipid keratopathy
  • Lipid deposits in the cornea can cause impairment, e.g., blurred vision.
  • the subject has an inflammatory eye disease such as uveitis (e.g., anterior uveitis, intermediate uveitis, posterior uveitis, or panuveitis) or scleritis.
  • uveitis e.g., anterior uveitis, intermediate uveitis, posterior uveitis, or panuveitis
  • scleritis e.g., anterior uveitis, intermediate uveitis, posterior uveitis, or panuveitis
  • the subject treated according to the methods and/or dosing regimens of the disclosure has an LCAT deficiency, optionally wherein the lipid binding protein-based complex used to treat the subject is CER-001.
  • the subject can be homozygous or heterozygous for a LCAT mutation.
  • the subject treated according to the methods and/or dosing regimens of the disclosure has fish-eye disease.
  • Subjects with fish-eye disease typically develop bilateral corneal opacity and can have visual impairment, e.g., decreased contrast sensitivity compared to normal and/or blurred vision.
  • Corneal opacity and its progression or regression e.g., in response to treatment as described herein can be qualitatively evaluated, for example by comparing slit lamp images of a subject’s eyes taken at different times.
  • Corneal opacity can also be evaluated quantitatively, for example by anterior segment optical coherence tomography (OCT) (see, Kanai et al., 2018, American Journal of Ophthalmology Case Reports, 10:137-141, incorporated herein by reference in its entirety).
  • OCT anterior segment optical coherence tomography
  • Visual function can be assessed, for example, by measuring a subject’s contrast sensitivity using a standard test chart (e.g., CSV-1000E chart; Vector Vision Co., Greenville, OH).
  • Straylight measurements can be used to quantify light scattering that results in a veil of straylight over the retinal image, which can lead to hazy vision or increased glare hindrance.
  • Straylight can be measured using a straylight meter (e.g.,C- Quant from Oculus GmbH, Wetzlar, Germany).
  • methods of the disclosure can reduce the severity of a subject’s fish eye disease, for example as measured by corneal opacity, contrast sensitivity, straylight values, or a combination thereof.
  • the subject does not have an LCAT deficiency.
  • the subject has an eye disease that is other than fish-eye disease, e.g., an eye disease described herein other than fish-eye disease, and optionally wherein the lipid binding protein-based complex used to treat the subject is CER-001.
  • the subject has a genetic disease such as Stargardt disease, optionally wherein the lipid binding protein-based complex used to treat the subject is CER-001.
  • the subject has macular degeneration, e.g., dry AMD or wet AMD, optionally wherein the lipid binding protein-based complex used to treat the subject is CER-001.
  • the subject has an eye disease which is other than macular degeneration, e.g., an eye disease described herein other than macular degeneration.
  • the subject has diabetic retinopathy, optionally wherein the lipid binding protein-based complex used to treat the subject is CER-001.
  • a subject with diabetic retinopathy has diabetic macular edema.
  • the subject has retinal vein occlusion.
  • the subject has dry eye disease (e.g., severe dry eye disease).
  • MGD Meibomian gland dysfunction
  • the subject has lacrimal gland dysfunction.
  • the subject has blepharitis.
  • the subject has uveitis (e.g., caused by a bacterial infection).
  • the subject has lipid keratopathy.
  • the lipid binding protein-based complex used to treat the subject having one of the eye diseases described in this paragraph is CER-001.
  • the subject has ocular lipid deposits comprising lipid deposits present in the eye and/or near the eye.
  • the lipid deposits are corneal lipid deposits, retinal lipid deposits, palpebral lipid deposits or a combination thereof.
  • the lipid binding protein-based complex used to treat the subject having one of the eye diseases described in this paragraph is CER-001.
  • the subject has lipid deposits in the cornea and/or in the retina. Lipid deposits in the cornea can cause vision impairment, e.g., blurred vision.
  • Lipids deposits in the retina can lead to degeneration of the retina.
  • the lipid binding protein-based complex used to treat the subject having one of the eye diseases described in this paragraph is CER-001.
  • the subject has palpebral lipid deposits, which are lipid deposits on the eyelids.
  • the lipid deposits are within Drusen deposits. Drusen are focal deposits of extracellular debris located between the basal lamina of the retinal pigment epithelium (RPE) and the inner collagenous layer of Bruch’s membrane.
  • RPE retinal pigment epithelium
  • drusen are of the hard type, which can be dome shaped with solid interiors and homogeneous contents, and a median diameter of 47 ⁇ m.
  • Hard drusen comprise lipid particles of about 60–90 nm in diameter containing abundant esterified cholesterol, unesterified cholesterol, phosphatidylcholine, and apolipoprotein B. The presence of a few hard drusen is normal with advancing age. The presence of larger and more numerous drusen in the macula is a common early sign of age-related macular degeneration (AMD).
  • the lipid deposits are lipofuscin granules. Lipofuscin granules accumulate in postmitotic RPE lysosomal compartments.
  • Lipofuscin granules mainly comprise N-retinylidene-N-retinyl-ethanolamine (A2E).
  • A2E N-retinylidene-N-retinyl-ethanolamine
  • the lipid deposits are cholesterol depots, especially cholesterol depots in the cornea.
  • cholesterol depots In individuals with genetic deficiency of LCAT, cholesterol accumulates within the extracellular connective tissue matrix of the cornea stroma. Usually, such cholesterol depots have 0.2 to 2.5 ⁇ m in diameter.
  • the ocular lipid deposits are not calcified.
  • the presence of ocular lipid deposits can be determined by one or more of slit lamp photography of the retina, Heidelberg retina tomograph (HRT) scan, optical coherence tomography (OCT), fundus autofluorescence imaging, eye fundus by slit lamp.
  • Drusen can be observed by slit lamp photography of the retina, HRT scan and/or OCT; lipofuscin granules can be observed by fundus autofluorescence imaging; and cholesterol depots in the cornea can be observed by slit lamp.
  • the use of the lipid binding protein complexes described herein can reduce the severity of a subject’s eye disease.
  • lipid binding protein complexes can solubilize lipids accumulated in ocular deposits, leading to their elimination.
  • use of the lipid binding protein complexes described herein can reduce the number of ocular lipid deposits. In some embodiments, use of the lipid binding protein complexes described herein can reduce the size of the ocular lipid deposits.
  • the reduction in number and/or in size of the lipid deposits can be qualitatively evaluated, for example by comparing the results of exams performed before the administration of a lipid binding protein complex and during or after administration, such as slit lamp photography of the retina, Heidelberg retina tomograph (HRT) scan, optical coherence tomography (OCT), fundus autofluorescence imaging, eye fundus by slit lamp.
  • the reduction in number and/or in size of the lipid deposits can also be quantitatively evaluated by above methods.
  • the reduction in number and/or in size of the lipid deposits can be indirectly determined by comparing the results measures of the corneal opacity, contrast sensitivity, straylight values, or a combination thereof, obtained before the administration of the lipoprotein complex and during or after administration.
  • the reduction of the severity of the eye disease can for example be measured by evaluation of corneal opacity, contrast sensitivity, straylight values, or a combination thereof.
  • the subject has impaired vision, including blurred vision, due to ocular lipid deposits and the amount of the lipoprotein complex is an amount which improves the subject’s vision.
  • the subject has corneal opacity due to lipid deposits in the cornea.
  • Treatment with a lipid binding protein complex described herein can reduce the opacity of the subject’s cornea(s).
  • Corneal opacity and its progression or regression e.g., in response to treatment as described herein
  • Corneal opacity and its progression or regression can be qualitatively evaluated, for example by comparing slit lamp images of a subject’s eyes taken at different times.
  • Corneal opacity can also be evaluated quantitatively, for example by anterior segment optical coherence tomography (OCT) (see, Kanai et al., 2018, American Journal of Ophthalmology Case Reports, 10:137-141, incorporated herein by reference in its entirety).
  • OCT anterior segment optical coherence tomography
  • Visual function can be assessed, for example, by measuring a patient’s contrast sensitivity using a standard test chart (e.g., CSV-1000E chart; Vector Vision Co., Greenville, OH). Straylight measurements can be used to quantify light scattering that results in a veil of straylight over the retinal image, which can lead to hazy vision or increased glare hindrance. Straylight can be measured using a straylight meter (e.g., C- Quant from Oculus GmbH, Wetzlar, Germany). [0243] In one embodiment, the amount of the lipid binding protein complex administered is an amount effective to reduce the opacity of the patient’s cornea(s).
  • a standard test chart e.g., CSV-1000E chart; Vector Vision Co., Greenville, OH.
  • Straylight measurements can be used to quantify light scattering that results in a veil of straylight over the retinal image, which can lead to hazy vision or increased glare hindrance. Stray
  • the amount of the lipid binding protein complex administered is effective to improve the patient’s contrast sensitivity. [0245] In one embodiment, the amount of the lipid binding protein complex administered is effective to reduce the patient’s straylight values. [0246] In other aspects, the subject has an eye disease (which can be, but is not necessarily a disease associated with lipid accumulation) and a lipid-binding protein- based complex is used as a drug carrier to deliver one or more ophthalmic drugs to the eye of the subject.
  • eye disease which can be, but is not necessarily a disease associated with lipid accumulation
  • a lipid-binding protein- based complex is used as a drug carrier to deliver one or more ophthalmic drugs to the eye of the subject.
  • the subject can have an anterior ocular condition or a posterior ocular condition, for example uveitis (e.g., caused by a bacterial infection), macular edema, macular degeneration, retinal detachment, an ocular tumor, a fungal infection, a viral infection, a bacterial infection such as bacterial conjunctivitis or trachoma, multifocal choroiditis, diabetic retinopathy, proliferative vitreoretinopathy (PVR), sympathetic ophthalmia, Vogt Koyanagi-Harada (VKH) syndrome, histoplasmosis, uveal diffusion, vascular occlusion, endophthalmitis, or glaucoma.
  • uveitis e.g., caused by a bacterial infection
  • macular edema e.g., caused by a bacterial infection
  • macular degeneration e.g., macular degeneration
  • retinal detachment e
  • CER-001 for use in treating uveitis
  • Inflammatory eye disease such as uveitis (e.g., anterior uveitis, intermediate uveitis, posterior uveitis, or panuveitis), which may or may not be caused by bacterial infection, can treated by the administration of CER-001.
  • the use of CER-001 to treat uveitis can be accomplished by administering a therapeutically effective amount of CER-001 to a subject in need thereof, e.g., an amount which reduces the severity of the uveitis (e.g., by alleviating one or more symptoms of the uveitis).
  • CER-001 can be suitably formulated for the intended route of administration.
  • CER- 001 For the treatment of uveitis, local administration of CER- 001 such as topical administration or intraocular administration to a subject in need thereof is preferred.
  • Intraocular administration can be by, for example, intraocular injection, for example intra-vitreal injection, sub-conjuctival injection, parabulbar injection, peribulbar injection or retro-bulbar injection.
  • CER- 001 can be administered, for example, as an eye drop. As shown in Examples 3 and 4, good ocular tolerance of CER-001 was observed even with repeated administrations.
  • CER-001 can be used for the treatment of uveitis in a subject in need thereof in accordance with the dosage regimen described in one or more of Sections 6.3,6.4, and 6.5 above.
  • CER-001 can be used for the treatment of uveitis in a subject in need thereof in accordance with a induction regimen described in Section 6.3.
  • CER-001 can be used for the treatment of uveitis in a subject in need thereof in accordance with a consolidation regimen described in Section 6.4.
  • CER-001 can be used for the treatment of uveitis in a subject in need thereof in accordance with a maintenance regimen described in Section 6.5.
  • CER-001 can be used for the treatment of uveitis in a subject in need thereof in accordance with an induction regimen described in Section 6.3; and/or a consolidation regimen described in Section 6.4; and/or a maintenance regimen described in Section 6.5. 6.2.2.
  • inflammatory eye disease such as uveitis (e.g., anterior uveitis, intermediate uveitis, posterior uveitis, or panuveitis), which may or may not be caused by bacterial infection, can treated by the administration of a composition comprising CER-001 and dexamethasone, a composition comprising CER-001 and dexamethasone palmitate, or a composition comprising CER-001 and tacrolimus.
  • compositions to treat uveitis can be accomplished by administering a therapeutically effective amount of the composition to a subject in need thereof, e.g., an amount which reduces the severity of the uveitis (e.g., by alleviating one or more symptoms of the uveitis).
  • the composition can be suitably formulated for the intended route of administration. Exemplary formulations are described in Section 6.1.9.
  • local administration of the composition such as topical administration or intraocular administration to a subject in need thereof is preferred.
  • Intraocular administration can be by, for example, intraocular injection, for example intra-vitreal injection, sub-conjuctival injection, parabulbar injection, peribulbar injection or retro-bulbar injection.
  • the composition can be administered, for example, as an eye drop. As shown in Examples 3 and 4, good ocular tolerance of such compositions was observed even with repeated administrations.
  • a composition comprising CER-001 and dexamethasone, a composition comprising CER-001 and dexamethasone palmitate, or a composition comprising CER-001 and tacrolimus can be used for the treatment of uveitis in a subject in need thereof in accordance with the dosage regimen described in one or more of Sections 6.3,6.4, and 6.5 above.
  • the composition can be used for the treatment of uveitis in a subject in need thereof in accordance with a induction regimen described in Section 6.3.
  • the composition can be used for the treatment of uveitis in a subject in need thereof in accordance with a consolidation regimen described in Section 6.4.
  • the composition can be used for the treatment of uveitis in a subject in need thereof in accordance with a maintenance regimen described in Section 6.5.
  • the composition can be used for the treatment of uveitis in a subject in need thereof in accordance with an induction regimen described in Section 6.3; and/or a consolidation regimen described in Section 6.4; and/or a maintenance regimen described in Section 6.5.
  • compositions comprising CER-001 and dexamethasone and compositions comprising CER-001 and dexamethasone palmitate can also be used to treat other eye diseases such as macular degeneration and dry macular edema (e.g., by alleviating one or more symptoms of the disease).
  • Compositions comprising CER-001 and tacrolimus can also be used to treat other eye diseases, for example dry eye disease, e.g., severe dry eye disease (e.g., by alleviating one or more symptoms of the disease).
  • compositions comprising CER-001 and dexamethasone, compositions comprising CER-001 and dexamethasone palmitate, and compositions comprising CER- 001 and tacrolimus can in some embodiments be made by thermal cycling a mixture comprising CER-001 and the respective drug, for example as described in Section 6.1.9. 6.3. Induction Regimen [0253] Induction regimens suitable for use in the methods of the disclosure entail administering multiple doses of a lipid binding protein-based complex (e.g., CER-001) separated by 1 or more day between each administration.
  • a lipid binding protein-based complex e.g., CER-001
  • the induction regimens typically include at least three doses of a lipid binding protein-based complex (e.g., CER-001) but can include four or more doses of a lipid binding protein-based complex (e.g., CER-001), e.g., five, six, seven, eight, nine, ten, eleven or twelve doses.
  • the induction regimens can last one or more weeks, two or more weeks, three or more weeks, four or more weeks, five or more weeks, six or more weeks, seven or more weeks, eight or more weeks, nine or more weeks, or ten or more weeks.
  • the induction regimen can comprise administering: three doses of a lipid binding protein-based complex (e.g., CER-001) over one week; three doses of a lipid binding protein-based complex (e.g., CER-001) over two weeks; three doses of a lipid binding protein-based complex (e.g., CER-001) over three weeks; four doses of a lipid binding protein-based complex (e.g., CER-001) over two weeks; four doses of a lipid binding protein-based complex (e.g., CER-001) over three weeks; five doses of a lipid binding protein-based complex (e.g., CER-001) over two weeks; five doses of a lipid binding protein-based complex (e.g., CER-001) over three weeks; five doses of a lipid binding protein-based complex (e.g., CER-001) over four weeks; six doses of a lipid binding protein-based complex (e.g., CER
  • the induction regimen comprises two doses of a lipid binding protein-based complex (e.g., CER-001) per week to five doses per week.
  • the induction regimen comprises administering nine doses of a lipid binding protein-based complex (e.g., CER-001) over three weeks, e.g., on days 1, 2, 4, 7, 9, 11, 14, 16, and 18.
  • an administration window can be provided, for example, to accommodate slight variations to a multi-dosing per week dosing schedule. For example, a window of ⁇ 2 days or ⁇ 1 day around the dosage date can be used.
  • a therapeutic dose of a lipid binding protein-based complex (e.g., CER-001) administered by infusion in the induction regimen can range from 4 to 30 mg/kg on a protein weight basis (e.g., 4, 5, 6, 7, 8, 9, 10, 1215, 20, 25, or 30 mg/kg, or any range bounded by any two of the foregoing values, e.g., 5 to 15 mg/kg, 10 to 20 mg/kg, or 15 to 25 mg/kg).
  • a protein weight basis e.g., 4, 5, 6, 7, 8, 9, 10, 1215, 20, 25, or 30 mg/kg, or any range bounded by any two of the foregoing values, e.g., 5 to 15 mg/kg, 10 to 20 mg/kg, or 15 to 25 mg/kg.
  • protein weight basis means that a dose of a lipid binding protein-based complex (e.g., CER-001) to be administered to a subject is calculated based upon the amount of lipid binding protein (e.g., ApoA-I) in the a lipid binding protein-based complex (e.g., CER-001) to be administered and the weight of the subject. For example, a subject who weighs 70 kg and is to receive a 10 mg/kg dose of CER-001 would receive an amount of CER-001 that provides 700 mg of ApoA-I (70 kg x 10 mg/kg).
  • a lipid binding protein-based complex e.g., CER-001
  • the dose of a lipid binding protein-based complex (e.g., CER-001) used in the induction regimen is 8 mg/kg.
  • the induction regimen comprises nine doses of a lipid binding protein-based complex (e.g., CER-001) administered over three weeks at a dose of 8 mg/kg.
  • the dose of a lipid binding protein-based complex (e.g., CER-001) used in the induction regimen is 10 mg/kg.
  • the dose of a lipid binding protein-based complex (e.g., CER-001) used in the induction regimen is 15 mg/kg.
  • the dose of a lipid binding protein-based complex (e.g., CER-001) used in the induction regimen is 20 mg/kg.
  • the induction regimen comprises nine doses of a lipid binding protein-based complex (e.g., CER-001) administered over three weeks at a dose of 10 mg/kg.
  • the dose of a lipid binding protein-based complex used to deliver an ophthalmic drug can be a dose that delivers a therapeutically effective amount of the drug.
  • a lipid binding protein-based complex (e.g., CER-001) can be administered on a unit dosage basis.
  • the unit dosage used in the induction phase can vary from 300 mg to 3000 mg per administration by infusion.
  • the dosage of a lipid binding protein-based complex (e.g., CER-001) used during the induction phase is 300 mg to 1500 mg, 400 mg to 1500 mg, 500 mg to 1200 mg, or 500 mg to 1000 mg per administration by infusion.
  • a lipid binding protein-based complex e.g., CER- 001
  • a stock solution of CER-001 can be diluted in normal saline such as physiological saline (0.9% NaCl) to a total volume between 125 and 250 ml.
  • subjects weighing less than 80 kg will have a total volume of 125 ml whereas subjects weighing at least 80 kg will have a total volume of 250 ml.
  • a lipid binding protein-based complex (e.g., CER-001) may be administered over a one-hour period using an infusion pump at a fixed rate of 250 ml/hr.
  • administration can be by slow infusion with a duration of more than one hour (e.g., up to two hours), by rapid infusion of one hour or less, or by a single bolus injection.
  • a lipid binding protein-based complex (e.g., CER- 001) is administered locally to the eye, for example, by intraocular injection or topical administration.
  • a stock solution of a lipid binding protein-based complex (e.g., CER- 001) can be diluted in a suitable diluent prior to administration.
  • suitable diluents include normal saline such as physiological saline (0.9% NaCl).
  • the lipid binding protein-based complex is formulated as an eye drop. 6.4.
  • Consolidation regimens suitable for use in the methods of the disclosure entail administering multiple doses of a lipid binding protein-based complex (e.g., CER-001) separated by 1 day or greater between each dose e.g., 2 days for greater between each administration.
  • the consolidation regimens typically include at least two doses of a lipid binding protein-based complex (e.g., CER-001) but can include three or more doses of a lipid binding protein-based complex (e.g., CER-001), e.g., four, five, six, seven, eight, nine or ten.
  • the consolidation regimens can last one or more weeks, two or more weeks, three or more weeks, four or more weeks, five or more weeks, six or more weeks, seven or more weeks, eight or more weeks, nine or more weeks, or ten or more weeks.
  • the consolidation regimen can comprise administering: two doses of a lipid binding protein-based complex (e.g., CER-001) over one week; two doses of a lipid binding protein-based complex (e.g., CER-001) over two weeks; three doses of a lipid binding protein-based complex (e.g., CER-001) over two weeks; three doses of a lipid binding protein-based complex (e.g., CER-001) over three weeks; four doses of a lipid binding protein-based complex (e.g., CER-001) over two weeks; four doses of a lipid binding protein-based complex (e.g., CER-001) over three weeks; five doses of a lipid binding protein-based complex (e.g.
  • the consolidation regimen comprises two doses of a lipid binding protein-based complex (e.g., CER-001) per week to five doses per week.
  • the consolidation regimen comprises administering six doses of a lipid binding protein-based complex (e.g., CER-001) over three weeks, e.g., on days 21, 24, 28, 31, 35 and 38 of a treatment regimen that begins with an induction regimen on day 1.
  • an administration window can be provided, for example, to accommodate slight variations to a multi-dosing per week dosing schedule. For example, a window of ⁇ 2 days or ⁇ 1 day around the dosage date can be used.
  • a therapeutic dose of a lipid binding protein-based complex (e.g., CER-001) administered by infusion in the consolidation regimen can range from 4 to 30 mg/kg on a protein weight basis (e.g., 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, or 30 mg/kg, or any range bounded by any two of the foregoing values, e.g., 5 to 15 mg/kg, 10 to 20 mg/kg, or 15 to 25 mg/kg).
  • the dose of a lipid binding protein-based complex (e.g., CER-001) used in the consolidation regimen is 8 mg/kg.
  • the consolidation regimen comprises six doses of a lipid binding protein-based complex (e.g., CER-001) administered over three weeks at a dose of 8 mg/kg.
  • the dose of a lipid binding protein-based complex (e.g., CER-001) used in the consolidation regimen is 10 mg/kg.
  • the dose of a lipid binding protein-based complex (e.g., CER-001) in the consolidation regimen is 15 mg/kg.
  • the dose of a lipid binding protein-based complex (e.g., CER-001) used in the consolidation regimen is 20 mg/kg.
  • the consolidation regimen comprises six doses of a lipid binding protein-based complex (e.g., CER-001) administered over three weeks at a dose of 10 mg/kg.
  • the dose of a lipid binding protein-based complex used to deliver an ophthalmic drug can be a dose that delivers a therapeutically effective amount of the drug.
  • a lipid binding protein-based complex e.g., CER-001
  • the unit dosage used in the consolidation phase can vary from 300 mg to 3000 mg per administration by infusion.
  • the dosage of a lipid binding protein-based complex (e.g., CER-001) used during the consolidation phase is 300 mg to 1500 mg, 400 mg to 1500 mg, 500 mg to 1200 mg, or 500 mg to 1000 mg per administration by infusion.
  • the dose of the a lipid binding protein-based complex (e.g., CER-001) administered during the consolidation phase is greater than the dose of the a lipid binding protein-based complex (e.g., CER-001) administered during the induction phase.
  • the dose administered in the consolidation phase can be 1.5 to 3 times the dose administered in the induction phase.
  • the dose of a lipid binding protein-based complex (e.g., CER-001) administered in the consolidation phase is 2 times the dose of the lipid binding protein-based complex (e.g., CER-001) administered in the consolidation phase.
  • Increasing the dose in the consolidation phase can offset the reduced frequency of dosing.
  • the dose of the lipid binding protein-based complex (e.g., CER-001) administered during the consolidation phase is the same as the dose of the lipid binding protein-based complex (e.g., CER-001) administered during the induction phase.
  • the lipid binding protein-based complex (e.g., CER-001) can be administered during the consolidation phase in the same manner as described in Section 6.3, e.g., as an IV infusion over a one-hour period or administered locally such as intraocular or topical administration.
  • the dose of lipid binding protein-based complex (e.g., CER-001) administered during the consolidation phase is larger than the dose administered in the induction phase, the lipid binding protein-based complex (e.g., CER-001) can optionally be administered in a larger volume and/or infused and/or administered over a longer period of time.
  • a maintenance regimen comprises administering a lipid binding protein-based complex (e.g., CER-001) to a subject on a less frequent basis than during the induction phase and/or the consolidation phase.
  • the lipid binding protein-based complex (e.g., CER-001) is administered once every 3 or more days, for example once every week or twice a week, during the maintenance regimen.
  • the maintenance regimen can entail administering the lipid binding protein- based complex (e.g., CER-001) for one month or longer, two months or longer, three months or longer, six months or longer, nine months or longer, a year or longer, 18 months or longer, two years or longer, or indefinitely.
  • the maintenance regimen comprises administering a lipid binding protein-based complex (e.g., CER-001) once every 5 days to one week for at least 16 weeks.
  • the maintenance regimen comprises administering a lipid binding protein-based complex (e.g., CER-001) once every week for at least 20 weeks, for at least 30 weeks, or for at least 40 weeks.
  • a lipid binding protein-based complex e.g., CER-001
  • an administration window can also be used in the maintenance regimen to accommodate slight variations to a weekly dosing schedule. For example, a window of ⁇ 2 days or ⁇ 1 day around the weekly date can be used.
  • a therapeutic dose of a lipid binding protein-based complex (e.g., CER-001) administered by infusion in the maintenance regimen can range from 4 to 30 mg/kg on a protein weight basis (e.g., 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, or 30 mg/kg, or any range bounded by any two of the foregoing values, e.g., 5 to 15 mg/kg, 10 to 20 mg/kg, or 15 to 25 mg/kg ).
  • a subject who weighs 70 kg and is to receive a 10 mg/kg dose of CER-001 would receive an amount of CER-001 that provides 700 mg of ApoA- I (70 kg x 10 mg/kg).
  • the dose of lipid binding protein-based complex (e.g., CER-001) used in the maintenance regimen is 8 mg/kg. In some embodiments, the dose of lipid binding protein-based complex (e.g., CER-001) used in the maintenance regimen is 10 mg/kg. In some embodiments, the dose of lipid binding protein-based complex (e.g., CER-001) used in the consolidation regimen is 15 mg/kg. In some embodiments, the dose of lipid binding protein-based complex (e.g., CER-001) used in the consolidation regimen is 20 mg/kg.
  • the dose of a lipid binding protein- based complex used to deliver an ophthalmic drug can be a dose that delivers a therapeutically effective amount of the drug.
  • a lipid binding protein-based complex (e.g., CER-001) can be administered on a unit dosage basis.
  • the unit dosage used in the maintenance phase can vary from 300 mg to 3000 mg per administration by infusion.
  • the dosage of a lipid binding protein-based complex (e.g., CER-001) used during the maintenance phase is 300 mg to 1500 mg, 400 mg to 1500 mg, 500 mg to 1200 mg, or 500 mg to 1000 mg per administration by infusion.
  • the dose of the lipid binding protein-based complex (e.g., CER-001) administered during the maintenance phase is greater than the dose of the lipid binding protein-based complex (e.g., CER-001) administered during the induction phase and/or consolidation phase.
  • the dose administered in the maintenance phase can be 1.5 to 3 times the dose administered in the consolidation phase.
  • the dose of lipid binding protein-based complex (e.g., CER-001) administered in the maintenance phase is 2 times the dose of the lipid binding protein-based complex (e.g., CER-001) administered in the consolidation phase.
  • Increasing the dose in the maintenance phase can offset the reduced frequency of dosing.
  • the dose of the lipid binding protein-based complex (e.g., CER-001) administered during the maintenance phase is the same as the dose of the lipid binding protein-based complex (e.g., CER-001) administered during the induction phase and/or consolidation phase.
  • the dose administered in the maintenance phase can be adjusted, for example increased or decreased, for example to reach dose that stabilizes a clinical parameter (e.g., corneal opacity).
  • the administration frequency in the maintenance phase can be adjusted, for example increasing or decreasing the frequency, for example to achieve stabilization of a clinical parameter (e.g., corneal opacity).
  • a lipid binding protein-based complex (e.g., CER-001) can be administered during the maintenance phase in the same manner as described in Section 6.3, e.g., as an IV infusion or administered locally such as intraocular or topical administration.
  • the dose of lipid binding protein-based complex (e.g., CER-001) administered during the maintenance phase is larger than the dose administered in the consolidation phase, the lipid binding protein-based complex (e.g., CER-001) can optionally be administered in a larger volume and/or infused and/or administered over a longer period of time.
  • the administration volume can be increased (e.g., doubled) and/or the infusion time can be increased (e.g., doubled).
  • lipid binding protein-based complex e.g., CER-001
  • a lipid binding protein-based complex e.g., CER-001
  • one or more lipid control medications such as a statin (e.g., atorvastatin, rosuvastatin, simvastatin, fluvastatin, lovastatin, pravastatin), a cholesterol absorption inhibitor (e.g., ezetimibe), niacin, aspirin, a proprotein convertase subtilisin/kexin type 9 (PCSK9) inhibitor (e.g., an antibody such as alirocumab, bococizumab, evolocumab, 1D05-IgG2 (Ni et al., 2011, J Lipid Res.
  • a statin e.g., atorvastatin, rosuvastatin, simvastatin, fluvastatin, lovastatin, pravastatin
  • a subject with fish-eye disease can be treated with one or more lipid control medications in combination with a lipid binding protein- based complex.
  • a combination therapy comprises a lipid binding protein-based complex (e.g., CER-001) in combination with a standard of care treatment for the subject’s eye disease.
  • a combination therapy regimen can entail administering a lipid binding protein- based complex (e.g., CER-001) in combination with one or more of the foregoing medicines and/or one or more of the foregoing classes of medications.
  • the subject is treated with a lipid binding protein-based complex (e.g., CER-001) in combination with atorvastatin.
  • the subject is treated with a lipid binding protein-based complex (e.g., CER-001) in combination with ezetimibe.
  • the subject is treated with a lipid binding protein- based complex (e.g., CER-001) in combination with niacin.
  • the subject is treated with a lipid binding protein-based complex (e.g., CER-001) in combination with rosuvastatin. In some embodiments, the subject is treated with a lipid binding protein-based complex (e.g., CER-001) in combination with simvastatin. In some embodiments, the subject is treated with a lipid binding protein-based complex (e.g., CER-001) in combination with aspirin. In some embodiments, the subject is treated with a lipid binding protein-based complex (e.g., CER-001) in combination with fluvastatin.
  • a lipid binding protein-based complex e.g., CER-001
  • fluvastatin fluvastatin
  • the subject is treated with a lipid binding protein- based complex (e.g., CER-001) in combination with lovastatin. In some embodiments, the subject is treated with a lipid binding protein-based complex (e.g., CER-001) in combination with pravastatin. In some embodiments, the subject is treated with a lipid binding protein-based complex (e.g., CER-001) in combination with alirocumab. In some embodiments, the subject is treated with a lipid binding protein-based complex (e.g., CER-001) in combination with evolocumab.
  • the subject is treated with a lipid binding protein-based complex (e.g., CER-001) in combination with ALN-PCSsc.
  • the lipid control medicine can be the only lipid control medicine that the subject receives in combination with lipid binding protein-based complex therapy, or can be part of a combination of lipid control medicines administered in combination with the lipid binding protein-based complex.
  • a lipid binding protein-based complex e.g., CER-001
  • an antihypertensive medication e.g., one, two, or all three of amlodipine, urapidil, and furosemide.
  • a lipid binding protein-based complex (e.g., CER-001) is administered in combination with amlodipine, urapidil, and furosemide.
  • the combination further comprises a statin, e.g., atorvastatin.
  • a lipid binding protein-based complex e.g., CER-001
  • a background lipid lowering therapy started before therapy with a lipid binding protein-based complex (e.g., CER-001).
  • the subject is treated with a stable dose of a lipid control medication for at least 6 weeks (e.g., 6 weeks, 8 weeks, 2 months, 6 months, 1 year, or more than one year) before beginning therapy with a lipid binding protein-based complex (e.g., CER-001) according to a dosing regimen of the disclosure.
  • a lipid binding protein-based complex e.g., CER-001
  • a lipid binding protein-based complex (e.g., CER-001) therapy can be started before or concurrently with treatment with one or more lipid control medications.
  • Example 1 CER-001 as a carrier for ophthalmic drugs 7.1.1.
  • Azithromycin and spironolactone are an antibiotic used to treat bacterial infections of the eye such as bacterial conjunctivitis and trachoma (www.mayoclinic.org/drugs- supplements/azithromycin-ophthalmic-route/description/drg-20070979).
  • Spironolactone is steroid which has been investigated for the treatment of meibomian gland dysfunction and associated dry eye (Yee et al., 2016, Investigative Ophthalmology & Visual Science 57(12):5664). A study was conducted to evaluate the suitability of CER-001 to act as a drug carrier for the delivery of azithromycin and spironolactone.
  • a solution of CER-001 was mixed with azithromycin to provide a final azithromycin concentration of 10 mg/ml and subjected to five heating and cooling cycles from 37°C to 55°C to promote complexation of azithromycin to CER-001.
  • a sample of CER-001 without added azithromycin and a sample of azithromycin at a concentration of 10 mg/ml in phosphate buffered saline (PBS) were similarly subjected to five heating and cooling cycles from 37°C to 55°C. As shown in FIG.
  • the sample of CER-001 without azithromycin (left tube) remained clear following the heating and cooling cycles, while the sample of azithromycin in PBS (right tube) contained numerous crystals in the liquid and on the glass tube.
  • the sample of CER-001 with azithromycin (middle tube) was cloudier than the pure CER-001 sample, but contained significantly fewer azithromycin crystals than the sample of azithromycin in PBS.
  • a solution of CER-001 was mixed with spironolactone to provide a final spironolactone concentration of 1.5 mg/ml and subjected to five heating and cooling cycles from 37°C to 55°C to promote complexation of spironolactone to CER-001.
  • a sample of CER-001 without added spironolactone and a sample of spironolactone at a concentration of 1.5 mg/ml in phosphate buffered saline (PBS) were similarly subjected to five heating and cooling cycles from 37°C to 55°C.
  • PBS phosphate buffered saline
  • Dexamethasone palmitate is a lipophilic prodrug of dexamethasone and can be used to treat macular edema (Daull et al., 2013, J. Ocul Pharmacol Ther. 29(2):258-69). A study was conducted to evaluate the suitability of CER-001 to act as a drug carrier for the delivery of dexamethasone palmitate.
  • a solution of CER-001 was mixed with dexamethasone palmitate to provide a final dexamethasone palmitate concentration of 1 mg/ml and subjected to five heating and cooling cycles from 37°C to 55°C to promote complexation of dexamethasone palmitate to CER-001.
  • a sample of CER-001 without added dexamethasone palmitate and a sample of dexamethasone palmitate at a concentration of 1 mg/ml in phosphate buffered saline (PBS) were similarly subjected to five heating and cooling cycles from 37°C to 55°C. As shown in FIG.
  • Cyclosporine is an immunomodulator used to increase tear production in subjects with dry eye (Ames and Galor, 2015, Clin Investig (Longd.) 5(3):267-285).
  • a solution of CER-001 was mixed with cyclosporine to provide a final cyclosporine concentration of 1 mg/ml and subjected to five heating and cooling cycles from 37°C to 55°C to promote complexation of cyclosporine to CER-001.
  • a sample of CER-001 without added cyclosporine and a sample of cyclosporine at a concentration of 1 mg/ml in phosphate buffered saline (PBS) were similarly subjected to five heating and cooling cycles from 37°C to 55°C. As shown in FIG.
  • Example 2 CER-001 therapy for LCAT deficiency-related vision impairment
  • a subject with LCAT deficiency and having vision impairment related to the subject’s LCAT deficiency (said vision impairment being due to ocular lipid deposits) was administered CER-001 according to a treatment regimen comprising an induction regimen, a consolidation regimen, and a maintenance regimen.
  • a treatment regimen comprising an induction regimen, a consolidation regimen, and a maintenance regimen.
  • the subject Prior to treatment with CER-001, the subject had ocular lipid deposits presenting as white corneal ring opacities. The subject had normal visual acuity but visual blur, especially at night. Slit-lamp examination and optical computerized tomography showed hyperreflective corneal opacification (data not shown).
  • Next-generation sequencing confirmed the subject as compound-heterozygous for two LCAT gene variations, but none in the ABCA1 or APOA1 genes.
  • the first allele, motherly inherited, is an exon-5 (c.605T>C) missense mutation p.(Ile202Thr), previously well-established as familial LCAT deficiency (FLD)-causing in Europe.
  • the paternal allele (c.154+5G>C) was novel and absent from general referral population databases. It alters a highly evolutionary-conserved residue of intron-1 donor splice-site, thereby potentially altering exon-1 mRNA-splicing and creating a cryptic acceptor splice-site at position c.154+15.
  • the induction regimen comprised nine doses of CER-001 administered over three weeks.
  • the dose of CER-001 administered in the induction regimen was 10 mg/kg, calculated based upon the amount of ApoA-I in the CER-001 administered and the weight of the subject.
  • the subject was administered CER-001 according to a consolidation regimen comprising seven doses of CER-001 administered over four weeks.
  • the dose of CER-001 administered in the induction regimen was 10 mg/kg, calculated based upon the amount of ApoA-I in the CER-001 administered and the weight of the subject.
  • CER-001 Following the consolidation regimen, the subject was administered CER-001 according to a maintenance regimen comprising once a week administration of CER- 001 for three weeks.
  • the dose of CER-001 administered in the maintenance regimen was 10 mg/kg calculated based upon the amount of ApoA-I in the CER-001 to be administered and the weight of the subject. Thereafter, the dose was increased to 20 mg/kg once weekly for six weeks.
  • the treatment period was 5 months and was followed by a 3 months off-treatment follow-up period.
  • CER-001 was administered as an IV infusion after premedication with hydroxyzine.
  • CER-001 A stock solution of CER-001 was diluted in physiological saline (0.9% NaCl) prior to administration, and all doses of CER-001 were administered using an infusion pump over one hour at a fixed rate of 250 ml/hr.
  • CER-001 administered by infusion appears to have reached the anterior segment of the subject’s eyes, including the cornea, where it exerted a therapeutic effect.
  • the observed effect on the subject’s vision is due to the ability of CER-001, even when peripherally administered, to mobilize accumulated lipids in and/or around the eye (e.g., directly or indirectly). Additionally, again without being bound by theory, it is believed that the anti-inflammatory properties of CER-001 may have contributed to the observed effect on the subject’s vision. [0307] It is further believed, again without being bound by theory, that subjects suffering from other eye diseases, particularly those associated with accumulation of lipids, can similarly benefit from treatment with CER-001 or another lipid binding protein-based complex.
  • Example 3 Ocular tolerance of CER-001 in rabbits
  • Ocular tolerance of CER-001 was assessed in albino rabbits.
  • Example 4 CER-001 treatment of endotoxin-induced uveitis (severe inflammation) in rabbits
  • DXP complexed dexamethasone palmitate
  • IVT single intravitreal injection
  • Tolerance was assessed by the McDonald-Shadduck scoring system (see, Eaton et al., Journal of Ocular Pharmacology and Therapeutics 33(10):718- 734) 6 and 24 hours after administration. Cell infiltration and protein content in the aqueous humor were measured 24 hours after administration.
  • Tolerance for the different treatment groups is shown in FIGS. 2A-2C, while aqueous humor cell infiltration and protein content are shown in FIGS. 3A-3B, respectively.
  • a method of treating a subject with an eye disease comprising administering to the subject an amount of a lipid binding protein-based complex effective to reduce the severity of the eye disease, optionally complexed with one or more ophthalmic drugs.
  • the eye disease is a disease associated with lipid accumulation.
  • the eye disease is fish-eye disease.
  • the eye disease is lipid keratopathy.
  • the lipid keratopathy is secondary lipid keratopathy. 6.
  • the eye disease is corneal dystrophy, for example an inherited corneal dystrophy, an anterior or superficial corneal dystrophy, a stromal corneal dystrophy, or a posterior corneal dystrophy.
  • the subject has corneal opacity and wherein the amount of the lipid binding protein-based complex is an amount effective to reduce the opacity of the subject’s cornea(s).
  • opacity is measured by anterior segment optical coherence tomography (OCT).
  • OCT anterior segment optical coherence tomography
  • 21. The method of embodiment 20, wherein the uveitis is anterior uveitis, intermediate uveitis, posterior uveitis, or panuveitis. 22.
  • the eye disease is macular edema, macular degeneration, retinal detachment, an ocular tumor, a fungal infection, a viral infection, a bacterial infection (e.g., bacterial conjunctivitis or trachoma), multifocal choroiditis, diabetic retinopathy, proliferative vitreoretinopathy (PVR), sympathetic ophthalmia, Vogt Koyanagi-Harada (VKH) syndrome, histoplasmosis, uveal diffusion, vascular occlusion, endophthalmitis, or glaucoma.
  • the eye disease is dry macular degeneration.
  • the method of embodiment 1 or embodiment 2, wherein the eye disease is wet macular degeneration.
  • 30. The method of embodiment 1 or embodiment 2, wherein the eye disease is diabetic retinopathy, optionally wherein the subject has diabetic macular edema.
  • 31. The method of embodiment 1 or embodiment 2, wherein the eye disease is Stargardt disease.
  • 32. The method of any one of embodiments 1 to 31, wherein the subject has impaired vision due to the eye disease and the amount of the lipid binding protein-based complex is an amount which improves the subject’s vision.
  • 33. The method of any one of embodiments 1 to 32, wherein the subject has ocular lipid deposits. 34.
  • the ocular lipid deposits comprise corneal lipid deposits, retinal lipid deposits, palpebral lipid deposits or a combination thereof.
  • 35. The method of embodiment 34, wherein the ocular lipid deposits comprise corneal lipid deposits.
  • 36. The method of embodiment 34 or embodiment 35, wherein the ocular lipid deposits comprise retinal lipid deposits.
  • 37. The method of any one of embodiments 34 to 36, wherein the ocular lipid deposits comprise palpebral lipid deposits.
  • 38. The method of any one of embodiments 33 to 37, wherein the ocular lipid deposits are not calcified. 39.
  • 39. The method of any one of embodiments 33 to 38, wherein the lipid deposits comprise lipid deposits within drusen deposits. 40.
  • lipid deposits comprise lipofuscin granules.
  • the lipid deposits comprise cholesterol depots.
  • the method of any one of embodiments 33 to 41 which comprises administering to the subject an amount of a lipid binding protein-based complex effective to reduce the size and/or number of ocular lipid deposits.
  • the lipid binding protein-based complex comprises apolipoprotein A-I (ApoA-I), optionally wherein the ApoA-I is not ApoA-IMilano 44.
  • lipid binding protein-based complex does not comprise an apolipoprotein mimetic.
  • the lipid binding protein-based complex is a reconstituted HDL or HDL mimetic.
  • the lipid binding protein-based complex comprises CER-001. 47.
  • the CER-001 is a lipoprotein complex comprising ApoA-I and phospholipids in a ApoA-I weight:total phospholipid weight ratio of 1:2.7 +/- 20% and the phospholipids sphingomyelin and DPPG in a sphingomyelin:DPPG weight:weight ratio of 97:3 +/- 20%.
  • the CER-001 is a lipoprotein complex comprising ApoA-I and phospholipids in a ApoA-I weight:total phospholipid weight ratio of 1:2.7 +/- 10% and the phospholipids sphingomyelin and DPPG in a sphingomyelin:DPPG weight:weight ratio of 97:3 +/- 10%.
  • the CER-001 is a lipoprotein complex comprising ApoA-I and phospholipids in a ApoA-I weight:total phospholipid weight ratio of 1:2.7 and the phospholipids sphingomyelin and DPPG in a sphingomyelin:DPPG weight:weight ratio of 97:3. 50.
  • lipid binding protein-based complex comprises ETC-216.
  • lipid binding protein-based complex comprises CER-522.
  • the method of embodiment 45, wherein the lipid binding protein-based complex comprises delipidated HDL.
  • 65. The method of any one of embodiments 1 to 43, wherein the lipid binding protein-based complex is a Cargomer.
  • the method of any one of embodiments 1 to 65, wherein the lipid binding protein-based complex is a carrier for one or more ophthalmic drugs, optionally wherein one or more of the one or more ophthalmic drugs are (i) hydrophobic and/or (ii) poorly water soluble or water insoluble. 67.
  • the lipid binding protein-based complex comprises a lipid binding protein-based complex having one or more ophthalmic drugs complexed thereto, optionally wherein one or more of the one or more ophthalmic drugs are (i) hydrophobic and/or (ii) poorly water soluble or water insoluble. 68.
  • the one or more ophthalmic drugs comprise a steroid, a kinase inhibitor, an angiotensin II receptor antagonist, an aldose reductase inhibitor, an immunosuppressant, a carbonic anhydrase inhibitor, an antimicrobial agent, an antiviral agent, an antihistamine, an anti- inflammatory, a prostaglandin analog, or a combination thereof. 69.
  • any one of embodiments 66 to 68, wherein the one or more ophthalmic drugs comprise azithromycin, dexamethasone, difluprednate, estradiol, fluocinolone, fluorometholone, hydrocortisone, loteprednol etabonate, prednisolone, triamcinolone, rimexolone, spironolactone, axitinib, BMS-794833 (N-(4- ((2-amino-3-chloropyridin-4-yl)oxy)-3-fluorophenyl)-5-(4-fluorophenyl)-4-oxo-1,4- dihydropyridine-3-carboxamide), carbozantinib, cediranib, dovitinib, lapatinib, lenvatinib, motesanib, nintedanib, orantinib, PD173074 (N-[2-[[4- (
  • ophthalmic drugs comprise azithromycin, dexamethasone, difluprednate, estradiol, fluocinolone, fluorometholone, hydrocortisone, loteprednol etabonate, prednisolone, triamcinolone, rimexolone, spironolactone, axitinib, BMS-794833 (N-(4- ((2-amino-3-chloropyridin-4-yl)oxy)-3-fluorophenyl)-5-(4-fluorophenyl)-4-oxo-1,4- dihydropyridine-3-carboxamide), carbozantinib, cediranib, dovitinib, lapatinib, lenvatinib, motesanib, nintedanib, orantinib, PD173074 (N-[2-[[4[4]
  • any one of embodiments 66 to 74, wherein the one or more ophthalmic drugs comprise latanoprost, travaprost, bimatoprost, tafluprost, or a combination thereof.
  • the one or more ophthalmic drugs comprise latanoprost.
  • the one or more ophthalmic drugs comprise dexamethasone.
  • the one or more ophthalmic drugs comprise loteprednol etabonate 79.
  • any one of embodiments 66 to 78, wherein the one or more ophthalmic drugs comprise triamcinolone. 80. The method of any one of embodiments 66 to 79, wherein the one or more ophthalmic drugs comprise acyclovir. 81. The method of any one of embodiments 66 to 80, wherein the one or more ophthalmic drugs comprise travaprost. 82. The method of any one of embodiments 66 to 81, wherein the one or more ophthalmic drugs comprise bimatoprost. 83. The method of any one of embodiments 66 to 82, wherein the one or more ophthalmic drugs comprise tafluprost. 84.
  • any one of embodiments 66 to 83, wherein the one or more ophthalmic drugs comprise pazopanib. 85.
  • the method of any one of embodiments 66 to 84, wherein the one or more ophthalmic drugs comprise sirolimus.
  • the method of any one of embodiments 66 to 84, wherein the one or more ophthalmic drugs comprise tacrolimus.
  • the method of any one of embodiments 66 to 84, wherein the one or more ophthalmic drugs comprise nepafenac.
  • the method of embodiment 90 which comprises administering one or more doses of the lipid binding protein-based complex according to an induction regimen.
  • the method of embodiment 91, wherein the induction regimen comprises administering multiple doses of the lipid binding protein-based complex to the subject.
  • the method of embodiment 92, wherein the induction regimen comprises administering at least three doses of the lipid binding protein-based complex to the subject.
  • 94. The method of embodiment 92 or embodiment 93, in which multiple doses in the induction regimen are separated by 1 or more days.
  • 95. The method of any one any one of embodiments 91 to 94, wherein the doses following the initial dose of the induction regimen are separated by no more than 3 days.
  • 96. The method of embodiment 95, wherein the doses following the initial dose of the induction regimen are separated by one to three days.
  • 97. The method of embodiment 95, wherein the doses following the initial dose of the induction regimen are separated by two to three days. 98.
  • the induction regimen comprises administering four or more doses of the lipid binding protein-based complex to the subject.
  • the induction regimen comprises administering five or more doses of the lipid binding protein-based complex to the subject.
  • the induction regimen comprises administering six or more doses of the lipid binding protein-based complex to the subject.
  • the induction regimen comprises administering seven or more doses of the lipid binding protein-based complex to the subject. 107.
  • the induction regimen comprises administering eight or more doses of the lipid binding protein-based complex to the subject.
  • the induction regimen comprises administering nine or more doses of the lipid binding protein-based complex to the subject.
  • the induction regimen comprises administering the first dose of the lipid binding protein-based complex to the subject on day 1 and administering subsequent doses of the induction regimen to the subject on days 2, 4, 7, 9, 11, 14, 16, and 18.
  • the induction regimen comprises administering ten or more doses of the lipid binding protein-based complex to the subject. 111.
  • the method of embodiment 90 which does not include an induction regimen. 112.
  • the method of any one of embodiments 90 to 111 which comprises administering to the subject one or more doses of the lipid binding protein-based complex according to a consolidation regimen. 113.
  • the method of embodiment 112, wherein the consolidation regimen comprises administering multiple doses of the lipid binding protein-based complex to the subject.
  • the consolidation regimen comprises administering at least two doses of the lipid binding protein-based complex to the subject in one week. 116.
  • the consolidation regimen comprises administering five or more doses of the lipid binding protein-based complex to the subject.
  • the consolidation regimen comprises administering six or more doses of the lipid binding protein-based complex to the subject.
  • the consolidation regimen comprises administering six doses of the lipid binding protein-based complex to the subject.
  • the consolidation regimen comprises administering the six doses of the lipid binding protein-based complex to the subject on days 21, 24, 28, 31, 35, and 38 following an induction regimen which begins on day 1.
  • the consolidation regimen comprises administering seven or more doses of the lipid binding protein-based complex to the subject. 126. The method of any one of embodiments 112 to 118, wherein the consolidation regimen comprises administering eight or more doses of the lipid binding protein-based complex to the subject. 127. The method of any one of embodiments 112 to 118, wherein the consolidation regimen comprises administering nine or more doses of the lipid binding protein-based complex to the subject. 128. The method of any one of embodiments 112 to 118, wherein the consolidation regimen comprises administering ten or more doses of the lipid binding protein-based complex to the subject. 129.
  • the method of any one of embodiments 90 to 111 which does not include a consolidation regimen.
  • 130. The method of any one of embodiments 90 to 129, which comprises administering to the subject multiple doses of the lipid binding protein-based complex according to a maintenance regimen.
  • the maintenance regimen comprises administering a dose of the lipid binding protein-based complex to the subject once every 3 or more days.
  • 132. The method of embodiment 130, wherein the maintenance regimen comprises administering a dose of the lipid binding protein-based complex to the subject once every 5 or more days.
  • 133. The method of embodiment 130, wherein the maintenance regimen comprises administering a dose of the lipid binding protein-based complex to the subject weekly. 134.
  • the method of embodiment 130, wherein the maintenance regimen comprises administering a dose of the lipid binding protein-based complex to the subject twice weekly.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for at least one month.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for at least two months.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for at least three months. 139.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for at least six months.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for at least nine months.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for at least a year.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for at least 18 months. 143.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for at least 2 years.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject indefinitely.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for 16 or more weeks.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for 20 or more weeks. 147.
  • the method of any one of embodiments 130 to 135, wherein the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for 30 or more weeks.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for 40 or more weeks.
  • 149. The method of any one of embodiments 90 to 148, wherein the dose of the lipid binding protein-based complex administered in the induction regimen is 4 to 30 mg/kg (on a protein weight basis).
  • 150 The method of any one of embodiments 90 to 148, wherein the dose of the lipid binding protein-based complex administered in the induction regimen is 5 to 15 mg/kg (on a protein weight basis).
  • the method of any one of embodiments 90 to 148, wherein the dose of the lipid binding protein-based complex administered in the induction regimen is 10 to 20 mg/kg (on a protein weight basis).
  • the dose of the lipid binding protein-based complex administered in the induction regimen is 15 to 25 mg/kg (on a protein weight basis).
  • the dose of the lipid binding protein-based complex administered in the induction regimen is 8 mg/kg (on a protein weight basis).
  • the method of any one of embodiments 90 to 148, wherein the dose of the lipid binding protein-based complex administered in the induction regimen is 10 mg/kg (on a protein weight basis). 155. The method of any one of embodiments 90 to 148, wherein the dose of the lipid binding protein-based complex administered in the induction regimen is 300 mg to 3000 mg. 156. The method of any one of embodiments 90 to 148, wherein the dose of the lipid binding protein-based complex administered in the induction regimen is 300 mg to 1500 mg. 157. The method of any one of embodiments 90 to 148, wherein the dose of the lipid binding protein-based complex administered in the induction regimen is 400 mg to 1500 mg. 158.
  • the method of any one of embodiments 90 to 148, wherein the dose of the lipid binding protein-based complex administered in the induction regimen is 500 mg to 1200 mg. 159.
  • the method of any one of embodiments 90 to 148, wherein the dose of the lipid binding protein-based complex administered in the induction regimen is 500 mg to 1000 mg. 160.
  • the method of any one of embodiments 90 to 159, wherein the dose of the lipid binding protein-based complex administered in the consolidation regimen is 4 to 30 mg/kg (on a protein weight basis). 161.
  • the method of any one of embodiments 90 to 159, wherein the dose of the lipid binding protein-based complex administered in the consolidation regimen is 5 to 15 mg/kg (on a protein weight basis). 162.
  • the method of any one of embodiments 90 to 159, wherein the dose of the lipid binding protein-based complex administered in the consolidation regimen is 10 to 20 mg/kg (on a protein weight basis). 163. The method of any one of embodiments 90 to 159, wherein the dose of the lipid binding protein-based complex administered in the consolidation regimen is 15 to 25 mg/kg (on a protein weight basis). 164. The method of any one of embodiments 90 to 159, wherein the dose of the lipid binding protein-based complex administered in the consolidation regimen is 8 mg/kg (on a protein weight basis). 165. The method of any one of embodiments 90 to 159, wherein the dose of the lipid binding protein-based complex administered in the consolidation regimen is 10 mg/kg (on a protein weight basis). 166.
  • the method of any one of embodiments 90 to 159, wherein the dose of the lipid binding protein-based complex administered in the consolidation regimen is 300 mg to 3000 mg. 167.
  • the method of any one of embodiments 90 to 159, wherein the dose of the lipid binding protein-based complex administered in the consolidation regimen is 300 mg to 1500 mg. 168.
  • the method of any one of embodiments 90 to 159, wherein the dose of the lipid binding protein-based complex administered in the consolidation regimen is 400 mg to 1500 mg. 169.
  • the method of any one of embodiments 90 to 159, wherein the dose of the lipid binding protein-based complex administered in the consolidation regimen is 500 mg to 1200 mg. 170.
  • the method of any one of embodiments 90 to 159, wherein the dose of the lipid binding protein-based complex administered in the consolidation regimen is 500 mg to 1000 mg. 171.
  • the method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 4 to 30 mg/kg (on a protein weight basis).
  • the method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 5 to 15 mg/kg (on a protein weight basis). 173.
  • the method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 10 to 20 mg/kg (on a protein weight basis). 174.
  • the method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 15 to 25 mg/kg (on a protein weight basis). 175. The method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 8 mg/kg (on a protein weight basis). 176. The method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 10 mg/kg (on a protein weight basis). 177. The method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 20 mg/kg (on a protein weight basis). 178.
  • the method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 300 mg to 3000 mg. 179.
  • the method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 300 mg to 1500 mg. 180.
  • the method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 400 mg to 1500 mg. 181.
  • the method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 500 mg to 1200 mg. 182.
  • the method of any one of embodiments 90 to 170, wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is 500 mg to 1000 mg.
  • the method of embodiment 183, wherein the dose of the lipid binding protein-based complex administered in the induction regimen and the dose of the lipid binding protein-based complex administered in the maintenance regimen are the same.
  • the method of embodiment 183, wherein the dose of the lipid binding protein-based complex administered in the induction regimen and the dose of the lipid binding protein-based complex administered in the maintenance regimen are different.
  • the method of embodiment 185 wherein the dose of the lipid binding protein-based complex administered in the maintenance regimen is greater than the dose of the lipid binding protein-based complex administered in the induction regimen.
  • the dose of the lipid binding protein-based complex administered in the maintenance regimen is 1.5 to 3 times the dose of the lipid binding protein-based complex administered in the induction regimen.
  • the dose of the lipid binding protein-based complex administered in the maintenance regimen is 2 times the dose administered in the induction regimen.
  • the method of embodiment 189, wherein the lipid binding protein-based complex is administered intraocularly 191.
  • the method of embodiment 190, wherein the lipid binding protein-based complex is administered by intraocular injection.
  • the method of embodiment 191, wherein the intraocular injection is intra-vitreal injection. 193.
  • the method of embodiment 191, wherein the intraocular injection is sub- conjunctival injection. 194.
  • the method of embodiment 191, wherein the intraocular injection is parabulbar injection.
  • the method of embodiment 191, wherein the intraocular injection is peribulbar injection.
  • the method of embodiment 191, wherein the intraocular injection is retro-bulbar injection.
  • the method of embodiment 189, wherein the lipid binding protein-based complex is administered topically.
  • lipid binding protein-based complex is formulated as an eye drop.
  • lipid binding protein-based complex is administered according to a dosing regimen which comprises: (a) an induction regimen; and/or (b) a consolidation regimen; and/or (c) a maintenance regimen, optionally wherein the lipid binding protein-based complex is CER-001.
  • a dosing regimen which comprises: (a) an induction regimen; and/or (b) a consolidation regimen; and/or (c) a maintenance regimen, optionally wherein the lipid binding protein-based complex is CER-001.
  • the method of embodiment 199 which comprises an induction regimen.
  • 201 The method of embodiment 199 or embodiment 200, which comprises a consolidation regimen.
  • 202 The method of any one of embodiments 199 to 201, which comprises a maintenance regimen. 203.
  • 204. The method of any one of embodiments 1 to 203, wherein the subject is also treated with a lipid control medication.
  • 205. The method of embodiment 204, wherein the lipid control medication comprises a statin.
  • 206. The method of embodiment 205, wherein the statin is atorvastatin, rosuvastatin, simvastatin, fluvastatin, lovastatin, or pravastatin.
  • the lipid control medication comprises a cholesterol absorption inhibitor. 208.
  • PCSK9 inhibitor is an antibody. 213.
  • the method of embodiment 212, wherein the antibody is alirocumab, bococizumab, evolocumab, 1D05-IgG2 or LY3015014.
  • the PCSK9 inhibitor is RNAi therapeutic. 215.
  • the method of embodiment 214, wherein the RNAi therapeutic is ALN- PCSSC. 216.
  • the method of any one of embodiments 1 to 216, wherein the subject is also treated with a standard of care therapy for the eye disease. 218.
  • the method of embodiment 217 further comprising administering the standard of care therapy to the subject. 219.
  • a composition comprising a lipid binding protein-based complex and one or more ophthalmic drugs, wherein the composition is produced by a process comprising thermal cycling a mixture comprising the lipid binding protein-based complex and the one or more ophthalmic drugs, optionally wherein one or more of the one or more ophthalmic drugs are (i) hydrophobic and/or (ii) poorly water soluble or water insoluble. 224.
  • the composition of embodiment 223, wherein the thermal cycling comprises (a) heating the mixture from a temperature in a first temperature range to a temperature in a second temperature range, (b) cooling the mixture of (a) from a temperature in the second temperature range to a temperature in the first temperature range; and (c) optionally repeating steps (a) and (b) at least once.
  • composition of embodiment 224 wherein the thermal cycling comprising repeating steps (a) and (b) four times. 229.
  • 230 The composition of any one of embodiments 224 to 229, wherein the first temperature range is 30°C to 45°C. 231.
  • the composition of embodiment 230, wherein the temperature in the first temperature range is 37°C. 232.
  • the composition of any one of embodiments 224 to 231, wherein the second temperature range is 50°C to 65°C. 233.
  • the composition of embodiment 232, wherein the temperature in the second temperature range is 55°C. 234.
  • composition of any one of embodiments 223 to 233, wherein the thermal cycling comprises thermal cycling the mixture between 37°C and 55°C. 235.
  • a composition comprising a lipid binding protein-based complex and one or more ophthalmic drugs complexed thereto, optionally wherein one or more of the one or more ophthalmic drugs are (i) hydrophobic and/or (ii) poorly water soluble or water insoluble. 236.
  • the lipid binding protein-based complex comprises a lipid binding protein molecule described in Section 6.1.4. 237.
  • composition of any one of embodiments 223 to 235, wherein the lipid binding protein-based complex comprises apolipoprotein A-I (ApoA-I), optionally wherein the ApoA-I is not ApoA-IMilano. 238.
  • the composition of any one of embodiments 223 to 237, wherein the lipid binding protein-based complex does not comprise an apolipoprotein mimetic. 239.
  • the composition of any one of embodiments 223 to 239, wherein the lipid binding protein-based complex comprises one or more neutral lipids. 241.
  • composition of embodiment 240, wherein the one or more neutral lipids comprises a sphingomyelin. 242.
  • the composition of any one of embodiments 223 to 241, wherein the lipid binding protein-based complex comprises one or more negatively charged lipids. 243.
  • the composition of embodiment 242, wherein the one or more negatively charged lipids comprise 1,2-dipalmitoyl-sn-glycero-3-[phospho-rac-(1- glycerol) (DPPG) or a salt thereof.
  • DPPG 1,2-dipalmitoyl-sn-glycero-3-[phospho-rac-(1- glycerol) (DPPG) or a salt thereof.
  • DPPG 1,2-dipalmitoyl-sn-glycero-3-[phospho-rac-(1- glycerol) (DPPG) or a salt thereof.
  • DPPG 1,2-dipalmitoyl-sn-glycero-3-[phospho-rac-(1
  • composition of embodiment 244, wherein the lipid binding protein- based complex is CER-001. 246.
  • the composition of embodiment 244, wherein the lipid binding protein- based complex is CSL-111. 247.
  • the composition of embodiment 244, wherein the lipid binding protein- based complex is CSL-112. 248.
  • the composition of embodiment 244, wherein the lipid binding protein- based complex is ETC-216. 249.
  • the composition of embodiment 244, wherein the lipid binding protein- based complex is CER-522. 250.
  • the composition of embodiment 244, wherein the lipid binding protein- based complex is delipidated HDL. 251.
  • the composition of any one of embodiments 223 to 243, wherein the lipid binding protein-based complex is an Apomer. 252.
  • the one or more ophthalmic drugs comprise a steroid, a kinase inhibitor, an angiotensin II receptor antagonist, an aldose reductase inhibitor, an immunosuppressant, a carbonic anhydrase inhibitor, an antimicrobial agent, an antiviral agent, an antihistamine, an anti- inflammatory, or a combination thereof.
  • composition of embodiment 254 or embodiment 255, wherein the one or more ophthalmic drugs comprise azithromycin, optionally wherein the concentration of azithromycin in the composition is 10 mg/ml. 257.
  • the composition of any one of embodiments 254 to 256, wherein the one or more ophthalmic drugs comprise spironolactone, optionally wherein the concentration of spironolactone in the composition is 1.5 mg/ml. 258.
  • the composition of any one of embodiments 254 to 257, wherein the one or more ophthalmic drugs comprise dexamethasone palmitate, optionally wherein the concentration of dexamethasone palmitate in the composition is 1 mg/ml. 259.
  • 260. The composition of any one of embodiments 223 to 259, wherein the one or more ophthalmic drugs comprise latanoprost, travaprost, bimatoprost, tafluprost, or a combination thereof. 261.
  • the composition of any one of embodiments 223 to 270, wherein the one or more ophthalmic drugs comprise tacrolimus. 272.
  • the composition of any one of embodiments 223 to 276 for use in the method of any one of embodiments 1 to 222. 278.
  • the thermal cycling comprises (a) heating the mixture from a temperature in a first temperature range to a temperature in a second temperature range, (b) cooling the mixture of (a) from a temperature in the second temperature range to a temperature in the first temperature range; and (c) optionally repeating steps (a) and (b) at least once.
  • the lipid binding protein-based complex for use of any one of embodiments 291 or 292, wherein the eye disease is fish-eye disease and the subject is homozygous or heterozygous for an LCAT mutation. 294.
  • the lipid binding protein-based complex for use of any one of embodiments 291 to 293, wherein the lipid binding protein-based complex is a reconstituted HDL, HDL mimetic, a Cargomer or an Apomer; preferably the lipid binding protein-based complex selected from CER-001, CSL-111, CSL-112, CER-522 or ETC-216; more preferably the lipid binding protein-based complex is CER-001. 295.
  • the lipid binding protein-based complex for use of any one of embodiments 291 to 294, wherein the lipid binding protein-based complex comprises one or more ophthalmic drugs complexed to the lipid binding protein-based complex, and wherein the one or more ophthalmic drugs comprise a steroid, a kinase inhibitor, an angiotensin II receptor antagonist, an aldose reductase inhibitor, an immunosuppressant, a carbonic anhydrase inhibitor, an antimicrobial agent, an antiviral agent, an antihistamine, an anti-inflammatory, or a combination thereof. 296.
  • lipid binding protein-based complex for use of any one of embodiments 291 to 295, wherein the one or more ophthalmic drugs comprise azithromycin, spironolactone, dexamethasone, difluprednate, estradiol, fluocinolone, fluorometholone, hydrocortisone, loteprednol etabonate, prednisolone, triamcinolone, rimexolone, axitinib, BMS-794833 (N-(4-((2-amino-3-chloropyridin-4-yl)oxy)-3- fluorophenyl)-5-(4-fluorophenyl)-4-oxo-1,4-dihydropyridine-3-carboxamide), carbozantinib, cediranib, dovitinib, lapatinib, lenvatinib, motesanib, nintedanib, orantinib, PD173074 (
  • the lipid binding protein-based complex for use of any one of embodiments 291 to 296, wherein the lipid binding protein-based complex is administered according to a dosing regimen which comprises: (a) an induction regimen; and/or (b) a consolidation regimen; and/or (c) a maintenance regimen. 298.
  • 300. The lipid binding protein-based complex for use of any one of embodiments 297 to 299, wherein the induction regimen is for a duration of at least one week, preferably the induction regimen is for a duration of two weeks, more preferably for a duration of three weeks.
  • 301. The lipid binding protein-based complex for use of any one of embodiments 297 to 300, in which the induction regimen comprises administering to the subject three doses of the lipid binding protein-based complex per week. 302.
  • the lipid binding protein-based complex for use of any one of embodiments 297 to 301, wherein the induction regimen comprises administering at least three doses of the lipid binding protein-based complex to the subject; preferably four or more doses, five or more doses, six or more doses, seven or more doses, eight or more doses, or nine or more doses; more preferably the induction regimen comprises administering nine or more doses of the lipid binding protein-based complex to the subject.
  • the induction regimen comprises administering the first dose of the lipid binding protein-based complex to the subject on day 1 and administering subsequent doses of the induction regimen to the subject on days 2, 4, 7, 9, 11, 14, 16, and 18.
  • the lipid binding protein-based complex for use of any one of embodiments 297 to 303, wherein the dosing regimen comprises a consolidation regimen which comprises administering multiple doses of the lipid binding protein- based complex to the subject, in which multiple doses are separated by 2 or more days.
  • the dosing regimen comprises a consolidation regimen which comprises administering multiple doses of the lipid binding protein- based complex to the subject, in which multiple doses are separated by 2 or more days.
  • the lipid binding protein-based complex for use of any one of embodiments 297 to 304, wherein the doses of the consolidation regimen are separated by no more than four days, preferably the doses of the consolidation regimen are separated from one another by three or four days.
  • the lipid binding protein-based complex for use of any one of embodiments 297 to 306, wherein the consolidation regimen comprises administering at least two doses of the lipid binding protein-based complex to the subject per week. 308.
  • the lipid binding protein-based complex for use of any one of embodiments 297 to 307, wherein the consolidation regimen comprises administering at least two doses of the lipid binding protein-based complex to the subject; preferably three or more doses, four or more dose, five or more doses, or six or more doses; more preferably the consolidation regimen comprises administering six or more doses of the lipid binding protein-based complex to the subject. 309.
  • the lipid binding protein-based complex for use of any one of embodiments 297 to 308, wherein the consolidation regimen comprises administering the six doses of the lipid binding protein-based complex to the subject on days 21, 24, 28, 31, 35, and 38 following an induction regimen which begins on day 1.
  • the dosing regimen comprises a maintenance regimen which comprises administering a dose of the lipid binding protein-based complex to the subject once every 3 or more days, preferably once every 5 or more days, more preferably one dose per week. 311.
  • the lipid binding protein-based complex for use of any one of embodiments 297 to 310, wherein the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for at least one month.
  • the maintenance regimen comprises administering the lipid binding protein-based complex to the subject for at least one month.
  • the dose of the lipid binding protein-based complex administered in the induction regimen, in the consolidation regimen and/or in the maintenance regimen is 4 to 30 mg/kg (on a protein weight basis); preferably 5 to 15 mg/kg (on a protein weight basis), 10 to 20 mg/kg (on a protein weight basis), or 15 to 25 mg/kg (on a protein weight basis). 313.
  • the lipid binding protein-based complex for use of any one of embodiments 297 to 312, wherein the dose of the lipid binding protein-based complex administered in the induction regimen, in the consolidation regimen and/or in the maintenance regimen is 8 mg/kg (on a protein weight basis) or 10 mg/kg (on a protein weight basis). 314.
  • the lipid binding protein-based complex for use of any one of embodiments 297 to 313, wherein the dose of the lipid binding protein-based complex administered in the induction regimen, in the consolidation regimen and/or in the maintenance regimen is 300 mg to 3000 mg; preferably 300 mg to 1500 mg, 400 mg to 1500 mg, 500 mg to 1200 mg, or 500 mg to 1000 mg. 315.
  • the lipid binding protein-based complex for use of any one of embodiments 291 to 314, wherein the lipid binding protein-based complex is administered peripherally, optionally by infusion. 316.
  • lipid binding protein-based complex for use of any one of embodiments 291 to 317, wherein the subject is also treated with a lipid control medication; preferably the lipid control medication comprises a statin such as atorvastatin, rosuvastatin, simvastatin, fluvastatin, lovastatin, or pravastatin; a cholesterol absorption inhibitor such as ezetimibe; niacin; aspirin; a proprotein convertase subtilisin/kexin type 9 (PCSK9) inhibitor such as an antibody selected from alirocumab, bococizumabevolocumab, 1D05-IgG2 and LY3015014, or a RNAi therapeutic such as ALN-PCSSC.
  • a statin such as atorvastatin, rosuvastatin, simvastatin, fluvastatin, lovastatin, or pravastatin
  • a cholesterol absorption inhibitor such as ezetimibe
  • the lipid binding protein-based complex for use of any one of embodiments 291 to 318, wherein the subject is also treated with a standard of care therapy for the eye disease.
  • 320. The lipid binding protein-based complex for use of any one of embodiments 291 to 319, wherein the lipid binding protein-based complex does not comprise and is not administered with a cell-penetrating peptide.
  • 321. The lipid binding protein-based complex for use of any one of embodiments 291 to 320, wherein the lipid binding protein-based complex does not comprise and is not administered with a chemical penetration enhancer. 322.
  • the lipid binding protein-based complex for use of any one of embodiments 291 to 321, wherein the lipid binding protein-based complex does not comprise and is not administered with a cytophilic peptide. 323.
  • the lipoprotein complex for use according to embodiment 323 or embodiment 324, wherein the lipoprotein complex is selected from CER-001, CSL-111 and ETC-216. 326.
  • the lipoprotein complex for use according to any one of embodiment 323 to 325, wherein the lipoprotein complex comprises an ApoA-I apolipoprotein fraction and a lipoprotein faction comprising sphingomyelin and one or more negatively charged phospholipids. 327.
  • the lipoprotein complex for use according to any one of embodiment 323 to 326, wherein the lipoprotein complex comprises an ApoA-I apolipoprotein fraction and a lipid fraction, wherein the lipid fraction consists essentially of sphingomyelin and about 0.2 to 6 wt% of a negatively charged phospholipid, and wherein the molar ratio of the lipid fraction to the ApoA-I apolipoprotein fraction is ranging from about 2:1 to 200:1. 328.
  • DPPG 1,2-dipalmitoyl- sn-glycero-3-[phospho-rac-(1-glycerol)]
  • 329 The lipoprotein complex for use according to any one of embodiments 323 to 328, wherein the lipoprotein complex is CER-001.
  • 330 The lipoprotein complex for use according to any one of embodiment 323 to 329, wherein the ocular lipid deposits are corneal lipid deposits, retinal lipid deposits, palpebral lipid deposits or a combination thereof. 331.
  • the lipoprotein complex for use according to any one of embodiment 323 to 330, wherein the eye disease is selected from dry eye associated with lipid accumulation including dry eye associated with Meibomian gland dysfunction (MGD) and dry eye associated with lacrimal gland dysfunction, blepharitis, inflammatory eye disease, uveitis including anterior uveitis, intermediate uveitis, posterior uveitis and panuveitis, diseases of the cornea including lipid keratopathy, eye diseases associated with LCAT deficiency including fish-eye disease, dry macular degeneration (dry AMD), Stargardt disease and Leber’s idiopathic stellate neuroretinitis, macular edema, macular degeneration, retinal detachment, an ocular tumor, a fungal infection, a viral infection, a bacterial infection including bacterial conjunctivitis and trachoma, multifocal choroiditis, diabetic retinopathy, proliferative vitreoretinopathy (PVR), sympathetic
  • the lipoprotein complex for use according to any one of embodiment 323 to 331, wherein the administered amount of lipoprotein complex is effective to reduce ocular lipid deposits for the subject. 333. The lipoprotein complex for use according to any one of embodiment 323 to 332, wherein the lipoprotein complex further comprises one or more ophthalmic drugs. 334.
  • the ophthalmic drug is a steroid, a kinase inhibitor, an angiotensin II receptor antagonist, an aldose reductase inhibitor, an immunosuppressant, a carbonic anhydrase inhibitor, an antimicrobial agent, an antiviral agent, an antihistamine, an anti- inflammatory, a prostaglandin analog, or a combination thereof; preferably the ophthalmic drug is selected from azithromycin, dexamethasone, dexamethasone palmitate, difluprednate, estradiol, fluocinolone, fluorometholone, hydrocortisone, loteprednol etabonate, prednisolone, triamcinolone, rimexolone, spironolactone, axitinib, BMS-794833 (N-(4-((2-amino-3-chloropyridin-4-yl)oxy
  • the lipoprotein complex for use according to any one of embodiment 323 to 334, wherein the lipoprotein complex is administered by topical route, preferably using eye drops. 338.
  • the lipoprotein complex for use according to any one of embodiments 323 to 337, wherein the lipoprotein complex does not comprise and is not administered with a cell-penetrating peptide. 339.
  • the lipoprotein complex for use according to any one of embodiments 323 to 338, wherein the lipoprotein complex does not comprise and is not administered with a chemical penetration enhancer. 340. The lipoprotein complex for use according to any one of embodiments 323 to 339, wherein the lipoprotein complex does not comprise and is not administered with a cytophilic peptide.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Ophthalmology & Optometry (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Dermatology (AREA)
  • Dispersion Chemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Medicinal Preparation (AREA)
  • Plural Heterocyclic Compounds (AREA)
  • Nitrogen Condensed Heterocyclic Rings (AREA)
  • Pyridine Compounds (AREA)
  • Saccharide Compounds (AREA)
  • Steroid Compounds (AREA)
  • Peptides Or Proteins (AREA)
PCT/IB2021/000674 2020-10-01 2021-10-01 Methods for treating eye diseases using lipid binding protein-based complexes Ceased WO2022069942A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
US18/247,465 US20240000948A1 (en) 2020-10-01 2021-10-01 Methods for treating eye diseases using lipid binding protein-based complexes
AU2021354095A AU2021354095A1 (en) 2020-10-01 2021-10-01 Compositions comprising lipid binding protein-based complexes for use for treating eye diseases
EP21811456.9A EP4221686A2 (en) 2020-10-01 2021-10-01 Compositions comprising lipid binding protein-based complexes for use for treating eye diseases
IL301769A IL301769A (en) 2020-10-01 2021-10-01 Methods for treating eye diseases using lipid binding protein-based complexes
MX2023003877A MX2023003877A (es) 2020-10-01 2021-10-01 Composiciones que comprenden complejos basados en proteina de union a lipidos para usarse en el tratamiento de enfermedades oculares.
JP2023519881A JP2023543498A (ja) 2020-10-01 2021-10-01 脂質結合タンパク質ベースの複合体を使用した、眼疾患を治療するための方法
CA3197168A CA3197168A1 (en) 2020-10-01 2021-10-01 Methods for treating eye diseases using lipid binding protein-based complexes
CN202180067629.6A CN116322646A (zh) 2020-10-01 2021-10-01 用于治疗眼病的包含基于脂质结合蛋白的复合物的组合物
KR1020237014173A KR20230079132A (ko) 2020-10-01 2021-10-01 안질환을 치료하는 데 사용하기 위한 지질 결합 단백질-기반 복합체를 포함하는 조성물

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US202063086386P 2020-10-01 2020-10-01
US63/086,386 2020-10-01
US202063092073P 2020-10-15 2020-10-15
US63/092,073 2020-10-15
US202163139015P 2021-01-19 2021-01-19
US63/139,015 2021-01-19
US202163175337P 2021-04-15 2021-04-15
US63/175,337 2021-04-15

Publications (2)

Publication Number Publication Date
WO2022069942A2 true WO2022069942A2 (en) 2022-04-07
WO2022069942A3 WO2022069942A3 (en) 2022-07-07

Family

ID=78725530

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2021/000674 Ceased WO2022069942A2 (en) 2020-10-01 2021-10-01 Methods for treating eye diseases using lipid binding protein-based complexes

Country Status (10)

Country Link
US (1) US20240000948A1 (cg-RX-API-DMAC7.html)
EP (1) EP4221686A2 (cg-RX-API-DMAC7.html)
JP (1) JP2023543498A (cg-RX-API-DMAC7.html)
KR (1) KR20230079132A (cg-RX-API-DMAC7.html)
CN (1) CN116322646A (cg-RX-API-DMAC7.html)
AU (1) AU2021354095A1 (cg-RX-API-DMAC7.html)
CA (1) CA3197168A1 (cg-RX-API-DMAC7.html)
IL (1) IL301769A (cg-RX-API-DMAC7.html)
MX (1) MX2023003877A (cg-RX-API-DMAC7.html)
WO (1) WO2022069942A2 (cg-RX-API-DMAC7.html)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022219413A1 (en) * 2021-04-15 2022-10-20 Abionyx Pharma Sa Use of lipid binding protein-based complexes in organ preservation solutions
WO2025093929A1 (en) 2023-10-31 2025-05-08 Abionyx Pharma Sa Lipid binding protein molecule therapy

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN120678886B (zh) * 2025-07-11 2026-02-06 中国中医科学院中医基础理论研究所 4f二聚体多肽及其脂化物的新用途

Citations (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4880935A (en) 1986-07-11 1989-11-14 Icrf (Patents) Limited Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates
US5059528A (en) 1987-05-28 1991-10-22 Ucb, S.A. Expression of human proapolipoprotein a-i
US5122368A (en) 1988-02-11 1992-06-16 Bristol-Myers Squibb Company Anthracycline conjugates having a novel linker and methods for their production
US5128318A (en) 1987-05-20 1992-07-07 The Rogosin Institute Reconstituted HDL particles and uses thereof
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5220043A (en) 1991-03-21 1993-06-15 Ohio University Synthesis of D-erythro-sphingomyelins
US5622929A (en) 1992-01-23 1997-04-22 Bristol-Myers Squibb Company Thioether conjugates
US5824805A (en) 1995-12-22 1998-10-20 King; Dalton Branched hydrazone linkers
US5840688A (en) 1994-03-22 1998-11-24 Research Corporation Technologies, Inc. Eating suppressant peptides
US6004925A (en) 1997-09-29 1999-12-21 J. L. Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6037323A (en) 1997-09-29 2000-03-14 Jean-Louis Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6046166A (en) 1997-09-29 2000-04-04 Jean-Louis Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US20020156007A1 (en) 2000-11-10 2002-10-24 Proteopharma Aps Apolipoprotein analogues
US20030045460A1 (en) 2000-08-24 2003-03-06 Fogelman Alan M. Orally administered peptides to ameliorate atherosclerosis
US20030087819A1 (en) 2001-05-09 2003-05-08 Bielicki John K. Cysteine-containing peptides having antioxidant properties
US6617134B1 (en) 1991-12-13 2003-09-09 Esperion Therapeutics, Inc. Dimer of molecular variant of apolipoprotein and processes for the production thereof
US20030171277A1 (en) 2000-08-24 2003-09-11 The Regents Of The University Of California Orally administered peptides to ameliorate atherosclerosis
US20030181372A1 (en) 2002-01-14 2003-09-25 The Regents Of The University Of California Apolipoprotein A-I mutant proteins having cysteine substitutions and polynucleotides encoding same
US20040067873A1 (en) 2002-05-17 2004-04-08 Dasseux Jean-Louis H. Method of treating dyslipidemic disorders
US20040077541A1 (en) 2002-07-30 2004-04-22 Lingyu Zhu Methods of using non-human animal Apolipoprotein A-I protein
US6743778B2 (en) 2000-04-21 2004-06-01 Amgen Inc. Apo-AI/AII peptide derivatives
WO2004073684A2 (en) 2003-02-14 2004-09-02 Children's Hospital & Research Center At Oakland Lipophilic drug delivery vehicle and methods of use thereof
US20040254120A1 (en) 2000-08-24 2004-12-16 The Regents Of The University Of California Orally administered small peptides synergize statin activity
US20040266671A1 (en) 2000-08-24 2004-12-30 The Regents Of The University Of California Orally administered peptides synergize statin activity
US20040266660A1 (en) 2001-08-20 2004-12-30 Alphonse Hubsch Hdl for the treatment of stroke and other ischemic conditions
US20060069030A1 (en) 2004-07-16 2006-03-30 Trustees Of Tufts College Apolipoprotein A1 mimetics and uses thereof
WO2007023476A2 (en) 2005-08-26 2007-03-01 Cerenis Therapeutics Holding Sa Compositions and methods for producing apolipoprotein gene products in lactic acid bacteria
WO2008104890A2 (en) 2007-02-28 2008-09-04 Cerenis Therapeutics Holding Sa Compositions and methods for producing apolipoprotein
US20080234192A1 (en) 2006-12-08 2008-09-25 Washington, University Of Compositions and methods of use for treating cardiovascular disease
US20090081293A1 (en) 2007-09-20 2009-03-26 Katsuyuki Murase Sustained release of apo a-i mimetic peptides and methods of treatment
WO2010093918A1 (en) 2009-02-16 2010-08-19 Cerenis Therapeutics Sa Apolipoprotein a-i mimics
US8143224B2 (en) 2007-10-23 2012-03-27 The Cleveland Clinic Foundation Oxidant resistant apolipoprotein A-1 and mimetic peptides
US8206750B2 (en) 2005-03-24 2012-06-26 Cerenis Therapeutics Holding S.A. Charged lipoprotein complexes and their uses
WO2012109162A1 (en) 2011-02-07 2012-08-16 Cerenis Therapeutics Holding S.A. Lipoprotein complexes and manufacturing and uses thereof
US20130137628A1 (en) 2010-05-11 2013-05-30 Esperion Therapeutics, Inc. Dimeric Oxidation-Resistant Apolipoprotein A1 Variants
US20140275590A1 (en) 2013-03-15 2014-09-18 Cerenis Therapeutics Holding Sa Methods for the synthesis of sphingomyelins and dihydrosphingomyelins
WO2014140787A2 (en) 2013-03-15 2014-09-18 Cerenis Therapeutics Holding Sa Methods for the synthesis of sphingomyelins and dihydrosphingomyelins
WO2015173633A2 (en) 2014-05-02 2015-11-19 Cerenis Therapeutics Holding Sa Hdl therapy markers
EP3238746A1 (en) 2014-12-25 2017-11-01 Kyoto University High-density lipoprotein, and delivery of drug to posterior segment of eye by ocular instillation of said cytophilic peptide-fused high-density lipoprotein
WO2019018350A1 (en) 2017-07-17 2019-01-24 Keith Roizman TOPICAL ADMINISTRATION OF THERAPEUTIC AGENTS COMPRISING CELL PENETRATION PEPTIDES, FOR USE IN THE TREATMENT OF AGE-RELATED MACULAR DEGENERATION AND OTHER OCULAR DISEASES
WO2019030574A1 (en) 2017-08-10 2019-02-14 Cerenis Therapeutics Holding Cargomers
WO2019030575A1 (en) 2017-08-10 2019-02-14 Cerenis Therapeutics Holding APOMÈRES

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070254832A1 (en) * 2006-02-17 2007-11-01 Pressler Milton L Methods for the treatment of macular degeneration and related eye conditions
CN113679699B (zh) * 2012-09-12 2022-10-28 诺瓦利克有限责任公司 包含半氟化烷烃的混合物的组合物
AU2018226872A1 (en) * 2017-03-03 2019-09-05 Macregen, Inc. Treatment of age-related macular degeneration and other eye diseases with one or more therapeutic agents
CN111902144A (zh) * 2018-03-30 2020-11-06 第一三共株式会社 Lcat缺乏的治疗剂

Patent Citations (46)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4880935A (en) 1986-07-11 1989-11-14 Icrf (Patents) Limited Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates
US5128318A (en) 1987-05-20 1992-07-07 The Rogosin Institute Reconstituted HDL particles and uses thereof
US5059528A (en) 1987-05-28 1991-10-22 Ucb, S.A. Expression of human proapolipoprotein a-i
US5122368A (en) 1988-02-11 1992-06-16 Bristol-Myers Squibb Company Anthracycline conjugates having a novel linker and methods for their production
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5220043A (en) 1991-03-21 1993-06-15 Ohio University Synthesis of D-erythro-sphingomyelins
US6617134B1 (en) 1991-12-13 2003-09-09 Esperion Therapeutics, Inc. Dimer of molecular variant of apolipoprotein and processes for the production thereof
US5622929A (en) 1992-01-23 1997-04-22 Bristol-Myers Squibb Company Thioether conjugates
US5840688A (en) 1994-03-22 1998-11-24 Research Corporation Technologies, Inc. Eating suppressant peptides
US5824805A (en) 1995-12-22 1998-10-20 King; Dalton Branched hydrazone linkers
US6004925A (en) 1997-09-29 1999-12-21 J. L. Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6037323A (en) 1997-09-29 2000-03-14 Jean-Louis Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6046166A (en) 1997-09-29 2000-04-04 Jean-Louis Dasseux Apolipoprotein A-I agonists and their use to treat dyslipidemic disorders
US6743778B2 (en) 2000-04-21 2004-06-01 Amgen Inc. Apo-AI/AII peptide derivatives
US20040266671A1 (en) 2000-08-24 2004-12-30 The Regents Of The University Of California Orally administered peptides synergize statin activity
US20030045460A1 (en) 2000-08-24 2003-03-06 Fogelman Alan M. Orally administered peptides to ameliorate atherosclerosis
US20040254120A1 (en) 2000-08-24 2004-12-16 The Regents Of The University Of California Orally administered small peptides synergize statin activity
US20030171277A1 (en) 2000-08-24 2003-09-11 The Regents Of The University Of California Orally administered peptides to ameliorate atherosclerosis
US20020156007A1 (en) 2000-11-10 2002-10-24 Proteopharma Aps Apolipoprotein analogues
US20030087819A1 (en) 2001-05-09 2003-05-08 Bielicki John K. Cysteine-containing peptides having antioxidant properties
US20040266660A1 (en) 2001-08-20 2004-12-30 Alphonse Hubsch Hdl for the treatment of stroke and other ischemic conditions
US20030181372A1 (en) 2002-01-14 2003-09-25 The Regents Of The University Of California Apolipoprotein A-I mutant proteins having cysteine substitutions and polynucleotides encoding same
US20040067873A1 (en) 2002-05-17 2004-04-08 Dasseux Jean-Louis H. Method of treating dyslipidemic disorders
US20040077541A1 (en) 2002-07-30 2004-04-22 Lingyu Zhu Methods of using non-human animal Apolipoprotein A-I protein
US20040229794A1 (en) 2003-02-14 2004-11-18 Ryan Robert O. Lipophilic drug delivery vehicle and methods of use thereof
WO2004073684A2 (en) 2003-02-14 2004-09-02 Children's Hospital & Research Center At Oakland Lipophilic drug delivery vehicle and methods of use thereof
US20060069030A1 (en) 2004-07-16 2006-03-30 Trustees Of Tufts College Apolipoprotein A1 mimetics and uses thereof
US8206750B2 (en) 2005-03-24 2012-06-26 Cerenis Therapeutics Holding S.A. Charged lipoprotein complexes and their uses
WO2007023476A2 (en) 2005-08-26 2007-03-01 Cerenis Therapeutics Holding Sa Compositions and methods for producing apolipoprotein gene products in lactic acid bacteria
US20080234192A1 (en) 2006-12-08 2008-09-25 Washington, University Of Compositions and methods of use for treating cardiovascular disease
US8541236B2 (en) 2006-12-08 2013-09-24 University Of Washington Mutant apolipoprotein A-1 polypeptide with increased resistance to oxidation and reactive carbonyls
WO2008104890A2 (en) 2007-02-28 2008-09-04 Cerenis Therapeutics Holding Sa Compositions and methods for producing apolipoprotein
US20090081293A1 (en) 2007-09-20 2009-03-26 Katsuyuki Murase Sustained release of apo a-i mimetic peptides and methods of treatment
US8143224B2 (en) 2007-10-23 2012-03-27 The Cleveland Clinic Foundation Oxidant resistant apolipoprotein A-1 and mimetic peptides
WO2010093918A1 (en) 2009-02-16 2010-08-19 Cerenis Therapeutics Sa Apolipoprotein a-i mimics
US20130137628A1 (en) 2010-05-11 2013-05-30 Esperion Therapeutics, Inc. Dimeric Oxidation-Resistant Apolipoprotein A1 Variants
US20120232005A1 (en) 2011-02-07 2012-09-13 Cerenis Therapeutics Holding S.A. Lipoprotein complexes and manufacturing and uses thereof
WO2012109162A1 (en) 2011-02-07 2012-08-16 Cerenis Therapeutics Holding S.A. Lipoprotein complexes and manufacturing and uses thereof
US20140275590A1 (en) 2013-03-15 2014-09-18 Cerenis Therapeutics Holding Sa Methods for the synthesis of sphingomyelins and dihydrosphingomyelins
WO2014140787A2 (en) 2013-03-15 2014-09-18 Cerenis Therapeutics Holding Sa Methods for the synthesis of sphingomyelins and dihydrosphingomyelins
US20160075634A1 (en) 2013-03-15 2016-03-17 Cerenis Therapeutics Holding Sa Methods for the synthesis of sphingomyelins and dihydrosphingomyelins
WO2015173633A2 (en) 2014-05-02 2015-11-19 Cerenis Therapeutics Holding Sa Hdl therapy markers
EP3238746A1 (en) 2014-12-25 2017-11-01 Kyoto University High-density lipoprotein, and delivery of drug to posterior segment of eye by ocular instillation of said cytophilic peptide-fused high-density lipoprotein
WO2019018350A1 (en) 2017-07-17 2019-01-24 Keith Roizman TOPICAL ADMINISTRATION OF THERAPEUTIC AGENTS COMPRISING CELL PENETRATION PEPTIDES, FOR USE IN THE TREATMENT OF AGE-RELATED MACULAR DEGENERATION AND OTHER OCULAR DISEASES
WO2019030574A1 (en) 2017-08-10 2019-02-14 Cerenis Therapeutics Holding Cargomers
WO2019030575A1 (en) 2017-08-10 2019-02-14 Cerenis Therapeutics Holding APOMÈRES

Non-Patent Citations (32)

* Cited by examiner, † Cited by third party
Title
"Remington: The Science and Practice of Pharmacy", 2012, PHARMACEUTICAL PRESS
AMESGALOR, CLIN INVESTIG (LONGD., vol. 5, no. 3, 2015, pages 267 - 285
BERGERKIMMEL: "Guide to Molecular Cloning Techniques", vol. 152, ACADEMIC PRESS, INC., article "Methods in Enzymology"
CHARI ET AL., CANCER RESEARCH, vol. 52, 1992, pages 127 - 131
CHEUNG ET AL., J. LIPID RES., vol. 28, no. 8, 1987, pages 913 - 29
CHUNG ET AL., J. LIPID RES., vol. 21, no. 3, 1980, pages 284 - 91
DAULL ET AL., J. OCUL PHARMACOL THER., vol. 29, no. 2, 2013, pages 258 - 69
DAUM ET AL., J. MOL. MED., vol. 77, 1999, pages 614 - 22
DUBOWCHIKWALKER, PHARM. THERAPEUTICS, vol. 83, 1999, pages 67 - 123
DUVERGER ET AL., ARTERIOSCLER. THROMB. VASE. BIOL., vol. 16, no. 12, 1996, pages 1424 - 29
DUVERGER ET AL., EURO. J. BIOCHEM., vol. 201, no. 2, 1991, pages 373 - 83
EATON ET AL., JOURNAL OF OCULAR PHARMACOLOGY AND THERAPEUTICS, vol. 33, no. 10, pages 718 - 734
FRANCESCHINI ET AL., J. BIOL. CHEM., vol. 260, no. 14, 1985, pages 8637 - 46
GOEDDEL: "Gene Expression Technology: Meth. Enzymol.", vol. 185, 1990, ACADEMIC PRESS
GRAY: "Measurement of Lipid Oxidation: A Review", JOURNAL OF THE AMERICAN OIL CHEMISTS SOCIETY, vol. 55, 1978, pages 539 - 545
HEATON, F.W.UR: "Improved Iodometric Methods for the Determination of Lipid Peroxides", JOURNAL OF THE SCIENCE OF FOOD AND AGRICULTURE, vol. 9, 1958, pages 781 - 786
JOHNSON ET AL., ANTICANCER RES, vol. 15, 1995, pages 1387 - 93
JONAS, BIOCHIM. BIOPHYS. ACTA, vol. 1529, no. 1-3, 2000, pages 245 - 56
KANAI ET AL., AMERICAN JOURNAL OF OPHTHALMOLOGY CASE REPORTS, vol. 10, 2018, pages 137 - 141
KASTELEIN ET AL., EUR HEART J, vol. 37, no. 17, 2016, pages 1360 - 9
LAU ET AL., BIOORG-MED-CHEM, vol. 3, no. 10, 1995, pages 1305 - 1304
MCLEAN ET AL., J. BIOL. CHEM., vol. 258, no. 14, 1983, pages 8993 - 9000
NEVILLE ET AL., BIOL. CHEM., vol. 264, 1989, pages 14653 - 14661
NI ET AL., J LIPID RES, vol. 52, no. 1, 2011, pages 78 - 86
NICHOLLS ET AL., EXPERT OPIN BIOL THER, vol. 11, no. 3, 2011, pages 387 - 94
SACKS ET AL., J LIPID RES, vol. 50, no. 5, 2009, pages 894 - 907
SHELNESS ET AL., J. BIOL. CHEM., vol. 259, no. 15, 1984, pages 9929 - 35
TARDIF ET AL., JAMA, vol. 297, 2007, pages 1675 - 1682
THORPE ET AL., CANCER RES., vol. 47, 1987, pages 5924 - 5931
WAWRZYNCZAK ET AL.: "Immunoconjugates: Antibody Conjugates in Radioimagery and Therapy of Cancer", 1987, OXFORD U. PRESS
WEIS, CHEM. PHYS. LIPIDS, vol. 102, no. 1-2, 1999, pages 3 - 12
YEE ET AL., INVESTIGATIVE OPHTHALMOLOGY & VISUAL SCIENCE, vol. 57, no. 12, 2016, pages 5664

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022219413A1 (en) * 2021-04-15 2022-10-20 Abionyx Pharma Sa Use of lipid binding protein-based complexes in organ preservation solutions
WO2025093929A1 (en) 2023-10-31 2025-05-08 Abionyx Pharma Sa Lipid binding protein molecule therapy

Also Published As

Publication number Publication date
AU2021354095A1 (en) 2023-06-08
US20240000948A1 (en) 2024-01-04
EP4221686A2 (en) 2023-08-09
WO2022069942A3 (en) 2022-07-07
JP2023543498A (ja) 2023-10-16
CA3197168A1 (en) 2022-04-07
IL301769A (en) 2023-05-01
CN116322646A (zh) 2023-06-23
MX2023003877A (es) 2023-04-18
KR20230079132A (ko) 2023-06-05

Similar Documents

Publication Publication Date Title
Kuai et al. High-density lipoproteins: nature’s multifunctional nanoparticles
US20240000948A1 (en) Methods for treating eye diseases using lipid binding protein-based complexes
US20070254832A1 (en) Methods for the treatment of macular degeneration and related eye conditions
Suda et al. High-density lipoprotein mutant eye drops for the treatment of posterior eye diseases
EP3238746B1 (en) High-density lipoprotein, and delivery of drug to posterior segment of eye by ocular instillation of said cytophilic peptide-fused high-density lipoprotein
CN105294859A (zh) 脂蛋白复合物及其制备和用途
US20110002851A1 (en) Cationic Colloidal Carriers for Delivery of Active Agents to the Blood-Brain Barrier in the Course of Neuroinflammatory Diseases
JP2024525795A (ja) Cldn6陽性癌を治療するための、cldn6およびcd3結合要素をコードする薬剤
US20250230208A1 (en) Methods for treating eye diseases using lipid binding protein-based complexes
CA2756181C (en) Carrier comprising a vitamin e derivative
WO2012097255A2 (en) Therapeutic effect of heat shock proteins in preventing amylin aggregation in type 2 diabetes mellitus
JP7497854B2 (ja) 薬物デリバリーキャリアおよびこれを用いる医薬組成物
US20070197442A1 (en) Methods for the Treatment of Macular Degeneration and Related Eye Conditions
DU Near-Infrared Light Activated Lipid-Based Drug Delivery Systems for the Treatment of Age-Related Macular Degeneration
Baid Lens epithelium derived growth factor (1-326): a new protein drug for retinal diseases
US20160296628A1 (en) Nanoparticle delivery systems for cytolytic peptide prodrugs
NZ613524B2 (en) Lipoprotein complexes and manufacturing and uses thereof

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 3197168

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2023519881

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20237014173

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 799391

Country of ref document: NZ

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021811456

Country of ref document: EP

Effective date: 20230502

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21811456

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2021354095

Country of ref document: AU

Date of ref document: 20211001

Kind code of ref document: A