WO2022060955A1 - Methods for treating cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins - Google Patents

Methods for treating cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins Download PDF

Info

Publication number
WO2022060955A1
WO2022060955A1 PCT/US2021/050627 US2021050627W WO2022060955A1 WO 2022060955 A1 WO2022060955 A1 WO 2022060955A1 US 2021050627 W US2021050627 W US 2021050627W WO 2022060955 A1 WO2022060955 A1 WO 2022060955A1
Authority
WO
WIPO (PCT)
Prior art keywords
treated
population
subjects
months
subject
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/050627
Other languages
English (en)
French (fr)
Inventor
Elaina Marie GARTNER
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Agensys Inc
Seagen Inc
Original Assignee
Agensys Inc
Seagen Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Agensys Inc, Seagen Inc filed Critical Agensys Inc
Priority to PH1/2023/550745A priority Critical patent/PH12023550745A1/en
Priority to CN202311192917.1A priority patent/CN117224698A/zh
Priority to CA3194339A priority patent/CA3194339A1/en
Priority to MX2023003059A priority patent/MX2023003059A/es
Priority to KR1020237012738A priority patent/KR20230091885A/ko
Priority to AU2021344976A priority patent/AU2021344976A1/en
Priority to IL301163A priority patent/IL301163A/en
Priority to CN202180077229.3A priority patent/CN116710483A/zh
Priority to EP21870200.9A priority patent/EP4213888A4/en
Priority to US18/025,349 priority patent/US20230330251A1/en
Priority to JP2023517259A priority patent/JP2023542879A/ja
Publication of WO2022060955A1 publication Critical patent/WO2022060955A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68031Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6889Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell

Definitions

  • This application contains a sequence listing, which is submitted electronically via EFS-Web as an ASCII formatted sequence listing with a file name of “14369-274- 228_SEQ_LISTING.txt” and a creation date of September 13, 2021 and having a size of 39,755 bytes.
  • the sequence listing submitted via EFS-Web is part of the specification and is herein incorporated by reference in its entirety.
  • ADC antibody drug conjugates
  • Cancer is the leading cause of death in the US for people 35 to 65 years of age and it is the second leading cause of death worldwide. It was estimated in 2019 that there would be approximately 1.7 million new cancer cases and approximately 610000 deaths from cancer in the US (National Cancer Institute. 2019. Cancer Stat Facts: Cancer of Any Site. seer.cancer.gov/statfacts/html/all.html. Accessed 5 Jun 2019). Globally there were an estimated 18.1 million new cancer cases in 2018 and approximately 9.6 million deaths attributed to cancer in 2018 (World Health Organization. Press Release. Sept 2018. who.int/cancer/PRGlobocanFinal.pdf. Accessed 5 Jun 2019). Most deaths now occur in patients with metastatic cancers.
  • 191P4D12 (which is also known as Nectin-4) is a type I transmembrane protein and member of a family of related immunoglobulin-like adhesion molecules implicated in cell-to-cell adhesion. 191P4D12 belongs to the Nectin family of adhesion molecules.
  • 191P4D12 is composed of an extracellular domain (ECD) containing 3 Ig-like subdomains, a transmembrane helix, and an intracellular region (Takai Y et al, Annu Rev Cell Dev Biol 2008;24:309-42).
  • ECD extracellular domain
  • Nectins are thought to mediate Ca 2+ -independent cell-cell adhesion via both homophilic and heterophilic trans interactions at adherens junctions where they can recruit cadherins and modulate cytoskeletal rearrangements (Rikitake & Takai, Cell Mol Life Sci. 2008;65(2):253-63).
  • Nectin-facilitated adhesion supports several biological processes, such as immune modulation, host-pathogen interaction, and immune evasion (Sakisaka T et al, Current Opinion in Cell Biology 2007;19:593-602).
  • First-line therapy for metastatic urothelial cancer in patients with sufficient renal function consists of cisplatin-based combinations, like methotrexate, vinblastine, doxorubicin, and cisplatin (MVAC) or gemcitabine plus cisplatin, which demonstrate overall response rates up to 50%, including approximately 10-15% complete response (CRs).
  • MVAC methotrexate
  • doxorubicin doxorubicin
  • gemcitabine plus cisplatin which demonstrate overall response rates up to 50%, including approximately 10-15% complete response (CRs).
  • CRs complete response
  • CPI immune check point inhibitors
  • bladder cancer represents approximately 5 percent in men (fifth most common neoplasm) and 3 percent in women (eighth most common neoplasm). The incidence is increasing slowly, concurrent with an increasing older population.
  • American Cancer Society cancer.org estimates that there are 81,400 new cases annually, including 62,100 in men and 19,300 in women, which accounts for 4.5% of all cancer cases.
  • the age-adjusted incidence in the United States is 20 per 100,000 for men and women.
  • Bladder cancer incidence and mortality strongly increase with age and will be an increasing problem as the population becomes more elderly.
  • bladder cancers recur in the bladder.
  • Bladder cancer is managed with a combination of transurethral resection of the bladder (TUR) and intravesical chemotherapy or immunotherapy.
  • TUR transurethral resection of the bladder
  • the multifocal and recurrent nature of bladder cancer points out the limitations of TUR.
  • Most muscle-invasive cancers are not cured by TUR alone. Radical cystectomy and urinary diversion is the most effective means to eliminate the cancer but carry an undeniable impact on urinary and sexual function. There continues to be a significant need for treatment modalities that are beneficial for bladder cancer patients.
  • ADC antibody drug conjugate
  • the previous treatment includes platinum-based chemotherapy.
  • the previous treatment includes an immune checkpoint inhibitor (CPI).
  • CPI immune checkpoint inhibitor
  • the previous treatment includes both platinum-based chemotherapy and a CPI.
  • Embodiment 1 A method of treating urothelial or bladder cancer in a human subject having liver metastases, comprising administering to the subject having liver metastases an effective amount of an antibody drug conjugate, wherein the subject has received an immune checkpoint inhibitor (CPI) therapy, and wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds to 191P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23.
  • CDRs complementarity determining regions
  • Embodiment 2 A method of treating urothelial or bladder cancer in a human subject having a primary site of tumor in the upper urinary tract , comprising administering to the subject having a primary site of tumor in the upper urinary tract an effective amount of an antibody drug conjugate, wherein the subject has received an immune checkpoint inhibitor (CPI) therapy, and wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds tol91P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23.
  • CDRs complementarity determining regions
  • Embodiment 3 A method of treating urothelial or bladder cancer in a human subject, comprising administering to the subject an effective amount of an antibody drug conjugate, wherein the subject has received an immune checkpoint inhibitor (CPI) therapy, wherein the subject had progression or recurrence of the cancer during or following the CPI therapy, and wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds tol91P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23.
  • CPI immune checkpoint inhibitor
  • Embodiment 4 The method of any one of embodiments 1 to 3, wherein the subject has a duration of response of at least or about 7 months following the treatment.
  • Embodiment 5. The method of any one of embodiments 1 to 3, wherein the subject has a duration of response ranging from 5 to 9 months following the treatment.
  • Embodiment 6 The method of embodiment 1, wherein the subject has a progression free survival of at least or about 4 months following the treatment.
  • Embodiment 7 The method of embodiment 2 or 3, wherein the subject has a progression free survival of at least or about 5 months following the treatment.
  • Embodiment 8 The method of embodiment 1, wherein the subject has a progression free survival ranging from 4 to 9 months following the treatment.
  • Embodiment 9 The method of embodiment 2 or 3, wherein the subject has a progression free survival ranging from 5 to 9 months following the treatment.
  • Embodiment 10 The method of embodiment 1, wherein the subject has an overall survival of at least or about 9 months following the treatment.
  • Embodiment 11 The method of embodiment 2, wherein the subject has an overall survival of at least or about 12 months following the treatment.
  • Embodiment 12 The method of embodiment 3, wherein the subject has an overall survival of at least or about 11 months following the treatment.
  • Embodiment 13 The method of any one of embodiments 1 to 3, wherein the subject has an overall survival ranging from 9 to 19 months following the treatment.
  • Embodiment 14 The method of any one of embodiments 1 to 3, wherein a population of the subjects is treated by the methods, and wherein the percentage of the subjects having complete response in the treated population is at least or about 4%.
  • Embodiment 15 The method of any one of embodiments 1 to 3, wherein a population of the subjects is treated by the methods, and wherein the percentage of the subjects having partial response in the treated population is at least or about 35%.
  • Embodiment 16 The method of embodiment 1, wherein a population of the subjects is treated by the methods, and wherein overall response rate in the treated population is at least or about 35%.
  • Embodiment 17 The method of embodiment 2, wherein a population of the subjects is treated by the methods, and wherein overall response rate in the treated population is at least or about 43%.
  • Embodiment 18 The method of embodiment 3, wherein a population of the subjects is treated by the methods, and wherein overall response rate in the treated population is at least or about 39%.
  • Embodiment 19 The method of any one of embodiments 1 to 3, wherein a population of the subjects is treated by the methods, and wherein the percentage of the subjects having stable disease in the treated population is at least or about 30%.
  • Embodiment 20 The method of any one of embodiments 1 to 3, wherein a population of the subjects is treated by the methods, and wherein median duration of response in the treated population is at least or about 7 months.
  • Embodiment 21 The method of any one of embodiments 1 to 3, wherein a population of the subjects is treated by the methods, and wherein duration of response in the treated population ranges from 5 to 9 months.
  • Embodiment 22 The method of embodiment 1, wherein a population of the subjects is treated by the methods, and wherein median progression free survival in the treated population is at least or about 4 months.
  • Embodiment 23 The method of embodiment 1, wherein a population of the subjects is treated by the methods, and wherein progression free survival in the treated population ranges from 4 to 9 months.
  • Embodiment 24 The method embodiment 2 or 3, wherein a population of the subjects is treated by the methods, and wherein median progression free survival in the treated population is at least or about 5 months.
  • Embodiment 25 The method of embodiment 2 or 3, wherein a population of the subjects is treated by the methods, and wherein progression free survival in the treated population ranges from 5 to 9 months.
  • Embodiment 26 The method of embodiment 1, wherein a population of the subjects is treated by the methods, and wherein median overall survival in the treated population is at least or about 9 months.
  • Embodiment 27 The method of embodiment 2, wherein a population of the subjects is treated by the methods, and wherein median overall survival in the treated population is at least or about 12 months.
  • Embodiment 28 The method of embodiment 3, wherein a population of the subjects is treated by the methods, and wherein median overall survival in the treated population is at least or about 11 months.
  • Embodiment 29 The method of any one of embodiments 1 to 3, wherein a population of the subjects is treated by the methods, and wherein overall survival in the treated population ranges from 9 to 19 months.
  • Embodiment 30 The method of any one of embodiments 1 to 3, wherein the complete response rate is at least or about 4% for a population of subjects treated with the method.
  • Embodiment 31 The method of any one of embodiments 1 to 3, wherein the partial response rate is at least or about 35% for a population of subjects treated with the method.
  • Embodiment 32 The method of embodiment 1, wherein overall response rate is at least or about 35% for a population of subjects treated with the method.
  • Embodiment 33 The method of embodiment 2, wherein overall response rate is at least or about 43% for a population of subjects treated with the method.
  • Embodiment 34 The method of embodiment 3, wherein overall response rate is at least or about 39% for a population of subjects treated with the method.
  • Embodiment 35 The method of any one of embodiments 1 to 3, wherein the median duration of response is at least or about 7 months for a population of subjects treated with the method.
  • Embodiment 36 The method of any one of embodiments 1 to 3, wherein the duration of response is from 5 to 9 months for a population of subjects treated with the method.
  • Embodiment 37 The method of embodiment 1, wherein the median progression free survival is at least or about 4 months for a population of subjects treated with the method.
  • Embodiment 38 The method of any one of embodiments 1 to 3, wherein the progression free survival is from 4 to 9 months for a population of subjects treated with the method.
  • Embodiment 39 The method of embodiment 2 or 3, wherein the median progression free survival is at least or about 5 months for a population of subjects treated with the method.
  • Embodiment 40 The method of embodiment 2 or 3, wherein the progression free survival is from 5 to 9 months for a population of subjects treated with the method.
  • Embodiment 41 The method of embodiment 1, wherein the median overall survival is at least or about 9 months for a population of subjects treated with the method.
  • Embodiment 42 The method of embodiment 2, wherein the median overall survival is at least or about 12 months for a population of subjects treated with the method.
  • Embodiment 43 The method of embodiment 3, wherein the median overall survival is at least or about 11 months for a population of subjects treated with the method.
  • Embodiment 44 Embodiment 44.
  • Embodiment 45 The method of any one of embodiments 1 to 44, wherein the subject is a subject that received platinum-based chemotherapy.
  • Embodiment 46 The method of any one of embodiments 1 to 45, wherein the cancer is urothelial cancer, and wherein the human subject has locally advanced or metastatic urothelial carcinoma.
  • Embodiment 47 The method of any one of embodiments 1 to 46, wherein the subject has one or more of the conditions selected from the group consisting of:
  • Embodiment 48 The method of embodiment 47, wherein the subject has all of conditions (i) to (vi) of embodiment 47.
  • Embodiment 49 The method of embodiment 47 or 48, wherein the CrCl is measured by 24 hour urine collection or estimated by the Cockcroft-Gault criteria.
  • Embodiment 50 The method of any one of embodiments 1 to 49, wherein the subject has no more than Grade 2 sensory or motor neuropathy.
  • Embodiment 51 The method of any one of embodiments 1 to 50, wherein the subject has no active central nervous system metastases.
  • Embodiment 52 The method of any one of embodiments 1 to 51, wherein the subject has no uncontrolled diabetes.
  • Embodiment 53 The method of embodiment 52, wherein the uncontrolled diabetes is determined by hemoglobin Ale (HbAlc) no less than 8% or HbAlc between 7 and 8% with associated diabetes symptoms that are not otherwise explained.
  • HbAlc hemoglobin Ale
  • Embodiment 54 The method of embodiment 53, wherein the associated diabetes symptoms comprise or consist of polyuria, polydipsia, or both polyuria and polydipsia.
  • Embodiment 55 The method of any one of embodiments 1 to 54, wherein the CPI therapy is a therapy of programmed death receptor- 1 (PD-1) inhibitor.
  • PD-1 programmed death receptor- 1
  • Embodiment 56 The method of any one of embodiments 1 to 54, wherein the CPI therapy is a therapy of programmed death-ligand 1 (PD-L1) inhibitor.
  • the CPI therapy is a therapy of programmed death-ligand 1 (PD-L1) inhibitor.
  • Embodiment 57 The method of embodiment 55, wherein PD-1 inhibitor is nivolumab or pembrolizumab
  • Embodiment 58 The method of embodiment 56, wherein PD-L1 inhibitor is selected from a group consisting of atezolizumab, avelumab, and durvalumab.
  • Embodiment 59 The method of any one of embodiments 1 to 58, wherein the antibody or antigen binding fragment thereof comprises CDR-H1 comprising the amino acid sequence of SEQ ID NO: 9, CDR-H2 comprising the amino acid sequence of SEQ ID NO: 10, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 11; CDR-L1 comprising the amino acid sequence of SEQ ID NO: 12, CDR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and CDR-L3 comprising the amino acid sequence of SEQ ID NO: 14, or wherein the antibody or antigen binding fragment thereof comprises CDR-H1 comprising the amino acid sequence of SEQ ID NO: 16, CDR-H2 comprising the amino acid sequence of SEQ ID NO: 17, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 18; CDR-L1 comprising the amino acid sequence of SEQ ID NO: 19, CDR-L2 comprising the amino acid sequence of SEQ ID NO:20, and CDR-L3
  • Embodiment 60 The method of any one of embodiments 1 to 58, wherein the antibody or antigen binding fragment thereof comprises CDR-H1 consisting of the amino acid sequence of SEQ ID NO:9, CDR-H2 consisting of the amino acid sequence of SEQ ID NO: 10, CDR-H3 consisting of the amino acid sequence of SEQ ID NO:11; CDR-L1 consisting of the amino acid sequence of SEQ ID NO: 12, CDR-L2 consisting of the amino acid sequence of SEQ ID NO: 13, and CDR-L3 consisting of the amino acid sequence of SEQ ID NO: 14, or wherein the antibody or antigen binding fragment thereof comprises CDR-H1 consisting of the amino acid sequence of SEQ ID NO: 16, CDR-H2 consisting of the amino acid sequence of SEQ ID NO: 17, CDR-H3 consisting of the amino acid sequence of SEQ ID NO: 18; CDR-L1 consisting of the amino acid sequence of SEQ ID NO: 19, CDR-L2 consisting of the amino acid sequence of SEQ
  • Embodiment 61 The method of any one of embodiments 1 to 60, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:22 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:23.
  • Embodiment 62 The method of any one of embodiments 1 to 61, wherein the antibody comprises a heavy chain comprising the amino acid sequence ranging from the 20th amino acid (glutamic acid) to the 466th amino acid (lysine) of SEQ ID NO: 7 and a light chain comprising the amino acid sequence ranging from the 23rd amino acid (aspartic acid) to the 236th amino acid (cysteine) of SEQ ID NO:8.
  • Embodiment 63 The method of any one of embodiments 1 to 61, wherein the antigen binding fragment is an Fab, F(ab')2, Fv or scFv.
  • Embodiment 64 The method of any one of embodiments 1 to 62, wherein the antibody is a fully human antibody.
  • Embodiment 65 The method of any one of embodiments 1 to 62 and 64, wherein the antibody is an IgGl and light chain is a kappa light chain.
  • Embodiment 66 The method of any one of embodiments 1 to 65, wherein the antibody or antigen binding fragment thereof is recombinantly produced.
  • Embodiment 67 The method of any one of embodiments 1 to 66, wherein the antibody or antigen binding fragment is conjugated to each unit of MMAE via a linker.
  • Embodiment 68 The method of embodiment 67, wherein the linker is an enzyme-cleavable linker, and wherein the linker forms a bond with a sulfur atom of the antibody or antigen binding fragment thereof.
  • Embodiment 69 The method of embodiment 67 or 68, wherein the linker has a formula of: -Aa-Ww-Yy-; wherein -A- is a stretcher unit, a is 0 or 1; -W- is an amino acid unit, w is an integer ranging from 0 to 12; and -Y- is a spacer unit, y is 0, 1, or 2.
  • Embodiment 70 The method of embodiment 69, wherein the stretcher unit has the structure of Formula (1) below; the amino acid unit is valine-citrulline; and the spacer unit is a PAB group comprising the structure of Formula (2) below:
  • Embodiment 71 The method of embodiment 69 or 70, wherein the stretcher unit forms a bond with a sulfur atom of the antibody or antigen binding fragment thereof; and wherein the spacer unit is linked to MMAE via a carbamate group.
  • Embodiment 72 The method of any one of embodiments 1 to 71, wherein the ADC comprises from 1 to 20 units of MMAE per antibody or antigen binding fragment thereof.
  • Embodiment 73 The method of any one of embodiments 1 to 72, wherein the ADC comprises from 1 to 10 units of MMAE per antibody or antigen binding fragment thereof.
  • Embodiment 74 The method of any one of embodiments 1 to 73, wherein the ADC comprises from 2 to 8 units of MMAE per antibody or antigen binding fragment thereof.
  • Embodiment 75 The method of any one of embodiments 1 to 74, wherein the ADC comprises from 3 to 5 units of MMAE per antibody or antigen binding fragment thereof.
  • Embodiment 76 The method of any one of embodiments 1 to 73, wherein the ADC has the following structure: wherein L- represents the antibody or antigen binding fragment thereof and p is from 1 to 10.
  • Embodiment 77 The method of embodiment 76, wherein p is from 2 to 8.
  • Embodiment 78 The method of embodiment 76 or 77, wherein p is from 3 to 5.
  • Embodiment 79 The method of any one of embodiments 76 to 78, wherein p is from 3 to 4.
  • Embodiment 80 The method of any one of embodiments 77 to 79, wherein p is about 4.
  • Embodiment 81 The method of any one of embodiments 76 to 79, wherein the average p value of the effective amount of the antibody drug conjugates is about 3.8.
  • Embodiment 82 The method of any one of embodiments 1 to 81, wherein the
  • ADC is administered at a dose of about 1 to about 10 mg/kg of the subject’s body weight, about 1 to about 5 mg/kg of the subject’s body weight, about 1 to about 2.5 mg/kg of the subject’s body weight, or about 1 to about 1.25 mg/kg of the subject’s body weight.
  • Embodiment 83 The method of any one of embodiments 1 to 82, wherein the ADC is administered at a dose of about 0.25 mg/kg, about 0.5 mg/kg, about 0.75 mg/kg, about 1.0 mg/kg, about 1.25 mg/kg, about 1.5 mg/kg, about 1.75 mg/kg, about 2.0 mg/kg, about 2.25 mg/kg, or about 2.5 mg/kg of the subject’s body weight.
  • Embodiment 84 The method of any one of embodiments 1 to 83, wherein the ADC is administered at a dose of about 1 mg/kg of the subject’s body weight.
  • Embodiment 85 The method of any one of embodiments 1 to 83, wherein the ADC is administered at a dose of about 1.25 mg/kg of the subject’s body weight.
  • Embodiment 86 The method of any one of embodiments 1 to 85, wherein the ADC is administered by an intravenous (IV) injection or infusion.
  • IV intravenous
  • Embodiment 87 The method of any one of embodiments 1 to 86, wherein the ADC is administered by an IV injection or infusion three times every four- week cycle.
  • Embodiment 88 The method of any one of embodiments 1 to 87, wherein the ADC is administered by an IV injection or infusion on Days 1, 8 and 15 of every four-week cycle.
  • Embodiment 89 The method of any one of embodiments 1 to 88, wherein the ADC is administered by an IV injection or infusion over about 30 minutes three times every four-week cycle.
  • Embodiment 90 The method of any one of embodiments 1 to 89, wherein the ADC is administered by an IV injection or infusion over about 30 minutes on Days 1, 8 and 15 of every four-week cycle.
  • Embodiment 91 The method of any one of embodiments 1 to 90, wherein the ADC is formulated in a pharmaceutical composition comprising L-histidine, polysorbate-20 (TWEEN-20), and trehalose dehydrate.
  • Embodiment 92 The method of any one of embodiments 1 to 91, wherein the ADC is formulated in a pharmaceutical composition comprising about 20 mM L-histidine, about 0.02% (w/v) TWEEN-20, about 5.5% (w/v) trehalose dihydrate, and hydrochloride, and wherein the pH of the pharmaceutical composition is about 6.0 at 25°C.
  • Embodiment 93 The method of any one of embodiments 1 to 91, wherein the ADC is formulated in a pharmaceutical composition comprising about 9 mM histidine, about 11 mM histidine hydrochloride monohydrate, about 0.02% (w/v) TWEEN-20, and about 5.5% (w/v) trehalose dihydrate, and wherein the pH of the pharmaceutical composition is about 6.0 at 25°C.
  • Embodiment 94 The method of any one of embodiments 1 to 93, wherein the ADC is enfortumab vedotin (EV) or a biosimilar thereof, wherein the EV is administered at a dose of about 1.25 mg/kg of the subject’s body weight, and wherein the dose is administered by an IV injection or infusion over about 30 minutes on Days 1, 8 and 15 of every four- week cycle.
  • EV vedotin
  • Embodiment 95 The method of any one of embodiments 1 to 94, whereby a population of the subjects have a complete response following the treatment.
  • Embodiment 96 The method of any one of embodiments 1 to 94, wherein a population of the subjects have a partial response following the treatment.
  • Embodiment 97 The method of any one of embodiments 1 to 94, wherein a population of the subjects have a complete response or a partial response following the treatment.
  • Embodiment 98 The method of any one of embodiments 1 to 94, wherein a population of the subjects have a stable disease following the treatment.
  • FIGS. 1A-1E depict the nucleotide and amino acid sequences of nectin-4 protein (FIG. 1A), the nucleotide and amino acid sequences of the heavy chain (FIG. IB) and light chain (FIG. 1C) of Ha22-2(2.4)6.1, and the amino acid sequences of the heavy chain (FIG. ID) and light chain of Ha22-2(2.4)6.1 (FIG. IE).
  • FIG. 2A depicts the overall study design of the clinical study described in Section 6.1.
  • FIG. 2B depicts the study scheme of the clinical study described in Section 6.1.
  • FIG. 2C depicts the EuroQOL 5-dimensions (EQ-5D-5L) described in Section 6.1.
  • FIG. 3 depicts the analysis efficacy boundaries of the clinical study described in Section 6.1.
  • FIG. 4 depicts the Overall Survival, Kaplan Meier Plot - FAS of the clinical study described in Section 6.1.
  • FIG. 5 depicts the Overall Survival, Sub-groups Results of the clinical study described in Section 6.1.
  • FIG. 6 depicts the PFS, Kaplan Meier Plot - FAS of the clinical study described in Section 6.1.
  • FIG. 7 depicts the results of subgroup analyses, which show that a progression- free survival benefit with enfortumab vedotin (EV) was present across multiple subgroups.
  • FIG. 8 depicts the results of subgroup analyses of Overall Response Rate.
  • FIG. 9. depicts the Kaplan-Meier estimate for investigator-assessed duration of response based on treatment group in all patients with confirmed complete or partial response.
  • FIGS. 10A-10D depict Kaplan-Meier estimates of overall survival by subgroup.
  • FIG. 10A depicts the age ⁇ 65 years subgroup.
  • FIG. 10B depicts the subgroup with presence of liver metastasis.
  • FIG. 10C depicts the subgroup with primary upper tract disease.
  • FIG. 10D depicts the nonresponsive to prior PD-1/L1 inhibitor subgroup.
  • FIGS. 11A-11D depict Kaplan-Meier estimates of progression-free survival by subgroup.
  • FIG. 11A depicts the age ⁇ 65 years subgroup.
  • FIG. 11B depicts the subgroup with presence of liver metastasis.
  • FIG. 11C depicts the subgroup with primary upper tract disease.
  • FIG. 11D depicts the nonresponsive to prior PD-1/L1 inhibitor subgroup.
  • FIG. 12 depicts treatment-related adverse events (safety population).
  • EV enfortumab vedotin
  • PD-1/L programmed cell death protein-1 or programmed death-ligand 1
  • SC standard chemotherapy.
  • FIG. 13 depicts exposure-adjusted grade ⁇ 3 treatment-related adverse events in hard-to-treat subgroups.
  • EV enfortumab vedotin
  • PD-1/L programmed cell death protein- 1 or programmed death-ligand 1
  • SC standard chemotherapy. 5.
  • antibody immunoglobulin
  • Ig immunoglobulin
  • monoclonal antibodies including agonist, antagonist, neutralizing antibodies, full length or intact monoclonal antibodies
  • antibody compositions with polyepitopic or monoepitopic specificity polyclonal or monovalent antibodies
  • multivalent antibodies multispecific antibodies (e.g., bispecific antibodies so long as they exhibit the desired biological activity)
  • An antibody can be human, humanized, chimeric and/or affinity matured, as well as an antibody from other species, for example, mouse and rabbit, etc.
  • antibody is intended to include a polypeptide product of B cells within the immunoglobulin class of polypeptides that is able to bind to a specific molecular antigen and is composed of two identical pairs of polypeptide chains, wherein each pair has one heavy chain (about 50-70 kDa) and one light chain (about 25 kDa), each amino-terminal portion of each chain includes a variable region of about 100 to about 130 or more amino acids, and each carboxy -terminal portion of each chain includes a constant region. See, e.g., Antibody Engineering (Borrebaeck ed., 2d ed. 1995); and Kuby, Immunology (3d ed. 1997).
  • the specific molecular antigen can be bound by an antibody provided herein, including a polypeptide or an epitope.
  • Antibodies also include, but are not limited to, synthetic antibodies, recombinantly produced antibodies, camelized antibodies, intrabodies, anti -idiotypic (anti-Id) antibodies, and functional fragments (e.g., antigen-binding fragments) of any of the above, which refers to a portion of an antibody heavy or light chain polypeptide that retains some or all of the binding activity of the antibody from which the fragment was derived.
  • Non-limiting examples of functional fragments include single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), Fab fragments, F(ab’) fragments, F(ab)2 fragments, F(ab’)2 fragments, disulfide-linked Fvs (dsFv), Fd fragments, Fv fragments, diabody, triabody, tetrabody, and minibody.
  • scFv single-chain Fvs
  • Fab fragments F(ab’) fragments, F(ab)2 fragments, F(ab’)2 fragments
  • dsFv disulfide-linked Fvs
  • antibodies provided herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, for example, antigen-binding domains or molecules that contain an antigenbinding site that binds to an antigen (e.g., one or more CDRs of an antibody).
  • an antigen e.g., one or more CDRs of an antibody.
  • Such antibody fragments can be found in, for example, Harlow and Lane, Antibodies: A Laboratory Manual (1989); Mol. Biology and Biotechnology: A Comprehensive Desk Reference (Myers ed., 1995); Huston et al., 1993, Cell Biophysics 22: 189-224; Pluickthun and Skerra, 1989, Meth. Enzymol. 178:497-515; and Day, Advanced Immunochemistry (2d ed. 1990).
  • the antibodies provided herein can be of any class (e.g., IgG, IgE, IgM, IgD, and IgA) or any subclass (e.g., IgGl, IgG2, IgG3, IgG4, IgA1, and IgA2) of immunoglobulin molecule.
  • Antibodies may be agonistic antibodies or antagonistic antibodies.
  • the term “monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, that is, the individual antibodies comprising the population are identical except for possible naturally occurring mutations that can be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. In contrast to polyclonal antibody preparations, which can include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
  • An “antigen” is a structure to which an antibody can selectively bind.
  • a target antigen may be a polypeptide, carbohydrate, nucleic acid, lipid, hapten, or other naturally occurring or synthetic compound.
  • the target antigen is a polypeptide.
  • an antigen is associated with a cell, for example, is present on or in a cell, for example, a cancer cell.
  • An “intact” antibody is one comprising an antigen-binding site as well as a CL and at least heavy chain constant regions, CHI, CH2 and CH3. The constant regions may include human constant regions or amino acid sequence variants thereof.
  • an intact antibody has one or more effector functions.
  • antigen binding fragment refers to that portion of an antibody, which comprises the amino acid residues that interact with an antigen and confer on the binding agent its specificity and affinity for the antigen (e.g., the CDRs).
  • Antigen-binding fragment as used herein include “antibody fragment,” which comprise a portion of an intact antibody, such as the antigen-binding or variable region of the intact antibody. Examples of antibody fragments include, without limitation, Fab, Fab’, F(ab’)2, and Fv fragments; diabodies and di-diabodies (see, e.g., Holliger et al., 1993, Proc. Natl. Acad. Sci.
  • binding refers to an interaction between molecules including, for example, to form a complex. Interactions can be, for example, non-covalent interactions including hydrogen bonds, ionic bonds, hydrophobic interactions, and/or van der Waals interactions. A complex can also include the binding of two or more molecules held together by covalent or non-covalent bonds, interactions, or forces. The strength of the total non-covalent interactions between a single antigen-binding site on an antibody and a single epitope of a target molecule, such as an antigen, is the affinity of the antibody or functional fragment for that epitope.
  • the ratio of dissociation rate ( koff) to association rate (kon) of a binding molecule (e.g., an antibody) to a monovalent antigen ( koff/kon) is the dissociation constant KD, which is inversely related to affinity.
  • KD dissociation constant
  • the value of KD varies for different complexes of antibody and antigen and depends on both kon and koff.
  • the dissociation constant KD for an antibody provided herein can be determined using any method provided herein or any other method well-known to those skilled in the art.
  • the affinity at one binding site does not always reflect the true strength of the interaction between an antibody and an antigen.
  • an antibody or antigen binding fragment that binds to or specifically binds to an antigen may be cross-reactive with related antigens. In certain embodiments, an antibody or antigen binding fragment that binds to or specifically binds to an antigen does not cross-react with other antigens.
  • an antibody or antigen binding fragment that binds to or specifically binds to an antigen can be identified, for example, by immunoassays, Octet®, Biacore®, or other techniques known to those of skill in the art.
  • an antibody or antigen binding fragment binds to or specifically binds to an antigen when it binds to an antigen with higher affinity than to any cross-reactive antigen as determined using experimental techniques, such as radioimmunoassays (RIA) and enzyme linked immunosorbent assays (ELISAs).
  • RIA radioimmunoassays
  • ELISAs enzyme linked immunosorbent assays
  • a specific or selective reaction will be at least twice background signal or noise and may be more than 10 times background. See, e.g., Fundamental Immunology 332-36 (Paul ed., 2d ed.
  • the extent of binding of an antibody or antigen binding fragment to a “non-targef ’ protein is less than about 10% of the binding of the binding molecule or antigen binding domain to its particular target antigen, for example, as determined by fluorescence activated cell sorting (FACS) analysis or RIA.
  • FACS fluorescence activated cell sorting
  • specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target.
  • An antibody or antigen binding fragment that binds to an antigen includes one that is capable of binding the antigen with sufficient affinity such that the binding molecule is useful, for example, as a diagnostic agent in targeting the antigen.
  • an antibody or antigen binding fragment that binds to an antigen has a dissociation constant (KD) of less than or equal to 1000 nM, 800 nM, 500 nM, 250 nM, 100 nM, 50 nM, 10 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, or 0.1 nM.
  • KD dissociation constant
  • an antibody or antigen binding fragment binds to an epitope of an antigen that is conserved among the antigen from different species (e.g., between human and cyno species).
  • Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., a binding protein such as an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a binding molecule X for its binding partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein.
  • the “KD” or “KD value” may be measured by assays known in the art, for example by a binding assay.
  • the KD may be measured in a RIA, for example, performed with the Fab version of an antibody of interest and its antigen (Chen et al., 1999, J. Mol Biol 293:865-81).
  • the KD or KD value may also be measured by using biolayer interferometry (BLI) or surface plasmon resonance (SPR) assays by Octet®, using, for example, a Octet®QK384 system, or by Biacore®, using, for example, a Biacore®TM- 2000 or a Biacore®TM-3000.
  • An “on-rate” or “rate of association” or “association rate” or “kon” may also be determined with the same biolayer interferometry (BLI) or surface plasmon resonance (SPR) techniques described above using, for example, the Octet®QK384, the Biacore®TM-2000, or the Biacore®TM-3000 system.
  • the antibodies or antigen binding fragments can comprise “chimeric” sequences in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see U.S. Pat. No. 4,816,567; and Morrison et al., 1984, Proc. Natl. Acad. Sci. USA 81 :6851-55).
  • the antibodies or antigen binding fragments can comprise portions of “humanized” forms of nonhuman (e.g., murine) antibodies that are chimeric antibodies that include human immunoglobulins (e.g., recipient antibody) in which the native CDR residues are replaced by residues from the corresponding CDR of a nonhuman species (e.g., donor antibody) such as mouse, rat, rabbit, or nonhuman primate comprising the desired specificity, affinity, and capacity.
  • a nonhuman species e.g., donor antibody
  • humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • a humanized antibody heavy or light chain can comprise substantially all of at least one or more variable regions, in which all or substantially all of the CDRs correspond to those of a nonhuman immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • the humanized antibody will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • the antibodies or antigen binding fragments can comprise portions of a “fully human antibody” or “human antibody,” wherein the terms are used interchangeably herein and refer to an antibody that comprises a human variable region and, for example, a human constant region. In specific embodiments, the terms refer to an antibody that comprises a variable region and constant region of human origin. “Fully human” antibodies, in certain embodiments, can also encompass antibodies which bind polypeptides and are encoded by nucleic acid sequences which are naturally occurring somatic variants of human germline immunoglobulin nucleic acid sequence. The term “fully human antibody” includes antibodies comprising variable and constant regions corresponding to human germline immunoglobulin sequences as described by Kabat et al.
  • a “human antibody” is one that possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies. This definition of a human antibody specifically excludes a humanized antibody comprising nonhuman antigen-binding residues.
  • Human antibodies can be produced using various techniques known in the art, including phage-display libraries (Hoogenboom and Winter, 1991, J. Mol. Biol. 227:381; Marks et al., 1991, J. Mol. Biol.
  • Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., mice (see, e.g., Jakobovits, 1995, Curr. Opin. Biotechnol. 6(5):561-66; Bruggemann and Taussing, 1997, Curr. Opin. Biotechnol. 8(4):455-58; and U.S. Pat. Nos. 6,075,181 and 6,150,584 regarding XENOMOUSETM technology). See also, for example, Li et al., 2006, Proc. Natl. Acad. Sci. USA 103:3557-62 regarding human antibodies generated via a human B-cell hybridoma technology.
  • the antibodies or antigen binding fragments can comprise portions of a “recombinant human antibody,” wherein the phrase includes human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell, antibodies isolated from a recombinant, combinatorial human antibody library, antibodies isolated from an animal (e.g., a mouse or cow) that is transgenic and/or transchromosomal for human immunoglobulin genes (see e.g., Taylor, L. D. et al. (1992) Nucl. Acids Res.
  • human antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences.
  • Such recombinant human antibodies can have variable and constant regions derived from human germline immunoglobulin sequences (See Kabat, E. A. et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
  • such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
  • the antibodies or antigen binding fragments can comprise a portion of a “monoclonal antibody,” wherein the term as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, e.g., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts, and each monoclonal antibody will typically recognize a single epitope on the antigen.
  • a “monoclonal antibody,” as used herein is an antibody produced by a single hybridoma or other cell. The term “monoclonal” is not limited to any particular method for making the antibody.
  • the monoclonal antibodies useful in the present disclosure may be prepared by the hybridoma methodology first described by Kohler et al., 1975, Nature 256:495, or may be made using recombinant DNA methods in bacterial or eukaryotic animal or plant cells (see, e.g., U.S. Pat. No. 4,816,567).
  • the “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al., 1991, Nature 352:624-28 and Marks et al., 1991, J. Mol. Biol. 222:581-97, for example.
  • a typical 4-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains.
  • the 4- chain unit is generally about 150,000 daltons.
  • Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype.
  • Each H and L chain also has regularly spaced intrachain disulfide bridges.
  • Each H chain has at the N-terminus, a variable domain (VH) followed by three constant domains (CH) for each of the a and y chains and four CH domains for p and a isotypes.
  • Each L chain has at the N-terminus, a variable domain (VL) followed by a constant domain (CL) at its other end.
  • VL variable domain
  • CL constant domain
  • the VL is aligned with the VH
  • the CL is aligned with the first constant domain of the heavy chain (CHI).
  • Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
  • the pairing of a VH and VL together forms a single antigen-binding site.
  • Fab refers to an antibody region that binds to antigens.
  • a conventional IgG usually comprises two Fab regions, each residing on one of the two arms of the Y-shaped IgG structure.
  • Each Fab region is typically composed of one variable region and one constant region of each of the heavy and the light chain. More specifically, the variable region and the constant region of the heavy chain in a Fab region are VH and CHI regions, and the variable region and the constant region of the light chain in a Fab region are VL and CL regions.
  • the VH, CHI, VL, and CL in a Fab region can be arranged in various ways to confer an antigen binding capability according to the present disclosure.
  • VH and CHI regions can be on one polypeptide, and VL and CL regions can be on a separate polypeptide, similarly to a Fab region of a conventional IgG.
  • VH, CHI, VL and CL regions can all be on the same polypeptide and oriented in different orders as described in more detail the sections below.
  • variable region refers to a portion of the light or heavy chains of an antibody that is generally located at the aminoterminal of the light or heavy chain and has a length of about 120 to 130 amino acids in the heavy chain and about 100 to 110 amino acids in the light chain, and are used in the binding and specificity of each particular antibody for its particular antigen.
  • the variable region of the heavy chain may be referred to as “VH.”
  • the variable region of the light chain may be referred to as “VL.”
  • variable refers to the fact that certain segments of the variable regions differ extensively in sequence among antibodies. The V region mediates antigen binding and defines specificity of a particular antibody for its particular antigen.
  • variable regions consist of less variable (e.g., relatively invariant) stretches called framework regions (FRs) of about 15-30 amino acids separated by shorter regions of greater variability (e.g., extreme variability) called “hypervariable regions” that are each about 9-12 amino acids long.
  • FRs framework regions
  • hypervariable regions that are each about 9-12 amino acids long.
  • the variable regions of heavy and light chains each comprise four FRs, largely adopting a P sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases form part of, the ⁇ sheet structure.
  • the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see, e.g., Kabat et al., Sequences of Proteins of Immunological Interest (5th ed. 1991)).
  • the constant regions are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
  • the variable regions differ extensively in sequence between different antibodies.
  • the variable region is a human variable region.
  • variable region residue numbering refers to the numbering system used for heavy chain variable regions or light chain variable regions of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, an FR or CDR of the variable domain.
  • a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 and three inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.
  • the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al., supra).
  • the “EU numbering system” or “EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region (e.g., the EU index reported in Kabat et al., supra).
  • the “EU index as in Kabat” refers to the residue numbering of the human IgG 1 EU antibody.
  • the term “heavy chain” when used in reference to an antibody refers to a polypeptide chain of about 50-70 kDa, wherein the amino-terminal portion includes a variable region of about 120 to 130 or more amino acids, and a carboxy -terminal portion includes a constant region.
  • the constant region can be one of five distinct types, (e.g., isotypes) referred to as alpha (a), delta (6), epsilon (a), gamma (y), and mu (p), based on the amino acid sequence of the heavy chain constant region.
  • the distinct heavy chains differ in size: ⁇ , ⁇ , and ⁇ contain approximately 450 amino acids, while p and a contain approximately 550 amino acids.
  • these distinct types of heavy chains give rise to five well-known classes (e.g., isotypes) of antibodies, IgA, IgD, IgE, IgG, and IgM, respectively, including four subclasses of IgG, namely IgG1, IgG2, IgG3, and IgG4.
  • the term “light chain” when used in reference to an antibody refers to a polypeptide chain of about 25 kDa, wherein the amino-terminal portion includes a variable region of about 100 to about 110 or more amino acids, and a carboxy -terminal portion includes a constant region.
  • the approximate length of a light chain is 211 to 217 amino acids.
  • K kappa
  • A lambda
  • the terms “hypervariable region,” “HVR,” “Complementarity Determining Region,” and “CDR” are used interchangeably.
  • CDR refers to one of three hypervariable regions (Hl, H2 or H3) within the non-framework region of the immunoglobulin (Ig or antibody) VH ⁇ -sheet framework, or one of three hypervariable regions (L1, L2 or L3) within the non-framework region of the antibody VL ⁇ -sheet framework. Accordingly, CDRs are variable region sequences interspersed within the framework region sequences.
  • CDR regions are well-known to those skilled in the art and have been defined by well-known numbering systems.
  • CDRs Kabat Complementarity Determining Regions
  • Chothia refers instead to the location of the structural loops (see, e.g., Chothia and Lesk, 1987, J. Mol. Biol. 196:901-17).
  • the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35 A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
  • the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular’s AbM antibody modeling software (see, e.g., Antibody Engineering Vol. 2 (Kontermann and Diibel eds., 2d ed. 2010)).
  • the “contact” hypervariable regions are based on an analysis of the available complex crystal structures.
  • Another universal numbering system that has been developed and widely adopted is ImMunoGeneTics (IMGT) Information System® (Lafranc et al., 2003, Dev. Comp.
  • IMGT immunoglobulins
  • TCR T-cell receptors
  • MHC major histocompatibility complex
  • the CDRs are referred to in terms of both the amino acid sequence and the location within the light or heavy chain.
  • location of the CDRs within the structure of the immunoglobulin variable domain is conserved between species and present in structures called loops, by using numbering systems that align variable domain sequences according to structural features, CDR and framework residues are readily identified. This information can be used in grafting and replacement of CDR residues from immunoglobulins of one species into an acceptor framework from, typically, a human antibody.
  • CDR complementary determining region
  • individual CDRs e.g., “CDR-H1, CDR-H2
  • the scheme for identification of a particular CDR or CDRs is specified, such as the CDR as defined by the Kabat, Chothia, or Contact method. In other cases, the particular amino acid sequence of a CDR is given.
  • Hypervariable regions may comprise “extended hypervariable regions” as follows: 24-36 or 24-34 (LI), 46-56 or 50-56 (L2), and 89-97 or 89-96 (L3) in the VL, and 26-35 or 26-35A (Hl), 50-65 or 49-65 (H2), and 93-102, 94-102, or 95-102 (H3) in the VH.
  • constant region or “constant domain” refers to a carboxy terminal portion of the light and heavy chain which is not directly involved in binding of the antibody to antigen but exhibits various effector function, such as interaction with the Fc receptor.
  • the term refers to the portion of an immunoglobulin molecule comprising a more conserved amino acid sequence relative to the other portion of the immunoglobulin, the variable region, which contains the antigen binding site.
  • the constant region may contain the CHI, CH2, and CH3 regions of the heavy chain and the CL region of the light chain.
  • framework or “FR” refers to those variable region residues flanking the CDRs.
  • FR residues are present, for example, in chimeric, humanized, human, domain antibodies, diabodies, linear antibodies, and bispecific antibodies. FR residues are those variable domain residues other than the hypervariable region residues or CDR residues.
  • the term “Fc region” herein is used to define a C-terminal region of an immunoglobulin heavy chain, including, for example, native sequence Fc regions, recombinant Fc regions, and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc region is often defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
  • the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations comprising a mixture of antibodies with and without the K447 residue.
  • a “functional Fc region” possesses an “effector function” of a native sequence Fc region.
  • effector functions include Clq binding; CDC; Fc receptor binding; ADCC; phagocytosis; downregulation of cell surface receptors (e.g., B cell receptor), etc.
  • effector functions generally require the Fc region to be combined with a binding region or binding domain (e.g., an antibody variable region or domain) and can be assessed using various assays known to those skilled in the art.
  • a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification (e.g., substituting, addition, or deletion).
  • the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, for example, from about one to about ten amino acid substitutions, or from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of a parent polypeptide.
  • the variant Fc region herein can possess at least about 80% homology with a native sequence Fc region and/or with an Fc region of a parent polypeptide, or at least about 90% homology therewith, for example, at least about 95% homology therewith.
  • an “epitope” is a term in the art and refers to a localized region of an antigen to which a binding molecule (e.g., an antibody) can specifically bind.
  • An epitope can be a linear epitope or a conformational, non-linear, or discontinuous epitope.
  • an epitope can be contiguous amino acids of the polypeptide (a “linear” epitope) or an epitope can comprise amino acids from two or more non-contiguous regions of the polypeptide (a “conformational,” “non-linear” or “discontinuous” epitope).
  • a linear epitope may or may not be dependent on secondary, tertiary, or quaternary structure.
  • a binding molecule binds to a group of amino acids regardless of whether they are folded in a natural three dimensional protein structure.
  • a binding molecule requires amino acid residues making up the epitope to exhibit a particular conformation (e.g., bend, twist, turn or fold) in order to recognize and bind the epitope.
  • polypeptide and “peptide” and “protein” are used interchangeably herein and refer to polymers of amino acids of any length.
  • the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification.
  • polypeptides containing one or more analogs of an amino acid including but not limited to, unnatural amino acids, as well as other modifications known in the art. It is understood that, because the polypeptides of this disclosure may be based upon antibodies or other members of the immunoglobulin superfamily, in certain embodiments, a “polypeptide” can occur as a single chain or as two or more associated chains.
  • pharmaceutically acceptable means being approved by a regulatory agency of the Federal or a state government, or listed in United States Pharmacopeia, European Pharmacopeia, or other generally recognized Pharmacopeia for use in animals, and more particularly in humans.
  • Excipient means a pharmaceutically-acceptable material, composition, or vehicle, such as a liquid or solid filler, diluent, solvent, or encapsulating material.
  • Excipients include, for example, encapsulating materials or additives such as absorption accelerators, antioxidants, binders, buffers, carriers, coating agents, coloring agents, diluents, disintegrating agents, emulsifiers, extenders, fillers, flavoring agents, humectants, lubricants, perfumes, preservatives, propellants, releasing agents, sterilizing agents, sweeteners, solubilizers, wetting agents and mixtures thereof.
  • the term “excipient” can also refer to a diluent, adjuvant (e.g., Freunds’ adjuvant (complete or incomplete) or vehicle.
  • each component is “pharmaceutically acceptable” in the sense of being compatible with the other ingredients of a pharmaceutical formulation, and suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity, or other problems or complications, commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically acceptable excipients are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed.
  • a pharmaceutically acceptable excipient is an aqueous pH buffered solution.
  • MMAE monomethyl auristatin E
  • chemotherapeutic Agent refers to all chemical compounds that are effective in inhibiting tumor growth.
  • Non-limiting examples of chemotherapeutic agents include alkylating agents; for example, nitrogen mustards, ethyleneimine compounds and alkyl sulphonates; antimetabolites, for example, folic acid, purine or pyrimidine antagonists; mitotic inhibitors, for example, anti-tubulin agents such as vinca alkaloids, auristatins and derivatives of podophyllotoxin; cytotoxic antibiotics; compounds that damage or interfere with DNA expression or replication, for example, DNA minor groove binders; and growth factor receptor antagonists.
  • chemotherapeutic agents include cytotoxic agents (as defined herein), antibodies, biological molecules and small molecules.
  • substitutions of amino acids are known to those of skill in this art and may be made generally without altering the biological activity of the resulting molecule.
  • Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson, et al., MOLECULAR BIOLOGY OF THE GENE, The Benjamin/Cummings Pub. Co., p. 224 (4th Edition 1987)).
  • Such exemplary substitutions are preferably made in accordance with those set forth in Table 2 and Table 3.
  • such changes include substituting any of isoleucine (I), valine (V), and leucine (L) for any other of these hydrophobic amino acids; aspartic acid (D) for glutamic acid (E) and vice versa; glutamine (Q) for asparagine (N) and vice versa; and serine (S) for threonine (T) and vice versa.
  • substitutions can also be considered conservative, depending on the environment of the particular amino acid and its role in the three-dimensional structure of the protein. For example, glycine (G) and alanine (A) can frequently be interchangeable, as can alanine (A) and valine (V).
  • Methionine (M) which is relatively hydrophobic, can frequently be interchanged with leucine and isoleucine, and sometimes with valine. Lysine (K) and arginine (R) are frequently interchangeable in locations in which the significant feature of the amino acid residue is its charge and the differing pK's of these two amino acid residues are not significant. Still other changes can be considered "conservative” in particular environments (see, e.g. Table 3 herein; pages 13-15 “Biochemistry” 2nd ED.
  • homologous is intended to mean a sequence similarity between two polynucleotides or between two polypeptides. Similarity can be determined by comparing a position in each sequence, which can be aligned for purposes of comparison. If a given position of two polypeptide sequences is not identical, the similarity or conservativeness of that position can be determined by assessing the similarity of the amino acid of the position, for example, according to Table 3. A degree of similarity between sequences is a function of the number of matching or homologous positions shared by the sequences.
  • the alignment of two sequences to determine their percent sequence similarity can be done using software programs known in the art, such as, for example, those described in Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, MD (1999). Preferably, default parameters are used for the alignment, examples of which are set forth below.
  • One alignment program well known in the art that can be used is BLAST set to default parameters.
  • the term “homologs” of to a given amino acid sequence or a nucleic acid sequence is intended to indicate that the corresponding sequences of the “homologs” having substantial identity or homology to the given amino acid sequence or nucleic acid sequence.
  • the determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • a preferred, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul, 1990, Proc. Natl. Acad. Sci. U.S.A. 87:2264 2268, modified as in Karlin and Altschul, 1993, Proc. Natl. Acad. Sci. U.S.A.
  • Gapped BLAST can be utilized as described in Altschul et al., 1997, Nucleic Acids Res. 25:3389 3402.
  • PSI BLAST can be used to perform an iterated search which detects distant relationships between molecules (Id.).
  • the default parameters of the respective programs e.g., of XBLAST and NBLAST
  • NCBI National Center for Biotechnology Information
  • Another non-limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, 1988, CABIOS 4: 11 17. Such an algorithm is incorporated in the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package.
  • ALIGN program version 2.0
  • the percent identity between two sequences can be determined using techniques similar to those described above, with or without allowing gaps. In calculating percent identity, typically only exact matches are counted.
  • cytotoxic agent refers to a substance that inhibits or prevents the expression activity of cells, function of cells and/or causes destruction of cells.
  • the term is intended to include radioactive isotopes, chemotherapeutic agents, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof.
  • cytotoxic agents include, but are not limited to auristatins (e.g., auristatin E, auristatin F, MMAE and MMAF), auromycins, maytansinoids, ricin, ricin A-chain, combrestatin, duocarmycins, dolastatins, doxorubicin, daunorubicin, taxols, cisplatin, ccl065, ethidium bromide, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicine, dihydroxy anthracin dione, actinomycin, diphtheria toxin, Pseudomonas exotoxin (PE) A, PE40, abrin, abrin A chain, modeccin A chain, alpha-sarcin, gelonin, mitogellin, retstrictocin, phenomycin, enomycin, curicin, a
  • an effective amount or “therapeutically effective amount” as used herein refers to the amount of binding molecule (e.g., an antibody) or pharmaceutical composition provided herein which is sufficient to result in the desired outcome.
  • a subject is a mammal, such as a non-primate (e.g., cow, pig, horse, cat, dog, rat, etc.) or a primate (e.g., monkey and human).
  • the subject is a human.
  • the subject is a mammal, e.g., a human, diagnosed with a condition or disorder.
  • the subject is a mammal, e.g., a human, at risk of developing a condition or disorder.
  • administering refers to the act of injecting or otherwise physically delivering a substance as it exists outside the body into a patient, such as by mucosal, intradermal, intravenous, intramuscular delivery, and/or any other method of physical delivery described herein or known in the art.
  • treat refers to the reduction or amelioration of the progression, severity, and/or duration of a disease or condition resulting from the administration of one or more therapies.
  • Treating may be determined by assessing whether there has been a decrease, alleviation and/or mitigation of one or more symptoms associated with the underlying disorder such that an improvement is observed with the patient, despite that the patient may still be afflicted with the underlying disorder.
  • Treating includes both managing and ameliorating the disease.
  • the terms “manage,” “managing,” and “management” refer to the beneficial effects that a subject derives from a therapy which does not necessarily result in a cure of the disease.
  • prevent refers to reducing the likelihood of the onset (or recurrence) of a disease, disorder, condition, or associated symptom(s) (e.g., a cancer).
  • cancer or “cancer cell” is used herein to denote a tissue or cell found in a neoplasm which possesses characteristics which differentiate it from normal tissue or tissue cells. Among such characteristics include but are not limited to: degree of anaplasia, irregularity in shape, indistinctness of cell outline, nuclear size, changes in structure of nucleus or cytoplasm, other phenotypic changes, presence of cellular proteins indicative of a cancerous or pre-cancerous state, increased number of mitoses, and ability to metastasize. Words pertaining to “cancer” include carcinoma, sarcoma, tumor, epithelioma, leukemia, lymphoma, polyp, and scirrus, transformation, neoplasm, and the like.
  • a “locally advanced” cancer refers to a cancer that has spread from where it started to nearby tissue or lymph nodes.
  • a “metastatic” cancer refers to a cancer that has spread from where it started to different part of the body.
  • the term “and/or” as used in a phrase such as “A, B, and/or C” is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
  • variant refers to a molecule that exhibits a variation from a described type or norm, such as a protein that has one or more different amino acid residues in the corresponding position(s) of a specifically described protein (e.g. the 191P4D12 protein shown in FIG. 1A.)
  • An analog is an example of a variant protein.
  • Splice isoforms and single nucleotides polymorphisms (SNPs) are further examples of variants.
  • the “191P4D12 proteins” and/or “191P4D12 related proteins” of the disclosure include those specifically identified herein (see, FIG. 1A), as well as allelic variants, conservative substitution variants, analogs and homologs that can be isolated/generated and characterized without undue experimentation following the methods outlined herein or readily available in the art. Fusion proteins that combine parts of different 191P4D12 proteins or fragments thereof, as well as fusion proteins of a 191P4D12 protein and a heterologous polypeptide are also included. Such 191P4D12 proteins are collectively referred to as the 191P4D12-related proteins, the proteins of the disclosure, or 191P4D12.
  • 191P4D12-related protein refers to a polypeptide fragment or a 191P4D12 protein sequence of 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more than 25 amino acids; or, at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 225, 250, 275, 300, 325, 330, 335, 339 or more amino acids.
  • the term “191P4D12” is used interchangeably with nectin-4.
  • ADC antibody drug conjugate
  • the urothelial cancer has been previously treated with platinum-based chemotherapy and a CPI.
  • the urothelial cancer has been previously treated with platinum-based chemotherapy.
  • the urothelial cancer has been previously treated with a CPI.
  • the subject has been previously treated with platinum -based chemotherapy and a CPI.
  • the subject has been previously treated with platinum-based chemotherapy.
  • the subject has been previously treated with a CPI.
  • the locally advanced urothelial cancer has been previously treated with platinum-based chemotherapy and a CPI.
  • the locally advanced urothelial cancer has been previously treated with platinum -based chemotherapy.
  • the locally advanced urothelial cancer has been previously treated with a CPI.
  • the subject has been previously treated with platinum -based chemotherapy and a CPI.
  • the subject has been previously treated with platinum-based chemotherapy.
  • the subject has been previously treated with a CPI.
  • the metastatic urothelial cancer has been previously treated with platinum-based chemotherapy and a CPI.
  • the metastatic urothelial cancer has been previously treated with platinum-based chemotherapy.
  • the metastatic urothelial cancer has been previously treated with a CPI.
  • the subject has been previously treated with platinum-based chemotherapy and a CPI.
  • the subject has been previously treated with platinum-based chemotherapy.
  • the subject has been previously treated with a CPI.
  • the urothelial cancer has been previously treated with platinum-based chemotherapy and a PD-1 inhibitor.
  • the urothelial cancer has been previously treated with platinum-based chemotherapy.
  • the urothelial cancer has been previously treated with a PD-1 inhibitor.
  • the subject has been previously treated with platinum -based chemotherapy and a PD-1 inhibitor.
  • the subject has been previously treated with platinum-based chemotherapy.
  • the subject has been previously treated with a PD-1 inhibitor.
  • the locally advanced urothelial cancer has been previously treated with platinum -based chemotherapy and a PD-1 inhibitor.
  • the locally advanced urothelial cancer has been previously treated with platinum-based chemotherapy.
  • the locally advanced urothelial cancer has been previously treated with a PD-1 inhibitor.
  • the subject has been previously treated with platinum -based chemotherapy and a PD-1 inhibitor.
  • the subject has been previously treated with platinum-based chemotherapy.
  • the subject has been previously treated with a PD-1 inhibitor.
  • the metastatic urothelial cancer has been previously treated with platinum -based chemotherapy and a PD-1 inhibitor.
  • the metastatic urothelial cancer has been previously treated with platinum-based chemotherapy.
  • the metastatic urothelial cancer has been previously treated with a PD-1 inhibitor.
  • the subject has been previously treated with platinum -based chemotherapy and a PD-1 inhibitor.
  • the subject has been previously treated with platinum-based chemotherapy.
  • the subject has been previously treated with a PD-1 inhibitor.
  • the urothelial cancer has been previously treated with platinum-based chemotherapy and a PD-L1 inhibitor. In some embodiments, the urothelial cancer has been previously treated with platinum-based chemotherapy. In other embodiments, the urothelial cancer has been previously treated with a PD-L1 inhibitor. In one embodiment, the subject has been previously treated with platinum-based chemotherapy and a PD-L1 inhibitor. In another embodiment, the subject has been previously treated with platinum -based chemotherapy. In a further embodiment, the subject has been previously treated with a PD-L1 inhibitor.
  • ADC antibody drug conjugate
  • the locally advanced urothelial cancer has been previously treated with platinum-based chemotherapy and a PD-L1 inhibitor.
  • the locally advanced urothelial cancer has been previously treated with platinum-based chemotherapy.
  • the locally advanced urothelial cancer has been previously treated with a PD-L1 inhibitor.
  • the subject has been previously treated with platinum -based chemotherapy and a PD-L1 inhibitor.
  • the subject has been previously treated with platinum-based chemotherapy.
  • the subject has been previously treated with a PD-L1 inhibitor.
  • the metastatic urothelial cancer has been previously treated with platinum -based chemotherapy and a PD-L1 inhibitor.
  • the metastatic urothelial cancer has been previously treated with platinum-based chemotherapy.
  • the metastatic urothelial cancer has been previously treated with a PD-L1 inhibitor.
  • the subject has been previously treated with platinum -based chemotherapy and a PD-L1 inhibitor.
  • the subject has been previously treated with platinum-based chemotherapy.
  • the subject has been previously treated with a PD-L1 inhibitor.
  • the subject has been treated with one or more other cancer treatments.
  • the urothelial cancer including locally advanced or metastatic urothelial cancer, has been treated with one or more other cancer treatments.
  • the CPI provided for the methods can comprise or consist of any CPI as described in this Section (Section 5.2.1).
  • the ADCs that can be used are described in Sections 3, 5.2, 5.3, 5.4, 5.5, and 6, selection of patients for treatment is described herein and exemplified in this Section (Section 5.2) and Sections 3 and 6, dosing regimens and pharmaceutical composition for administering the therapeutic agent are described in this Section (Section 5.2), Sections 5.6, 5.7 and 6 below, the biomarkers that can be used for identifying the therapeutic agents, selecting the patients, determining the outcome of these methods, and/or serving as criteria in any way for these methods are described herein and exemplified in this Section (Section 5.2, including 5.2.1 and 5.2.2) and Section 6, the biomarkers can be determined as described in Section 5.8 or as known in the art, therapeutic outcomes for the methods provided herein can be improvement of the biomarkers described herein, for example, those described and exemplified in this Section (Section 5.2 including 5.2.2) and Section 6. Therefore
  • the methods provided herein are used for treating subjects having urothelial cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein. In some embodiments, the methods provided herein are used for treating subjects who have urothelial cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein and who have been previously treated with platinum-based chemotherapy and a CPI.
  • the methods provided herein are used for treating subjects who have urothelial cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein and who have been previously treated with platinumbased chemotherapy. In another embodiment, the methods provided herein are used for treating subjects who have urothelial cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein and who have been previously treated with a CPI.
  • the methods provided herein are used for treating subjects having locally advanced urothelial cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein. In some embodiments, the methods provided herein are used for treating subjects who have locally advanced urothelial cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein and who have been previously treated with platinum-based chemotherapy and a CPI.
  • the methods provided herein are used for treating subjects who have locally advanced urothelial cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein and who have been previously treated with platinum-based chemotherapy. In another embodiment, the methods provided herein are used for treating subjects who have locally advanced urothelial cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein and who have been previously treated with a CPI.
  • the methods provided herein are used for treating subjects having metastic cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein. In some embodiments, the methods provided herein are used for treating subjects who have metastic urothelial cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein and who have been previously treated with platinum-based chemotherapy and a CPI.
  • the methods provided herein are used for treating subjects who have metastic urothelial cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein and who have been previously treated with platinum-based chemotherapy. In another embodiment, the methods provided herein are used for treating subjects who have metastic urothelial cancers that express 191P4D12 RNA, express 191P4D12 protein, or express both 191P4D12 RNA and 191P4D12 protein and who have been previously treated with a CPI.
  • the 191P4D12 RNA expression in the cancers is determined by polynucleotide hybridization, sequencing (assessing the relative abundance of the sequences), and/or PCR (including RT-PCR).
  • the 191P4D12 protein expression in the cancers is determined by IHC, analysis in fluorescence-activated cell sorting (FACS), and/or western blotting.
  • the 191P4D12 protein expression in the cancers is determined by more than one method.
  • the 191P4D12 protein expression in the cancers is determined by two methods of IHC.
  • the locally advanced or metastatic urothelial cancers are confirmed histologically, cytologically, or both histologically and cytologically.
  • the locally advanced or metastatic bladder cancers are confirmed histologically, cytologically, or both histologically and cytologically
  • the subjects that can be treated in the methods provided herein include subjects who received one or more other treatments for cancer.
  • the subjects that can be treated in the methods provided herein include subjects who received one or more other treatments for cancer and whose cancer progressed or relapsed following the one or more treatments.
  • Such one or more treatments include, for example, one or more lines of immune checkpoint inhibitor therapies, chemotherapies, and both immune checkpoint inhibitor therapies and chemotherapies.
  • the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a therapy with a CPI.
  • the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a platinum-containing chemotherapy. In some embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a platinum-containing chemotherapy in the neoadjuvant setting. In some embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a platinum-containing chemotherapy in the adjuvant setting. In some embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a platinum-containing chemotherapy in the neoadjuvant, locally advanced setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a platinum-containing chemotherapy in the neoadjuvant, metastatic setting. In some embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a platinum-containing chemotherapy in the adjuvant, locally advanced setting. In some embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a platinum-containing chemotherapy in the adjuvant, metastatic setting. In some embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a platinum-containing chemotherapy in metastatic setting. In some embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a platinum-containing chemotherapy in the locally advanced setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a therapy with a CPI and a platinum-containing chemotherapy. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI and a platinum-containing chemotherapy in the neoadjuvant setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI and a platinum-containing chemotherapy in the adjuvant setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI and a platinum-containing chemotherapy in the locally advanced setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI and a platinum-containing chemotherapy in the metastatic setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI and a platinum- containing chemotherapy in the neoadjuvant, locally advanced setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI and a platinum- containing chemotherapy in the neoadjuvant, metastatic setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI and a platinum- containing chemotherapy in the adjuvant, locally advanced setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI and a platinum- containing chemotherapy in the adjuvant, metastatic setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a therapy with a CPI. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI in the neoadjuvant setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI in the adjuvant setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI in the locally advanced setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI in the metastatic setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI in the neoadjuvant, locally advanced setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI in the neoadjuvant, metastatic setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI in the adjuvant, locally advanced setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a CPI in the adjuvant, metastatic setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a therapy with a PD-1 inhibitor and a platinum-containing chemotherapy. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor and a platinum-containing chemotherapy in the neoadjuvant setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor and a platinum-containing chemotherapy in the adjuvant setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor and a platinum-containing chemotherapy in the locally advanced setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor and a platinum-containing chemotherapy in the metastatic setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor and a platinum-containing chemotherapy in the neoadjuvant, locally advanced setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor and a platinum-containing chemotherapy in the neoadjuvant, metastatic setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor and a platinum-containing chemotherapy in the adjuvant, locally advanced setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor and a platinum-containing chemotherapy in the adjuvant, metastatic setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a therapy with a PD-1 inhibitor. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor in the neoadjuvant setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor in the adjuvant setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor in the locally advanced setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor in the metastatic setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor in the neoadjuvant, locally advanced setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor in the neoadjuvant, metastatic setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor in the adjuvant, locally advanced setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-1 inhibitor in the adjuvant, metastatic setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a therapy with a PD-L1 inhibitor and a platinum-containing chemotherapy.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor and a platinum-containing chemotherapy in the neoadjuvant setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor and a platinum-containing chemotherapy in the adjuvant setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor and a platinum-containing chemotherapy in the locally advanced setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor and a platinum-containing chemotherapy in the metastatic setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor and a platinum-containing chemotherapy in the neoadjuvant, locally advanced setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor and a platinum-containing chemotherapy in the neoadjuvant, metastatic setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor and a platinum-containing chemotherapy in the adjuvant, locally advanced setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor and a platinum-containing chemotherapy in the adjuvant, metastatic setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancers progressed or relapsed following a therapy with a PD-L1 inhibitor. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor in the neoadjuvant setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor in the adjuvant setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor in the locally advanced setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor in the metastatic setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor in the neoadjuvant, locally advanced setting.
  • the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor in the neoadjuvant, metastatic setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor in the adjuvant, locally advanced setting. In some specific embodiments, the subjects that can be treated in the methods provided herein include subjects whose cancer progressed or relapsed following a therapy with a PD-L1 inhibitor in the adjuvant, metastatic setting.
  • the subjects that can be treated in the methods provided herein include those whose cancers have progressed or relapsed other treatments for cancers within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 months after the other treatments, including for example and not by way of limitation, any or any combination of the treatments described in the preceding paragraphs.
  • the cancers in the subjects have progressed or relapsed within 6 months after the platinum-based therapy.
  • the cancers in the subjects have progressed or relapsed within 12 months after a platinum-based therapy.
  • the subjects that can be treated in the methods provided herein have certain phenotypic or genotypic characteristics.
  • the subjects have any permutation and combination of the phenotypic or genotypic characteristics described herein.
  • the phenotypic or genotypic characteristics are determined histologically, cytologically, or both histologically and cytologically.
  • the histological and/or the cytological determination of the phenotypic and/or genotypic characteristics are performed as described in American Society of Clinical Oncology/College of American Pathologists (ASCO/CAP) guidelines based on the most recently analyzed tissue, which is incorporated herein in their entirety by reference.
  • the phenotypic or genotypic characteristics are determined by sequencing including the next generation sequencing (e.g. NGS from Illumina, Inc), DNA hybridization, and/or RNA hybridization.
  • the methods involve a prior treatment with an immune checkpoint inhibitor as provided in the method.
  • an immune checkpoint inhibitor or “checkpoint inhibitor” refers to molecules that totally or partially reduce, inhibit, interfere with or modulate one or more checkpoint proteins. Numerous checkpoint proteins are known, such as CTLA-4 and its ligands CD80 and CD86; and PD-1 with its ligands PD-L1 and PD- L2 (Pardoll, Nature Reviews Cancer, 2012, 72, 252-264).
  • checkpoint proteins include LAG-3, B7, TIM3 (HAVCR2), 0X40 (CD134), GITR, CD137, CD40, VTCN1, IDO1, CD276, PVRIG, TIGIT, CD25 (IL2RA), IFNAR2, IFNAR1, CSF1R, VSIR (VISTA), or HLA. These proteins appear responsible for co-stimulatory or inhibitory interactions of T-cell responses. Immune checkpoint proteins appear to regulate and maintain self-tolerance and the duration and amplitude of physiological immune responses. Immune checkpoint inhibitors include antibodies or are derived from antibodies.
  • the checkpoint inhibitor for the methods provided herein can be an inhibitors or activators against a checkpoint protein that upregulated in cancer.
  • the checkpoint inhibitor for the methods provided herein can be an inhibitors or activators against a checkpoint protein including LAG-3, B7, TIM3 (HAVCR2), 0X40 (CD134), GITR, CD137, CD40, VTCN1, IDO1, CD276, PVRIG, TIGIT, CD25 (IL2RA), IFNAR2, IFNAR1, CSF1R, VSIR (VISTA), or HLA.
  • the checkpoint inhibitor for the methods provided herein can be an inhibitors or activators selected from the group consisting of a PD-1 inhibitor, a PD-L1 inhibitor, a PD-L2 inhibitor, a CTLA-4 inhibitor, a LAG-3 inhibitor, a B7 inhibitor, a TIM3 (HAVCR2) inhibitor, an 0X40 (CD134) inhibitor, a GITR agonist, a CD137 agonist, or a CD40 agonist, a VTCN1 inhibitor, an IDO1 inhibitor, a CD276 inhibitor, a PVRIG inhibitor, a TIGIT inhibitor, a CD25 (IL2RA) inhibitor, an IFNAR2 inhibitor, an IFNAR1 inhibitor, a CSF1R inhibitor, a VSIR (VISTA) inhibitor, or a therapeutic agent targeting HL A.
  • Such inhibitors, activators, or therapeutic agents are further provided below.
  • the checkpoint inhibitor is a CTLA-4 inhibitor.
  • the CTLA-4 inhibitor is an anti-CTLA-4 antibody.
  • anti-CTLA-4 antibodies include, but are not limited to, those described in US Patent Nos: 5,811,097; 5,811,097; 5,855,887; 6,051,227; 6,207,157; 6,682,736; 6,984,720; and 7,605,238, all of which are incorporated herein in their entireties.
  • the anti-CTLA-4 antibody is tremelimumab (also known as ticilimumab or CP-675,206).
  • the anti-CTLA-4 antibody is ipilimumab (also known as MDX-010 or MDX- 101).
  • Ipilimumab is a fully human monoclonal IgG antibody that binds to CTLA-4. Ipilimumab is marketed under the trade name YervoyTM.
  • the checkpoint inhibitor is a PD-1/PD-L1 inhibitor.
  • PD-1/PD-L1 inhibitors include, but are not limited to, those described in US Patent Nos. 7,488,802; 7,943,743; 8,008,449; 8,168,757; 8,217,149, and PCT Patent Application Publication Nos. W02003042402, WO2008156712, W02010089411, W02010036959, WO2011066342, WO2011159877, WO2011082400, and WO2011161699, all of which are incorporated herein in their entireties.
  • the checkpoint inhibitor is a PD-1 inhibitor.
  • the PD-1 inhibitor is an anti-PD-1 antibody.
  • the anti-PD-1 antibody is BGB-A317, nivolumab (also known as ONO-4538, BMS-936558, or MDX1106) or pembrolizumab (also known as MK-3475, SCH 900475, or lambrolizumab).
  • the anti-PD-1 antibody is nivolumab.
  • Nivolumab is a human IgG4 anti-PD-1 monoclonal antibody, and is marketed under the trade name OpdivoTM.
  • the anti-PD-1 antibody is pembrolizumab.
  • Pembrolizumab is a humanized monoclonal IgG4 antibody and is marketed under the trade name KeytrudaTM.
  • the anti-PD-1 antibody is CT-011, a humanized antibody. CT-011 administered alone has failed to show response in treating acute myeloid leukemia (AML) at relapse.
  • the anti-PD-1 antibody is AMP -224, a fusion protein.
  • the PD-1 antibody is BGB-A317.
  • BGB-A317 is a monoclonal antibody in which the ability to bind Fc gamma receptor I is specifically engineered out, and which has a unique binding signature to PD-1 with high affinity and superior target specificity.
  • the PD-1 antibody is cemiplimab. In another embodiment, the PD-1 antibody is camrelizumab. In a further embodiment, the PD-1 antibody is sintilimab. In some embodiments, the PD-1 antibody is tislelizumab. In certain embodiments, the PD-1 antibody is TSR-042. In yet another embodiment, the PD-1 antibody is PDR001. In yet another embodiment, the PD-1 antibody is toripalimab.
  • the checkpoint inhibitor is a PD-L1 inhibitor.
  • the PD-L1 inhibitor is an anti-PD-Ll antibody.
  • the anti- PD-L1 antibody is MEDI4736 (durvalumab).
  • the anti-PD-Ll antibody is BMS-936559 (also known as MDX-1105-01).
  • the PD-L1 inhibitor is atezolizumab (also known as MPDL3280A, and Tecentriq®).
  • the PD-L1 inhibitor is avelumab.
  • the checkpoint inhibitor is a PD-L2 inhibitor.
  • the PD-L2 inhibitor is an anti-PD-L2 antibody.
  • the anti- PD-L2 antibody is rHIgM12B7A.
  • the checkpoint inhibitor is a lymphocyte activation gene-3 (LAG-3) inhibitor.
  • the LAG-3 inhibitor is IMP321, a soluble Ig fusion protein (Brignone et al., J. Immunol., 2007, 179, 4202-4211).
  • the LAG-3 inhibitor is BMS-986016.
  • the checkpoint inhibitors is a B7 inhibitor.
  • the B7 inhibitor is a B7-H3 inhibitor or a B7-H4 inhibitor.
  • the B7-H3 inhibitor is MGA271, an anti-B7-H3 antibody (Loo et al., Clin. Cancer Res., 2012, 3834).
  • the checkpoint inhibitors is a TIM3 (T-cell immunoglobulin domain and mucin domain 3) inhibitor (Fourcade et al., J. Exp. Med., 2010, 207, 2175-86; Sakuishi et al., J. Exp. Med., 2010, 207, 2187-94).
  • TIM3 T-cell immunoglobulin domain and mucin domain 3
  • the checkpoint inhibitor is an 0X40 (CD 134) agonist. In one embodiment, the checkpoint inhibitor is an anti-OX40 antibody. In one embodiment, the anti- 0X40 antibody is anti-OX-40. In another embodiment, the anti-OX40 antibody is MEDI6469.
  • the checkpoint inhibitor is a GITR agonist. In one embodiment, the checkpoint inhibitor is an anti-GITR antibody. In one embodiment, the anti- GITR antibody is TRX518. [00226] In one embodiment, the checkpoint inhibitor is a CD137 agonist. In one embodiment, the checkpoint inhibitor is an anti-CD137 antibody. In one embodiment, the anti-CD137 antibody is urelumab. In another embodiment, the anti-CD137 antibody is PF- 05082566.
  • the checkpoint inhibitor is a CD40 agonist. In one embodiment, the checkpoint inhibitor is an anti-CD40 antibody. In one embodiment, the anti- CD40 antibody is CF-870,893.
  • the checkpoint inhibitor is recombinant human interleukin- 15 (rhIL-15).
  • the checkpoint inhibitor is a VTCN inhibitor.
  • the VTCN inhibitor is FPA150.
  • the checkpoint inhibitor is an IDO inhibitor.
  • the IDO inhibitor is INCB024360.
  • the IDO inhibitor is indoximod.
  • the IDO inhibitor is epacadostat.
  • the IDO inhibitor is BMS986205.
  • the IDO inhibitor is Navoximod.
  • the IDO inhibitor is PF-06840003.
  • the IDO inhibitor is KHK2455.
  • the IDO inhibitor is RG70099.
  • the IDO inhibitor is I0M-E.
  • the IDO inhibitor is or I0M-D.
  • the checkpoint inhibitor is a TIGIT inhibitor.
  • the TIGIT inhibitor is an anti-TIGIT antibody.
  • the TIGIT inhibitor is MTIG7192A.
  • the TIGIT inhibitor is BMS-986207.
  • the TIGIT inhibitor is OMP-313M32.
  • the TIGIT inhibitor is MK-7684.
  • the TIGIT inhibitor is AB 154.
  • the TIGIT inhibitor is CGEN-15137.
  • the TIGIT inhibitor is SEA-TIGIT.
  • the TIGIT inhibitor is ASP8374.
  • the TIGIT inhibitor is AJUD008.
  • the checkpoint inhibitor is a VSIR inhibitor. In certain embodiments, the VSIR inhibitor is an anti-VSIR antibody. In one embodiment, the VSIR inhibitor is MTIG7192A. In another embodiment, the VSIR inhibitor is CA-170. In yet another embodiment, the VSIR inhibitor is JNJ 61610588. In one embodiment, the VSIR inhibitor is HMBD-002. [00233] In some embodiments, the checkpoint inhibitor is a TIM3 inhibitor. In certain embodiments, the TIM3 inhibitor is an anti-TIM3 antibody. In one embodiment, the TIM3 inhibitor is AJUD009.
  • the checkpoint inhibitor is a CD25 (IL2RA) inhibitor.
  • the CD25 (IL2RA) inhibitor is an anti-CD25 (IL2RA) antibody.
  • the CD25 (IL2RA) inhibitor is daclizumab.
  • the CD25 (IL2RA) inhibitor is basiliximab.
  • the checkpoint inhibitor is an IFNAR1 inhibitor.
  • the IFNAR1 inhibitor is an anti-IFNARl antibody.
  • the IFNAR1 inhibitor is anifrolumab.
  • the IFNARl inhibitor is sifalimumab.
  • the checkpoint inhibitor is a CSF1R inhibitor.
  • the CSF1R inhibitor is an anti-CSFIR antibody.
  • the CSF1R inhibitor is pexidartinib.
  • the CSF1R inhibitor is emactuzumab.
  • the CSF1R inhibitor is cabiralizumab.
  • the CSF1R inhibitor is ARRY-382.
  • the CSF1R inhibitor is BLZ945.
  • the CSF1R inhibitor is AJUD010.
  • the CSF1R inhibitor is AMG820.
  • the CSF1R inhibitor is IMC-CS4.
  • the CSF1R inhibitor is JNJ-40346527.
  • the CSF1R inhibitor is PLX5622.
  • the CSF1R inhibitor is FPA008.
  • the checkpoint inhibitor is a therapeutic agent targeting HLA.
  • the therapeutic agent targeting HLA is an anti-HLA antibody.
  • the therapeutic agent targeting HLA is GSK01.
  • the therapeutic agent targeting HLA is IMC-C103C.
  • the therapeutic agent targeting HLA is IMC-F106C.
  • the therapeutic agent targeting HLA is IMC-G107C.
  • the therapeutic agent targeting HLA is ABBV-184.
  • the immune checkpoint inhibitors provided herein include two or more of the checkpoint inhibitors described herein (including checkpoint inhibitors of the same or different class). Moreover, the methods described herein can be used in combination with one or more second active agents as described herein where appropriate for treating diseases described herein and understood in the art. [00239] In some embodiments, the checkpoint inhibitor is administered after the administration of the ADCs provided herein. In other embodiments, the checkpoint inhibitor is administered simultaneously (e.g., in the same dosing period) with the ADCs provided herein. In yet other embodiments, the checkpoint inhibitor is administered after the administration of the ADCs provided herein.
  • the amount of the checkpoint inhibitor for the various methods provided herein can be determined by standard clinical techniques. In certain embodiments, the amount of the checkpoint inhibitor for the various methods are provided in Section 5.6.
  • the subjects that can be treated in the methods provided herein is a mammal. In some embodiments, the subjects that can be treated in the methods provided herein is a human.
  • the human subjects for whom the methods provided herein can be used are human subjects having various other conditions.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract.
  • the human subjects for whom the methods provided herein can have visceral metastases.
  • the human subjects for whom the methods provided herein can have liver metastases.
  • the human subjects for whom the methods provided herein can have at least 1 Bellmunt risk factor.
  • the human subjects for whom the methods provided herein can have ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract and visceral metastases.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract and liver metastases. In certain embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract and at least 1 Bellmunt risk factor. In other embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract and ECOG performance status score of 0. In further embodiments, the human subjects for whom the methods provided herein can have visceral metastases and liver metastases. In one embodiment, the human subjects for whom the methods provided herein can have visceral metastases and at least 1 Bellmunt risk factor.
  • the human subjects for whom the methods provided herein can have visceral metastases and ECOG performance status score of 0. In other embodiments, the human subjects for whom the methods provided herein can have liver metastases and at least 1 Bellmunt risk factor. In yet other embodiments, the human subjects for whom the methods provided herein can have liver metastases and ECOG performance status score of 0. In one embodiment, the human subjects for whom the methods provided herein can have at least 1 Bellmunt risk factor and ECOG performance status score of 0. In other embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract, visceral metastases, and liver metastases.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract, visceral metastases and at least 1 Bellmunt risk factor. In further embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract, visceral metastases, and ECOG performance status score of 0. In some embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract, liver metastases and at least 1 Bellmunt risk factor. In certain embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract, liver metastases, and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract, at least 1 Bellmunt risk factor and ECOG performance status score of 0. In some embodiments, the human subjects for whom the methods provided herein can have visceral metastases, liver metastases and at least 1 Bellmunt risk factor. In certain embodiments, the human subjects for whom the methods provided herein can have visceral metastases, liver metastases, and ECOG performance status score of 0. In yet other embodiments, the human subjects for whom the methods provided herein can have visceral metastases, at least 1 Bellmunt risk factor and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have liver metastases, at least 1 Bellmunt risk factor and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract, visceral metastases, liver metastases, and at least 1 Bellmunt risk factor.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract, visceral metastases, liver metastases, and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract, visceral metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the lower urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0. In some embodiments, the human subjects for whom the methods provided herein can have any one of a primary site of tumor in the lower urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have any two of a primary site of tumor in the lower urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0, in any combination or permutation. In some embodiments, the human subjects for whom the methods provided herein can have any three of a primary site of tumor in the lower urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0, in any combination or permutation.
  • the human subjects for whom the methods provided herein can have any four of a primary site of tumor in the lower urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0, in any combination or permutation. In some embodiments, the human subjects for whom the methods provided herein can have all five of a primary site of tumor in the lower urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract and visceral metastases.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract and liver metastases.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract and at least 1 Bellmunt risk factor.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract, visceral metastases, and liver metastases. In yet other embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract, visceral metastases and at least 1 Bellmunt risk factor. In further embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract, visceral metastases, and ECOG performance status score of 0. In some embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract, liver metastases and at least 1 Bellmunt risk factor.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract, liver metastases, and ECOG performance status score of 0. In yet other embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract, at least 1 Bellmunt risk factor and ECOG performance status score of 0. In other embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract, visceral metastases, liver metastases, and at least 1 Bellmunt risk factor.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract, visceral metastases, liver metastases, and ECOG performance status score of 0. In some embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract, visceral metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0. In certain embodiments, the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have a primary site of tumor in the upper urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0. In some embodiments, the human subjects for whom the methods provided herein can have any one of a primary site of tumor in the upper urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can have any two of a primary site of tumor in the upper urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0, in any combination or permutation. In some embodiments, the human subjects for whom the methods provided herein can have any three of a primary site of tumor in the upper urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0, in any combination or permutation.
  • the human subjects for whom the methods provided herein can have any four of a primary site of tumor in the upper urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0, in any combination or permutation. In some embodiments, the human subjects for whom the methods provided herein can have all five of a primary site of tumor in the upper urinary tract, visceral metastases, liver metastases, at least 1 Bellmunt risk factor, and ECOG performance status score of 0.
  • the human subjects for whom the methods provided herein can be used are human subjects having various other conditions.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x 10 9 /L.
  • the human subjects for whom the methods provided herein can be used also have the conditions of hemoglobin no less than 9 g/dL.
  • the human subjects for whom the methods provided herein can be used also have the conditions of serum bilirubin no more than either of 1.5 times of upper limit of normal (ULN) or 3 times ULN for patients with Gilbert’s disease.
  • the human subjects for whom the methods provided herein can be used also have the conditions of CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of alanine aminotransferase (ALT) and aspartate aminotransferase (AST) no more than 3 fold of ULN.
  • ALT alanine aminotransferase
  • AST aspartate aminotransferase
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L and platelet count no less than 100x 10 9 /L. In some embodiments, the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L and hemoglobin no less than 9 g/dL. In certain embodiments, the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than l.0x 109/L and serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x l0 9 /L and CrCl no less than 30 mL/min. In some embodiments, the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than l.0x 10 9 /L and ALT and AST no more than 3 fold of ULN. In further embodiments, the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x10 9 /L and hemoglobin no less than 9 g/dL.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x10 9 /L and serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease. In some embodiments, the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x 10 9 /L and CrCl no less than 30 mL/min. In certain embodiments, the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x 10 9 /L and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of hemoglobin no less than 9 g/dL and serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease.
  • the human subjects for whom the methods provided herein can be used also have the conditions of hemoglobin no less than 9 g/dL and CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of hemoglobin no less than 9 g/dL and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease and CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of CrCl no less than 30 mL/min and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x l0 9 /L, platelet count no less than 100x l0 9 /L, and hemoglobin no less than 9 g/dL.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x l0 9 /L, platelet count no less than 100x l0 9 /L and serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than l.Ox 10 9 /L, platelet count no less than 100> ⁇ 109/L, and CrCl no less than 30 mL/min. In some embodiments, the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, platelet count no less than 100x10 9 /L, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, hemoglobin no less than 9 g/dL and serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, hemoglobin no less than 9 g/dL, and CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, hemoglobin no less than 9 g/dL, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1 ,0x 10 9 /L, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease and CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1 ,0x 10 9 /L, CrCl no less than 30 mL/min and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x10 9 /L, hemoglobin no less than 9 g/dL and serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x 10 9 /L, hemoglobin no less than 9 g/dL, and CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x 10 9 /L, hemoglobin no less than 9 g/dL, and ALT and AST no more than 3 fold of ULN. In other embodiments, the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x 10 9 /L, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease and CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x10 9 /L, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x10 9 /L, CrCl no less than 30 mL/min and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease and CrCl no less than 30 mL/min. In other embodiments, the human subjects for whom the methods provided herein can be used also have the conditions of hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of hemoglobin no less than 9 g/dL, CrCl no less than 30 mL/min and ALT and AST no more than 3 fold of ULN. In some embodiments, the human subjects for whom the methods provided herein can be used also have the conditions of serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, platelet count no less than 100x10 9 /L, hemoglobin no less than 9 g/dL, and serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, platelet count no less than 100x10 9 /L, hemoglobin no less than 9 g/dL, and CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0X 10 9 /L, platelet count no less than 100x l0 9 /L, hemoglobin no less than 9 g/dL, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1 ,0x 10 9 /L, platelet count no less than 100x 10 9 /L, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, and CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, platelet count no less than 100x l0 9 /L, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 109/L, platelet count no less than 100x l0 9 /L, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x l0 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, and CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0X 10 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0X 10 9 /L, hemoglobin no less than 9 g/dL, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x10 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, and CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x 10 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x 10 9 /L, hemoglobin no less than 9 g/dL, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x 10 9 /L, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, platelet count no less than 100x10 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, and CrCl no less than 30 mL/min.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, platelet count no less than 100x10 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x 10 9 /L, platelet count no less than 100x 10 9 /L, hemoglobin no less than 9 g/dL, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1 ,0x 10 9 /L, platelet count no less than 100x 10 9 /L, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than l.Ox 10 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of platelet count no less than 100x10 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of absolute neutrophil count no less than 1.0x l0 9 /L, platelet count no less than 100x l0 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of any one of absolute neutrophil count no less than 1.0x 10 9 /L, platelet count no less than 100x10 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN.
  • the human subjects for whom the methods provided herein can be used also have the conditions of any two of absolute neutrophil count no less than 1.0X 10 9 /L, platelet count no less than 100x l0 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN, in any combination or permutation.
  • the human subjects for whom the methods provided herein can be used also have the conditions of any three of absolute neutrophil count no less than 1.0x l0 9 /L, platelet count no less than 100x l0 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN, in any combination or permutation.
  • the human subjects for whom the methods provided herein can be used also have the conditions of any four of absolute neutrophil count no less than 1.0x l0 9 /L, platelet count no less than 100x10 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN, in any combination or permutation.
  • the human subjects for whom the methods provided herein can be used also have the conditions of any five of absolute neutrophil count no less than l.Ox 10 9 /L, platelet count no less than 100x 10 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN, in any combination or permutation.
  • the human subjects for whom the methods provided herein can be used also have the conditions of all six of absolute neutrophil count no less than 1.0X 10 9 /L, platelet count no less than 100x l0 9 /L, hemoglobin no less than 9 g/dL, serum bilirubin no more than either of 1.5 times of ULN or 3 times ULN for patients with Gilbert’s disease, CrCl no less than 30 mL/min, and ALT and AST no more than 3 fold of ULN. [00245] In other embodiments of the methods provided herein, including the methods of the preceding paragraphs, the human subjects for whom the methods provided herein can be used are human subjects free from certain conditions.
  • the human subjects for whom the methods provided herein can have no more than Grade 2 sensory or motor neuropathy. In some embodiments, the human subjects for whom the methods provided herein can have no active central nervous system metastases. In certain embodiments, the human subjects for whom the methods provided herein can have no uncontrolled diabetes. In one embodiment, the human subjects for whom the methods provided herein can have no more than Grade 2 sensory or motor neuropathy and no active central nervous system metastases. In some embodiments, the human subjects for whom the methods provided herein can have no more than Grade 2 sensory or motor neuropathy and no uncontrolled diabetes. In further embodiments, the human subjects for whom the methods provided herein can have no active central nervous system metastases and no uncontrolled diabetes.
  • the human subjects for whom the methods provided herein can have no more than Grade 2 sensory or motor neuropathy, no active central nervous system metastases, and no uncontrolled diabetes. In some embodiments, the human subjects for whom the methods provided herein can have any one of no more than Grade 2 sensory or motor neuropathy, no active central nervous system metastases, and no uncontrolled diabetes. In some embodiments, the human subjects for whom the methods provided herein can have any two of no more than Grade 2 sensory or motor neuropathy, no active central nervous system metastases, and no uncontrolled diabetes, in any combination or permutation. In some embodiments, the human subjects for whom the methods provided herein can have all three of no more than Grade 2 sensory or motor neuropathy, no active central nervous system metastases, and no uncontrolled diabetes.
  • the uncontrolled diabetes is determined by hemoglobin Ale (HbAlc) no less than 8%. In some embodiments of the methods provided in this paragraph, the uncontrolled diabetes is determined by HbAlc between 7 and 8% with associated diabetes symptoms that are not otherwise explained. In further embodiments of the methods provided in this paragraph, the associated diabetes symptoms comprise or consist of polyuria. In some other embodiments of the methods provided in this paragraph, the associated diabetes symptoms comprise or consist of polydipsia. In yet other embodiments of the methods provided in this paragraph, the associated diabetes symptoms comprise or consist of both polyuria and polydipsia.
  • the CrCl is measured by 24 hour urine collection. In other embodiments of the methods provided herein, the CrCl is estimated by the Cockcroft-Gault criteria. [00247] In some embodiments of the methods provided herein, the subject has been treated with one or more other cancer treatments. In certain embodiments of the methods provided herein, the urothelial cancer, including locally advanced or metastatic urothelial cancer, has been treated with one or more other cancer treatments.
  • the CPI provided for the methods can comprise or consist of any CPI as described in this Section (Section 5.2.1.1).
  • the methods provided herein can provide beneficial therapeutic outcomes for these human subjects having cancer.
  • the human subject has a complete response following the treatment by a method provided herein.
  • the human subject has a partial response following the treatment by a method provided herein.
  • the response is determined by evaluating the tumor or cancer site (lesions). The criteria for determining complete response (CR), partial response (PR), progressive disease (PD), and stable disease (SD) are described in Section 6 (e.g., at Section 6.1.6.3).
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 30% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 35% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 40% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 45% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 50% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 55% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 60% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 65% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 70% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 75% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 80% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 85% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters. In one embodiment, the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 90% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters. In another embodiment, the human subject has a partial response following the treatment by a method provided herein, wherein the partial response is defined by an at least or about 95% decrease in the sum of the diameters of target lesions, taking as reference the baseline sum diameters.
  • the diameter is determined according to the longest diameter of a lesion. In certain embodiments, the diameter is determined according to the longest diameter of a lesion in the plane of measurement. In some embodiments, the diameter is determined according to the longest diameter of a lesion in the plane of measurement with a minimal size of 10mm by CT scan. In certain embodiments, the diameter is determined according to the longest diameter of a lesion in the plane of measurement with a minimal size of 10mm by CT scan and CT slice thickness no greater than 5 mm.
  • the therapeutic outcomes of the methods provided herein can also be evaluated based on whether the disease is stable following the treatment.
  • the human subject has a stable disease following the treatment by a method provided herein.
  • the human subject does not have a progressive disease following the treatment by a method provided herein.
  • therapeutic outcomes based on the complete response, partial response, or stable disease can be evaluated with respect to a population of human subjects treated by a method provided herein by evaluating the percentage of the subjects having complete response, partial response, or stable disease in the treated population.
  • the therapeutic outcome or efficacy measure applies to outcomes achieved by actually treating a population of subjects.
  • the therapeutic outcome or efficacy measure refers to the outcome or efficacy that is capable of being achieved if a population of human subjects was treated with a method as disclosed herein. While the following sections discuss the treatment of an actual population of human subjects, is should be understood that corresponding methods in which the outcome or efficacy measure is capable of being achieved in a patient population are also encompassed herein. In short, both scenarios described above apply to the following sections; only one scenario is described below in the interest of simplicity and to avoid redundancy.
  • the ADC is enfortumab vedotin.
  • the ADC is a biosimilar of enfortumab vedotin.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 2%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 3%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 4%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 5%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 6%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 7%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 8%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 9%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 10%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 15%. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 20%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 20.2%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 22%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 22.5%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 23%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 25%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 30%. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 35%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having complete response in the treated population is at least or about 40%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 20%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 25%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 28%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 30%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 31%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 32%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 33%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 34%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 35%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 36%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 37%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 38%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 39%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 40%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 45%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having partial response in the treated population is at least or about 50%.
  • overall response rate which is the sum of percentage of subjects having completed response and those having partial response, can be used as the evaluation criteria for the therapeutic outcome in the human subjects treated by a method provided herein.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 20%.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 25%.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 30%.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 35%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 36%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 37%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 38%.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 39%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 40%. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 41%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 42%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 43%.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 44%. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 45%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 50%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 55%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 60%.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 65%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 70%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 75%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population is at least or about 80%.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 40% to 65%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 40% to 65%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 40% to 60%. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 40% to 55%.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 40% to 50%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 40% to 45%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 35% to 65%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 35% to 65%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 35% to 60%.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 35% to 55%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 35% to 50%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 35% to 45%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 35% to 40%.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 30% to 65%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 30% to 65%. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 30% to 60%. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 30% to 55%. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 30% to 50%.
  • a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 30% to 45%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 30% to 40%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein overall response rate in the treated population ranges from 30% to 35%.
  • percentage of the subjects having stable disease can be used as the evaluation criteria for the therapeutic outcome in the human subjects treated by a method provided herein.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 10%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 15%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 20%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 25%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 26%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 27%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 28%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 29%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 30%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 31%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 32%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 33%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 34%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 35%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 40%.
  • a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 45%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 50%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 55%. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the percentage of the subjects having stable disease in the treated population is at least or about 60%.
  • the therapeutic outcome of the methods provided herein can be evaluated based on the duration of response as set forth in Section 6.1.8.4.
  • the human subject has a duration of response of at least or about 4 months following the treatment.
  • the human subject has a duration of response of at least or about 5 months following the treatment.
  • the human subject has a duration of response of at least or about 6 months following the treatment.
  • the human subject has a duration of response of at least or about 7 months following the treatment.
  • the human subject has a duration of response of at least or about 8 months following the treatment.
  • the human subject has a duration of response of at least or about 9 months following the treatment.
  • the human subject has a duration of response of at least or about 10 months following the treatment. In yet another embodiment, the human subject has a duration of response of at least or about 11 months following the treatment. In one embodiment, the human subject has a duration of response of at least or about 12 months following the treatment. In another embodiment, the human subject has a duration of response of at least or about 13 months following the treatment. In a further embodiment, the human subject has a duration of response of at least or about 14 months following the treatment. In yet another embodiment, the human subject has a duration of response of at least or about 15 months following the treatment. In one embodiment, the human subject has a duration of response of at least or about 16 months following the treatment.
  • the human subject has a duration of response of at least or about 17 months following the treatment. In a further embodiment, the human subject has a duration of response of at least or about 18 months following the treatment. In yet another embodiment, the human subject has a duration of response of at least or about 19 months following the treatment. In a further embodiment, the human subject has a duration of response of at least or about 20 months following the treatment.
  • the human subject has a duration of response ranging from 4 to 22 months following the treatment. In certain embodiment, the human subject has a duration of response ranging from 5 to more than 22 months following the treatment. In another embodiment, the human subject has a duration of response ranging from 5 to 21 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 5 to 20 months following the treatment. In yet another embodiment, the human subject has a duration of response ranging from 5 to 19 months following the treatment. In one embodiment, the human subject has a duration of response ranging from 5 to 18 months following the treatment. In another embodiment, the human subject has a duration of response ranging from 5 to 17 months following the treatment.
  • the human subject has a duration of response ranging from 5 to 16 months following the treatment. In yet another embodiment, the human subject has a duration of response ranging from 5 to 15 months following the treatment. In one embodiment, the human subject has a duration of response ranging from 5 to 14 months following the treatment. In another embodiment, the human subject has a duration of response ranging from
  • the human subject has a duration of response ranging from 5 to 12 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 5 to 11 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 5 to 10 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 5 to 9 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 5 to 8 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 5 to 7 months following the treatment. In yet another embodiment, the human subject has a duration of response ranging from 6 to 22 months following the treatment. In another embodiment, the human subject has a duration of response ranging from
  • the human subject has a duration of response ranging from 6 to 20 months following the treatment. In yet another embodiment, the human subject has a duration of response ranging from 6 to 19 months following the treatment. In one embodiment, the human subject has a duration of response ranging from 6 to 18 months following the treatment. In another embodiment, the human subject has a duration of response ranging from 6 to 17 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 6 to 16 months following the treatment. In yet another embodiment, the human subject has a duration of response ranging from 6 to 15 months following the treatment. In one embodiment, the human subject has a duration of response ranging from 6 to 14 months following the treatment.
  • the human subject has a duration of response ranging from 6 to 13 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 6 to 12 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 6 to 11 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 6 to 10 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 6 to 9 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 6 to 8 months following the treatment. In one embodiment, the human subject has a duration of response ranging from 7 to 22 months following the treatment.
  • the human subject has a duration of response ranging from 7 to 21 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 7 to 20 months following the treatment. In yet another embodiment, the human subject has a duration of response ranging from 7 to 19 months following the treatment. In one embodiment, the human subject has a duration of response ranging from 7 to 18 months following the treatment. In another embodiment, the human subject has a duration of response ranging from 7 to 17 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 7 to 16 months following the treatment. In yet another embodiment, the human subject has a duration of response ranging from 7 to 15 months following the treatment.
  • the human subject has a duration of response ranging from 7 to 14 months following the treatment. In another embodiment, the human subject has a duration of response ranging from 7 to 13 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 7 to 12 months following the treatment. In another embodiment, the human subject has a duration of response ranging from 8 to 22 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 9 to 22 months following the treatment. In yet another embodiment, the human subject has a duration of response ranging from 10 to 22 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 11 to 22 months following the treatment.
  • the human subject has a duration of response ranging from 12 to 22 months following the treatment. In another embodiment, the human subject has a duration of response ranging from 13 to 22 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 14 to 22 months following the treatment. In yet another embodiment, the human subject has a duration of response ranging from 15 to 22 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 16 to 22 months following the treatment. In one embodiment, the human subject has a duration of response ranging from 17 to 22 months following the treatment. In another embodiment, the human subject has a duration of response ranging from 18 to 22 months following the treatment.
  • the human subject has a duration of response ranging from 6 to 21 months following the treatment. In yet another embodiment, the human subject has a duration of response ranging from 7 to 20 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 8 to 19 months following the treatment. In one embodiment, the human subject has a duration of response ranging from 9 to 18 months following the treatment. In another embodiment, the human subject has a duration of response ranging from 10 to 17 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 11 to 16 months following the treatment. In yet another embodiment, the human subject has a duration of response ranging from 12 to 15 months following the treatment. In a further embodiment, the human subject has a duration of response ranging from 13 to 14 months following the treatment.
  • the duration of response is evaluated for a population of human subjects treated by a method provided herein by evaluating the median or mean duration of response in the treated population.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 5 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 6 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 7 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 8 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 9 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 10 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 11 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 12 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 13 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 14 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 15 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 16 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 17 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 18 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 19 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean duration of response of in the treated population is at least or about 20 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 22 months. In some embodiments, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 21 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 20 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 19 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 18 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 17 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 16 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 15 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 14 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 13 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 12 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 11 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 10 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 9 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 8 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 5 to 7 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 22 months. In some embodiments, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 21 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 20 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 19 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 18 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 17 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 16 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 15 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 14 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 13 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 12 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 11 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 10 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 9 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 8 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 22 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 21 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 20 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 19 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 18 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 17 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 16 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 15 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 14 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 13 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 12 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 11 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 10 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 9 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 8 to 22 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 9 to 22 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 10 to 22 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 11 to 22 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 12 to 12 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 13 to 22 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 14 to 22 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 15 to 22 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 6 to 21 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 7 to 20 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 8 to 19 months.
  • a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 9 to 18 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 10 to 17 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 11 to 16 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the duration of response of in the treated population ranges from 12 to 15 months.
  • the therapeutic outcome of the methods provided herein can be evaluated based on the progression free survival as set forth in Section 6.1.8.4.
  • the human subject has a progression free survival of at least or about 2 months following the treatment.
  • the human subject has a progression free survival of at least or about 3 months following the treatment.
  • the human subject has a progression free survival of at least or about 4 months following the treatment.
  • the human subject has a progression free survival of at least or about 5 months following the treatment.
  • the human subject has a progression free survival of at least or about 6 months following the treatment.
  • the human subject has a progression free survival of at least or about 6.7 months following the treatment.
  • the human subject has a progression free survival of at least or about 7 months following the treatment. In yet another embodiment, the human subject has a progression free survival of at least or about 8 months following the treatment. In one embodiment, the human subject has a progression free survival of at least or about 9 months following the treatment. In another embodiment, the human subject has a progression free survival of at least or about 10 months following the treatment. In a further embodiment, the human subject has a progression free survival of at least or about 11 months following the treatment. In yet another embodiment, the human subject has a progression free survival of at least or about 12 months following the treatment. In one embodiment, the human subject has a progression free survival of at least or about 13 months following the treatment.
  • the human subject has a progression free survival of at least or about 14 months following the treatment. In a further embodiment, the human subject has a progression free survival of at least or about 15 months following the treatment. In yet another embodiment, the human subject has a progression free survival of at least or about 16 months following the treatment. In one embodiment, the human subject has a progression free survival of at least or about 17 months following the treatment. In another embodiment, the human subject has a progression free survival of at least or about 18 months following the treatment. In a further embodiment, the human subject has a progression free survival of at least or about 19 months following the treatment. In yet another embodiment, the human subject has a progression free survival of at least or about 20 months following the treatment.
  • the human subject has a progression free survival ranging from 5 to 10 months following the treatment. In some embodiments, the human subject has a progression free survival ranging from 5 to 9 months following the treatment. In a further embodiment, the human subject has a progression free survival ranging from 5 to 8 months following the treatment. In yet another embodiment, the human subject has a progression free survival ranging from 5 to 7 months following the treatment. In one embodiment, the human subject has a progression free survival ranging from 5 to 6 months following the treatment. In another embodiment, the human subject has a progression free survival ranging from 6 to 10 months following the treatment. In a further embodiment, the human subject has a progression free survival ranging from 7 to 10 months following the treatment.
  • the human subject has a progression free survival ranging from 8 to 10 months following the treatment. In one embodiment, the human subject has a progression free survival ranging from 9 to 10 months following the treatment. In another embodiment, the human subject has a progression free survival of ranging from 4 to 11 months following the treatment. In a further embodiment, the human subject has a progression free survival ranging from 4 to 10 months following the treatment. In yet another embodiment, the human subject has a progression free survival ranging from 4 to 9 months following the treatment. In one embodiment, the human subject has a progression free survival ranging from 4 to 8 months following the treatment. In another embodiment, the human subject has a progression free survival ranging from 4 to 7 months following the treatment.
  • the human subject has a progression free survival ranging from 5 to 11 months following the treatment. In yet another embodiment, the human subject has a progression free survival ranging from 6 to 11 months following the treatment. In one embodiment, the human subject has a progression free survival ranging from 7 to 11 months following the treatment. In another embodiment, the human subject has a progression free survival ranging from 8 to 11 months following the treatment. In a further embodiment, the human subject has a progression free survival ranging from 9 to 11 months following the treatment. In yet another embodiment, the human subject has a progression free survival ranging from 10 to 11 months following the treatment.
  • the progression free survival is evaluated for a population of human subjects treated by a method provided herein by evaluating the median or mean progression free survival in the treated population.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 2 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 3 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 4 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 5 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 6 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 7 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 8 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 9 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 10 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 11 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 12 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 13 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 14 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 15 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 16 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 17 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 18 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 19 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean progression free survival in the treated population is at least or about 20 months.
  • a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 5 to 9 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 5 to 8 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 5 to 7 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 5 to 6 months.
  • a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 6 to 9 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 7 to 9 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 8 to 9 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 4 to 10 months.
  • a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 5 to 10 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 6 to 10 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 7 to 10 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 8 to 10 months.
  • a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 9 to 10 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 4 to 10 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 4 to 9 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 4 to 8 months.
  • a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 4 to 7 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 4 to 6 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 4 to 5 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 4 to 11 months.
  • a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 5 to 11 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 6 to 11 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 7 to 11 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 8 to 11 months.
  • a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 9 to 11 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the progression free survival in the treated population ranges from 10 to 11 months.
  • the therapeutic outcome of the methods provided herein can be evaluated based on the overall survival. In one embodiment, the human subject has an overall survival of at least or about 5 months following the treatment. In another embodiment, the human subject has an overall survival of at least or about 6 months following the treatment. In a further embodiment, the human subject has an overall survival of at least or about 7 months following the treatment.
  • the human subject has an overall survival of at least or about 8 months following the treatment. In one embodiment, the human subject has an overall survival of at least or about 9 months following the treatment. In another embodiment, the human subject has an overall survival of at least or about 10 months following the treatment. In a further embodiment, the human subject has an overall survival of at least or about 11 months following the treatment. In yet another embodiment, the human subject has an overall survival of at least or about 12 months following the treatment. In one embodiment, the human subject has an overall survival of at least or about 13 months following the treatment. In another embodiment, the human subject has an overall survival of at least or about 14 months following the treatment. In yet another embodiment, the human subject has an overall survival of at least or about 15 months following the treatment.
  • the human subject has an overall survival of at least or about 16 months following the treatment. In another embodiment, the human subject has an overall survival of at least or about 17 months following the treatment. In a further embodiment, the human subject has an overall survival of at least or about 18 months following the treatment. In yet another embodiment, the human subject has an overall survival of at least or about 19 months following the treatment. In one embodiment, the human subject has an overall survival of at least or about 20 months following the treatment. In another embodiment, the human subject has an overall survival of at least or about 21 months following the treatment. In a further embodiment, the human subject has an overall survival of at least or about 22 months following the treatment. In a further embodiment, the human subject has an overall survival of at least or about 23 months following the treatment.
  • the human subject has an overall survival of at least or about 24 months following the treatment. In one embodiment, the human subject has an overall survival of at least or about 25 months following the treatment. In another embodiment, the human subject has an overall survival of at least or about 26 months following the treatment. In a further embodiment, the human subject has an overall survival of at least or about 27 months following the treatment. In one embodiment, the human subject has an overall survival of at least or about 28 months following the treatment. In another embodiment, the human subject has an overall survival of at least or about 29 months following the treatment. In a further embodiment, the human subject has an overall survival of at least or about 30 months following the treatment.
  • the human subject has an overall survival ranging from 10 to 19 months following the treatment. In another embodiment, the human subject has an overall survival ranging from 10 to 18 months following the treatment. In a further embodiment, the human subject has an overall survival ranging from 10 to 17 months following the treatment. In yet another embodiment, the human subject has an overall survival ranging from 10 to 16 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 10 to 15 months following the treatment. In another embodiment, the human subject has an overall survival ranging from 10 to 14 months following the treatment. In a further embodiment, the human subject has an overall survival ranging from 10 to 13 months following the treatment. In yet another embodiment, the human subject has an overall survival ranging from 10 to 12 months following the treatment.
  • the human subject has an overall survival ranging from 10 to 11 months following the treatment. In another embodiment, the human subject has an overall survival ranging from 11 to 19 months following the treatment. In a further embodiment, the human subject has an overall survival ranging from 12 to 19 months following the treatment. In yet another embodiment, the human subject has an overall survival ranging from 13 to 19 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 14 to
  • the human subject has an overall survival ranging from 14 to 19 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 15 to 18 months following the treatment. In another embodiment, the human subject has an overall survival ranging from 15 to 19 months following the treatment. In a further embodiment, the human subject has an overall survival ranging from 16 to 19 months following the treatment. In yet another embodiment, the human subject has an overall survival ranging from 17 to 19 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 18 to
  • the human subject has an overall survival ranging from 11 to 18 months following the treatment. In a further embodiment, the human subject has an overall survival ranging from 12 to 17 months following the treatment. In a further embodiment, the human subject has an overall survival ranging from 13 to 16 months following the treatment. In yet another embodiment, the human subject has an overall survival ranging from 14 to 15 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 10 to 20 months following the treatment. In another embodiment, the human subject has an overall survival ranging from 11 to 20 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 11 to 24 months following the treatment.
  • the human subject has an overall survival ranging from 11 to 25 months following the treatmentin one embodiment, the human subject has an overall survival ranging from 12 to 24 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 12 to 25 months following the treatment. In a further embodiment, the human subject has an overall survival ranging from 12 to 20 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 13 to 20 months following the treatment. In another embodiment, the human subject has an overall survival ranging from 14 to 20 months following the treatment. In a further embodiment, the human subject has an overall survival ranging from 15 to 20 months following the treatment. In yet another embodiment, the human subject has an overall survival ranging from 16 to 20 months following the treatment.
  • the human subject has an overall survival ranging from 17 to 20 months following the treatment. In another embodiment, the human subject has an overall survival ranging from 18 to 20 months following the treatment. In a further embodiment, the human subject has an overall survival ranging from 19 to 20 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 9 to 20 months following the treatment. In another embodiment, the human subject has an overall survival ranging from 9 to 19 months following the treatment. In a further embodiment, the human subject has an overall survival ranging from 9 to 18 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 9 to 17 months following the treatment. In another embodiment, the human subject has an overall survival ranging from 9 to 16 months following the treatment.
  • the human subject has an overall survival ranging from 9 to 15 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 9 to 14 months following the treatment. In another embodiment, the human subject has an overall survival ranging from 9 to 13 months following the treatment. In a further embodiment, the human subject has an overall survival ranging from 9 to 12 months following the treatment. In one embodiment, the human subject has an overall survival ranging from 9 to 11 months following the treatment. In another embodiment, the human subject has an overall survival ranging from 9 to 10 months following the treatment. [00270] Additionally, in some embodiments, the overall survival is evaluated for a population of human subjects treated by a method provided herein by evaluating the median or mean overall survival in the treated population.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 5 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 6 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 7 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 8 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 9 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 10 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 11 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 12 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 13 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 14 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 15 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 16 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 17 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 18 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 19 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 20 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 21 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 22 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 23 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 24 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 25 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 26 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 27 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 28 months.
  • a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 29 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the median or mean overall survival in the treated population is at least or about 30 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 10 to 19 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 10 to 18 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 10 to 17 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 10 to 16 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 10 to 15 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 10 to 14 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 10 to 13 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 10 to 12 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 10 to 11 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 10 to 19 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 11 to 19 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 11 to 24 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 11 to 25 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 12 to 24 months. In one embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 12 to 25 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 12 to 19 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 13 to 19 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 14 to 19 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 15 to 19 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 16 to 19 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 17 to 19 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 18 to 19 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 11 to 18 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 12 to 17 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 13 to 16 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 14 to 15 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 10 to 20 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 11 to 20 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 12 to 20 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 13 to 20 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 14 to 20 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 15 to 20 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 16 to 20 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 17 to 20 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 18 to 20 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 19 to 20 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 9 to 20 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 9 to 19 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 9 to 18 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 9 to 17 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 9 to 16 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 9 to 15 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 9 to 14 months. In yet another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 9 to 13 months.
  • a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 9 to 12 months. In another embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 9 to 11 months. In a further embodiment, a population of the human subjects is treated by a method provided herein, wherein the overall survival in the treated population ranges from 9 to 10 months.
  • a method of preventing or treating cancer in a subject comprising administering to the subject an effective amount of an antibody drug conjugate, wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds to 191P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23; and wherein the subject has any of the suitable characteristics as provided in Section 6.
  • CDRs complementarity determining regions
  • a method of preventing or treating cancer in a subject comprising administering to the subject an effective amount of an antibody drug conjugate, wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds to 191P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23; and wherein the cancer has any of the suitable markers and/or characteristics as provided in Section 6.
  • CDRs complementarity determining regions
  • a method of treating urothelial or bladder cancer in a human subject having liver metastases comprising administering to the subject having liver metastases an effective amount of an antibody drug conjugate, wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds to 191P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the subject has received an immune checkpoint inhibitor (CPI) therapy, and wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds tol91P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain
  • CDRs complementarity determining regions
  • a method of treating urothelial or bladder cancer in a human subject having liver metastases comprising administering to the subject having liver metastases an effective amount of an antibody drug conjugate, wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds to 191P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the subject has received an immune checkpoint inhibitor (CPI) therapy, and wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds tol91P4D12 conjugated to one or more units of monomethyl auri statin E (MMAE), wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light
  • CDRs complementarity determining regions
  • a method of treating urothelial or bladder cancer in a human subject having a primary site of tumor in the upper urinary tract comprising administering to the subject having a primary site of tumor in the upper urinary tract an effective amount of an antibody drug conjugate, wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds to 191P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the subject has received an immune checkpoint inhibitor (CPI) therapy, and wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds tol91P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 and a light chain variable region comprising CDR
  • CDRs complementarity determining regions
  • a method of treating urothelial or bladder cancer in a human subject having a primary site of tumor in the upper urinary tract comprising administering to the subject having a primary site of tumor in the upper urinary tract an effective amount of an antibody drug conjugate, wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds to 191P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the subject has received an immune checkpoint inhibitor (CPI) therapy, and wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds tol91P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 and a light chain variable region comprising CDR
  • CDRs complementarity determining regions
  • a method of treating urothelial or bladder cancer in a human subject comprising administering to the subject an effective amount of an antibody drug conjugate, wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds to 191P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the subject has received an immune checkpoint inhibitor (CPI) therapy, wherein the subject had progression or recurrence of the cancer during or following the CPI therapy, and wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds tol91P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 and a light chain variable region comprising CDRs comprising
  • CDRs complementarity determining regions
  • a method of treating urothelial or bladder cancer in a human subject comprising administering to the subject an effective amount of an antibody drug conjugate, wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds to 191P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the subject has received an immune checkpoint inhibitor (CPI) therapy, wherein the subject had progression or recurrence of the cancer during or following the CPI therapy, and wherein the antibody drug conjugate comprises an antibody or antigen binding fragment thereof that binds tol91P4D12 conjugated to one or more units of monomethyl auristatin E (MMAE), wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 and a light chain variable region comprising CDRs comprising the
  • CDRs complementarity determining regions
  • the ADC used in the methods comprises or is an anti-191P4D12 ADC described herein and/or in US Patent No. 8,637,642, which is herein incorporated in its entirety by reference.
  • the anti-191P4D12 antibody drug conjugate provided for the methods herein comprises an antibody or antigen binding fragment thereof that binds to 191P4D12 as provided herein, including in Subsection 5.3.1, conjugated to one or more units of cytotoxic agents (drug units, or D) as provided herein, including in this Section (Section 5.3) with further disclosures in Subsection 5.3.2.
  • the cytotoxic agents (drug units, or D) can be covalently linked directly or via a linker unit (LU).
  • the antibody drug conjugate compound has the following formula:
  • L is the antibody unit, e.g., the anti-nectin-4 antibody or an antigen binding fragment thereof as provided in Subsection 5.3.1 below, and (LU-D) is a linker unit-drug unit moiety, wherein: LU- is a linker unit, and
  • D is a drug unit having cytostatic or cytotoxic activity against a target cell; and p is an integer from 1 to 20.
  • p ranges from 1 to 20, 1 to 19, 1 to 18, 1 to 17, 1 to 16, 1 to
  • p ranges from 2 to 20, 2 to 19, 2 to 18, 2 to 17, 2 to 16, 2 to
  • p ranges from 3 to 20, 3 to 19, 3 to 18, 3 to 17, 3 to 16, 3 to 15, 3 to 14, 3 to 13, 3 to 12, 3 to 11, 3 to 10, 3 to 9, 3 to 8, 3 to 7, 3 to 6, 3 to 5, or 3 to 4.
  • p is about 1.
  • p is about 2.
  • p is about 3.
  • p is about 4.
  • p is about 3.8.
  • p is about 5.
  • p is about 6.
  • p is about 7.
  • p is about 8.
  • p is about 9.
  • p is about 10.
  • p is about 11.
  • p is about 12. In some embodiments, p is about 13. In some embodiments, p is about 14. In some embodiments, p is about 15. In some embodiments, p is about 16. In some embodiments, p is about 17. In some embodiments, p is about 18. In some embodiments, p is about 19. In some embodiments, p is about 20.
  • the antibody drug conjugate compound has the following formula:
  • L is the Antibody unit, e.g., the anti-nectin-4 antibody or an antigen binding fragment thereof as provided in Subsection 5.3.1 below; and -Aa-Ww-Yy- is a linker unit (LU), wherein: -A- is a stretcher unit, a is 0 or 1, each -W- is independently an amino acid unit, w is an integer ranging from 0 to 12, -Y- is a self-immolative spacer unit, y is 0, 1 or 2;
  • LU linker unit
  • D is a drug units having cytostatic or cytotoxic activity against the target cell; and p is an integer from 1 to 20.
  • a is 0 or 1, w is 0 or 1, and y is 0, 1 or 2. In some embodiments, a is 0 or 1, w is 0 or 1, and y is 0 or 1. In some embodiments, p ranges from 1 to 20, 1 to 19, 1 to 18, 1 to 17, 1 to 16, 1 to 15, 1 to 14, 1 to 13, 1 to 12, 1 to 11, 1 to 10, 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2. In some embodiments, p ranges from 2 to 20, 2 to 19, 2 to 18, 2 to 17, 2 to 16, 2 to 15, 2 to 14, 2 to 13, 2 to 12, 2 to 11, 2 to 10, 2 to 9, 2 to 8, 2 to 7, 2 to 6, 2 to 5, 2 to 4 or 2 to 3.
  • p ranges from 3 to 20, 3 to 19, 3 to 18, 3 to 17, 3 to 16, 3 to 15, 3 to 14, 3 to 13, 3 to 12, 3 to 11, 3 to 10, 3 to 9, 3 to 8, 3 to 7, 3 to 6, 3 to 5, or 3 to 4.
  • p is about 1.
  • p is about 2.
  • p is about 3.
  • p is about 4.
  • p is about 3.8.
  • p is about 5.
  • p is about 6.
  • p is about 7.
  • p is about 8.
  • p is about 9.
  • p is about 10.
  • p is about 11.
  • p is about 12. In some embodiments, p is about 13. In some embodiments, p is about 14. In some embodiments, p is about 15. In some embodiments, p is about 16. In some embodiments, p is about 17. In some embodiments, p is about 18. In some embodiments, p is about 19. In some embodiments, p is about 20. In some embodiments, when w is not zero, y is 1 or 2. In some embodiments, when w is 1 to 12, y is 1 or 2. In some embodiments, w is 2 to 12 and y is 1 or 2. In some embodiments, a is 1 and w and y are 0. [00287] In some specific embodiments of the methods provided herein, including the methods provided in Section 5.2, the cytotoxic agent as part of any of the ADCs provided herein for the methods comprises, consists of, or is MMAE.
  • the drug loading is represented by p, the average number of drug molecules per antibody unit.
  • Drug loading can range from 1 to 20 drugs (D) per antibody.
  • the average number of drugs per antibody in preparation of conjugation reactions can be characterized by conventional means such as mass spectroscopy, ELISA assay, and HPLC.
  • the quantitative distribution of antibody drug conjugates in terms of p can also be determined.
  • separation, purification, and characterization of homogeneous antibody drug conjugates where p is a certain value from antibody drug conjugates with other drug loadings can be achieved by means such as reverse phase HPLC or electrophoresis.
  • p is from 2 to 8.
  • the antibody or antigen binding fragment thereof that binds to nectin-4-related proteins is an antibody or antigen binding fragment that specifically binds to nectin-4 protein comprising amino acid sequence of SEQ ID NO:2 (see FIG. 1A).
  • the corresponding cDNA encoding the 191P4D12 protein has a sequence of SEQ ID NO: 1 (see FIG. 1A)
  • the antibody that specifically binds to nectin-4 protein comprising amino acid sequence of SEQ ID NO:2 includes antibodies that can bind to other nectin-4-related proteins.
  • antibodies that bind nectin-4 protein comprising amino acid sequence of SEQ ID NO:2 can bind nectin-4-related proteins such as nectin-4 variants and the homologs or analogs thereof.
  • the anti-nectin-4 antibody provided herein is a monoclonal antibody.
  • the antibody comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:4 (cDNA sequence of SEQ ID NO:3), and/or a light chain comprising an amino acid sequence of SEQ ID NO: 6 (cDNA sequence of SEQ ID NO:5), as shown in FIGS. IB and 1C.
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 (which is the amino acid sequence ranging from the 20th amino acid (glutamic acid) to the 136th amino acid (serine) of SEQ ID NO: 7) and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 (which is the amino acid sequence ranging from the 23rd amino acid (aspartic acid) to the 130th amino acid (arginine) of SEQ ID NO:8).
  • CDRs complementarity determining regions
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining region 1 (CDR-H1), CDR-H2, and CDR-H3 comprising the amino acid sequences of the corresponding CDR-H1, CDR-H2, and CDR-H3 in the heavy chain variable region sequence set forth in SEQ ID NO:22 (which is the amino acid sequence ranging from the 20th amino acid (glutamic acid) to the 136th amino acid (serine) of SEQ ID NO: 7) and a light chain variable region comprising CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences of the corresponding CDR-L1, CDR-L2, and CDR-L3 in the light chain variable region sequence set forth in SEQ ID NO:23 (which is the amino acid sequence ranging from the 23rd amino acid (aspartic acid) to the 130th amino acid (arginine) of SEQ ID NO: 8).
  • CDR-H1 complementarity determining region
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining regions (CDRs) consisting of the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 (which is the amino acid sequence ranging from the 20th amino acid (glutamic acid) to the 136th amino acid (serine) of SEQ ID NO: 7) and a light chain variable region comprising CDRs consisting of the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 (which is the amino acid sequence ranging from the 23rd amino acid (aspartic acid) to the 130th amino acid (arginine) of SEQ ID NO:8).
  • CDRs complementarity determining regions
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising complementarity determining region 1 (CDR-H1), CDR-H2, and CDR-H3 consisting of the amino acid sequences of the corresponding CDR-H1, CDR-H2, and CDR-H3 in the heavy chain variable region sequence set forth in SEQ ID NO:22 (which is the amino acid sequence ranging from the 20th amino acid (glutamic acid) to the 136th amino acid (serine) of SEQ ID NO: 7) and a light chain variable region comprising CDR-L1, CDR-L2, and CDR-L3 consisting of the amino acid sequences of the corresponding CDR-L1, CDR-L2, and CDR-L3 in the light chain variable region sequence set forth in SEQ ID NO:23 (which is the amino acid sequence ranging from the 23rd amino acid (aspartic acid) to the 130th amino acid (arginine) of SEQ ID NO:8).
  • SEQ ID NO: 22 SEQ ID
  • SEP ID NO: 8 MDMRVPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVGDRVTITCRASQGISGWLA WYQQKPGKAPKFLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQAN SFPPTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK SFNRGEC
  • CDR sequences can be determined according to well-known numbering systems. As described above, CDR regions are well-known to those skilled in the art and have been defined by well-known numbering systems. For example, the Kabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (see, e.g., Kabat et al., supra). Chothia refers instead to the location of the structural loops (see, e.g., Chothia and Lesk, 1987, J. Mol. Biol. 196:901-17).
  • the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35 A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
  • the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular’s AbM antibody modeling software (see, e.g., Antibody Engineering Vol. 2 (Kontermann and Diibel eds., 2d ed. 2010)).
  • IMGT ImMunoGeneTics
  • IG immunoglobulins
  • TCR T-cell receptors
  • MHC major histocompatibility complex
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising CDRs (CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to Kabat numbering and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to Kabat numbering.
  • CDRs CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising CDRs (CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to AbM numbering and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to AbM numbering.
  • CDRs CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising CDRs (CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to Chothia numbering and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to Chothia numbering.
  • CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to Chothia numbering
  • a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to Chothia numbering.
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising CDRs (CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to Contact numbering and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to Contact numbering.
  • CDRs CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising CDRs (CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3) comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to IMGT numbering and a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to IMGT numbering.
  • CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to IMGT numbering
  • a light chain variable region comprising CDRs comprising the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to IMGT numbering.
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising CDRs (CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3) consisting of the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to Kabat numbering and a light chain variable region comprising CDRs consisting of the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to Kabat numbering.
  • CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3 consisting of the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to Kabat numbering
  • a light chain variable region comprising CDRs consisting of the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to Kabat numbering.
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising CDRs (CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3) consisting of the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to AbM numbering and a light chain variable region comprising CDRs consisting of the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to AbM numbering.
  • CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3 consisting of the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to AbM numbering
  • a light chain variable region comprising CDRs consisting of the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to AbM numbering.
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising CDRs (CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3) consisting of the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to Chothia numbering and a light chain variable region comprising CDRs consisting of the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to Chothia numbering.
  • CDRs CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising CDRs (CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3) consisting of the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to Contact numbering and a light chain variable region comprising CDRs consisting of the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to Contact numbering.
  • CDRs CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3
  • the anti-nectin-4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising CDRs (CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3) consisting of the amino acid sequences of the CDRs of the heavy chain variable region set forth in SEQ ID NO:22 according to IMGT numbering and a light chain variable region comprising CDRs consisting of the amino acid sequences of the CDRs of the light chain variable region set forth in SEQ ID NO:23 according to IMGT numbering.
  • CDRs CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3
  • the CDR sequences according to different numbering systems can be readily determined, e.g., using online tools such as the one provided by Antigen receptor Numbering And Receptor Classification (ANARCI).
  • ANARCI Antigen receptor Numbering And Receptor Classification
  • the heavy chain CDR sequences within SEQ ID NO:22, and the light chain CDR sequences within SEQ ID NO:23 according to Kabat numbering as determined by ANARCI are listed in Table 4 below.
  • the antibody or antigen binding fragment thereof comprises CDR-H1 comprising an amino acid sequence of SEQ ID NO:9, CDR-H2 comprising an amino acid sequence of SEQ ID NO: 10, CDR-H3 comprising an amino acid sequence of SEQ ID NO: 11, CDR-L1 comprising an amino acid sequence of SEQ ID NO:NO: 12, CDR-L2 comprising an amino acid sequence of SEQ ID NO:NO: 13, and CDR- L3 comprising an amino acid sequence of SEQ ID NO:NO: 14.
  • the antibody or antigen binding fragment thereof comprises CDR-H1 comprising an amino acid sequence of SEQ ID NO: 16, CDR-H2 comprising an amino acid sequence of SEQ ID NO: 17, CDR-H3 comprising an amino acid sequence of SEQ ID NO: 18, CDR-L1 comprising an amino acid sequence of SEQ ID NO:NO: 19, CDR-L2 comprising an amino acid sequence of SEQ ID NO:NO:20, and CDR- L3 comprising an amino acid sequence of SEQ ID NO:NO:21.
  • the antibody or antigen binding fragment thereof comprises CDR-H1 consisting of an amino acid sequence of SEQ ID NO:9, CDR-H2 consisting of an amino acid sequence of SEQ ID NO: 10, CDR-H3 consisting of an amino acid sequence of SEQ ID NO: 11, CDR-L1 consisting of an amino acid sequence of SEQ ID NO:NO: 12, CDR-L2 consisting of an amino acid sequence of SEQ ID NO:NO:13, and CDR- L3 consisting of an amino acid sequence of SEQ ID NO:NO: 14.
  • the antibody or antigen binding fragment thereof comprises CDR-H1 consisting of an amino acid sequence of SEQ ID NO: 16, CDR-H2 consisting of an amino acid sequence of SEQ ID NO: 17, CDR-H3 consisting of an amino acid sequence of SEQ ID NO: 18, CDR-L1 consisting of an amino acid sequence of SEQ ID NO:NO: 19, CDR-L2 consisting of an amino acid sequence of SEQ ID NO:NO:20, and CDR- L3 consisting of an amino acid sequence of SEQ ID NO:NO:21.
  • the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:22 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:23.
  • the antibody or antigen binding fragment thereof comprises a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO:22 and a light chain variable region consisting of the amino acid sequence of SEQ ID NO:23.
  • the antibody comprises a heavy chain comprising the amino acid sequence ranging from the 20th amino acid (glutamic acid) to the 466th amino acid (lysine) of SEQ ID NO:7 and a light chain comprising the amino acid sequence ranging from the 23rd amino acid (aspartic acid) to the 236th amino acid (cysteine) of SEQ ID NO:8.
  • the antibody comprises a heavy chain consisting of the amino acid sequence ranging from the 20th amino acid (glutamic acid) to the 466th amino acid (lysine) of SEQ ID NO:7 and a light chain consisting of the amino acid sequence ranging from the 23rd amino acid (aspartic acid) to the 236th amino acid (cysteine) of SEQ ID NO:8.
  • amino acid sequence modification(s) of antibodies described herein are contemplated. For example, it may be desirable to optimize the binding affinity and/or other biological properties of the antibody, including but not limited to specificity, thermostability, expression level, effector functions, glycosylation, reduced immunogenicity, or solubility.
  • antibody variants can be prepared.
  • antibody variants can be prepared by introducing appropriate nucleotide changes into the encoding DNA, and/or by synthesis of the desired antibody or polypeptide.
  • amino acid changes can alter post-translational processes of the antibody, such as changing the number or position of glycosylation sites or altering the membrane anchoring characteristics.
  • the antibodies provided herein are chemically modified, for example, by the covalent attachment of any type of molecule to the antibody.
  • the antibody derivatives can include antibodies that have been chemically modified, for example, by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications can be carried out by known techniques, including, but not limited to, specific chemical cleavage, acetylation, formulation, metabolic synthesis of tunicamycin, etc. Additionally, the antibody can contain one or more non- classical amino acids.
  • Variations can be a substitution, deletion, or insertion of one or more codons encoding the single domain antibody or polypeptide that results in a change in the amino acid sequence as compared with the original antibody or polypeptide.
  • Amino acid substitutions can be the result of replacing one amino acid with another amino acid comprising similar structural and/or chemical properties, such as the replacement of a leucine with a serine, e.g., conservative amino acid replacements.
  • Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding a molecule provided herein, including, for example, site-directed mutagenesis and PCR-mediated mutagenesis which results in amino acid substitutions.
  • Insertions or deletions can optionally be in the range of about 1 to 5 amino acids.
  • the substitution, deletion, or insertion includes fewer than 25 amino acid substitutions, fewer than 20 amino acid substitutions, fewer than 15 amino acid substitutions, fewer than 10 amino acid substitutions, fewer than 5 amino acid substitutions, fewer than 4 amino acid substitutions, fewer than 3 amino acid substitutions, or fewer than 2 amino acid substitutions relative to the original molecule.
  • the substitution is a conservative amino acid substitution made at one or more predicted non-essential amino acid residues. The variation allowed can be determined by systematically making insertions, deletions, or substitutions of amino acids in the sequence and testing the resulting variants for activity exhibited by the parental antibodies.
  • Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing multiple residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antibody with an N-terminal methionyl residue.
  • Antibodies generated by conservative amino acid substitutions are included in the present disclosure.
  • a conservative amino acid substitution an amino acid residue is replaced with an amino acid residue comprising a side chain with a similar charge.
  • families of amino acid residues comprising side chains with similar charges have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
  • beta-branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity.
  • the encoded protein can be expressed and the activity of the protein can be determined conservative (e.g., within an amino acid group with similar properties and/or side chains) substitutions can be made, so as to maintain or not significantly change the properties.
  • Amino acids can be grouped according to similarities in the properties of their side chains (see, e.g., Lehninger, Biochemistry 73-75 (2d ed. 1975)): (1) non-polar: Ala (A), Vai (V), Leu (L), He (I), Pro (P), Phe (F), Trp (W), Met (M); (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gin (Q); (3) acidic: Asp (D), Glu (E); and (4) basic: Lys (K), Arg (R), His(H).
  • residues can be divided into groups based on common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Vai, Leu, He; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.
  • any cysteine residue not involved in maintaining the proper conformation of the antibody also can be substituted, for example, with another amino acid, such as alanine or serine, to improve the oxidative stability of the molecule and to prevent aberrant crosslinking.
  • another amino acid such as alanine or serine
  • the variations can be made using methods known in the art such as oligonucleotide-mediated (site-directed) mutagenesis, alanine scanning, and PCR mutagenesis.
  • Site-directed mutagenesis see, e.g., Carter, 1986, Biochem J. 237: 1-7; and Zoller et al., 1982, Nucl. Acids Res. 10:6487-500
  • cassette mutagenesis see, e.g., Wells et al., 1985, Gene 34:315-23
  • other known techniques can be performed on the cloned DNA to produce the anti-anti-MSLN antibody variant DNA.
  • Covalent modifications of antibodies are included within the scope of the present disclosure. Covalent modifications include reacting targeted amino acid residues of an antibody with an organic derivatizing agent that is capable of reacting with selected side chains or the N- or C- terminal residues of the antibody.
  • the antibody or antigen binding fragment provided herein comprises a heavy chain having certain homology or identity to the heavy chain as set forth in SEQ ID NO: 7 and a light chain having certain homology or identity to the light chain as set forth in SEQ ID NO:8.
  • Such embodiments of heavy /light chains with homology or identity are further provided as follows.
  • the antibody or antigen binding fragment provided herein comprises a heavy chain having more than 70% homology or identity to the heavy chain as set forth in SEQ ID NO:7.
  • the antibody or antigen binding fragment provided herein comprises a heavy chain having more than 75% homology or identity to the heavy chain as set forth in SEQ ID NO:7. In some embodiments, the antibody or antigen binding fragment provided herein comprises a heavy chain having more than 80% homology or identity to the heavy chain as set forth in SEQ ID NO:7. In some embodiments, the antibody or antigen binding fragment provided herein comprises a heavy chain having more than 85% homology or identity to the heavy chain as set forth in SEQ ID NO:7. In some embodiments, the antibody or antigen binding fragment provided herein comprises a heavy chain having more than 90% homology or identity to the heavy chain as set forth in SEQ ID NO:7.
  • the antibody or antigen binding fragment provided herein comprises a heavy chain having more than 95% homology or identity to the heavy chain as set forth in SEQ ID NO:7. In certain embodiments, the antibody or antigen binding fragment provided herein comprises a heavy chain having any of the provided homology or identity to the heavy chain as set forth in SEQ ID NO: 7, wherein the CDRs (CDR-H1, CDR-H2, and CDR-H3) are identical to the CDRs in the heavy chain as set forth in SEQ ID NO:7. In some embodiments, the antibody or antigen binding fragment provided herein comprises a light chain having more than 70% homology or identity to the light chain as set forth in SEQ ID NO: 8.
  • the antibody or antigen binding fragment provided herein comprises a light chain having more than 75% homology or identity to the light chain as set forth in SEQ ID NO: 8. In some embodiments, the antibody or antigen binding fragment provided herein comprises a light chain having more than 80% homology or identity to the light chain as set forth in SEQ ID NO: 8. In some embodiments, the antibody or antigen binding fragment provided herein comprises a light chain having more than 85% homology or identity to the light chain as set forth in SEQ ID NO:8. In some embodiments, the antibody or antigen binding fragment provided herein comprises a light chain having more than 90% homology or identity to the light chain as set forth in SEQ ID NO: 8.
  • the antibody or antigen binding fragment provided herein comprises a light chain having more than 95% homology or identity to the light chain as set forth in SEQ ID NO:8. In certain embodiments, the antibody or antigen binding fragment provided herein comprises a light chain having any of the provided homology or identity to the light chain as set forth in SEQ ID NO: 8, wherein the CDRs (CDR-L1, CDR-L2, and CDR-L3) are identical to the CDRs in the light chain as set forth in SEQ ID NO:8. In certain embodiments, the antibody or antigen binding fragment provided herein comprises any homologous light chain and any homologous heavy chain as provided in this paragraph in any combination or permutation.
  • the antibody or antigen binding fragment provided herein comprises a heavy chain variable region having certain homology or identity to the heavy chain variable region as set forth in SEQ ID NO:22 and a light chain variable region having certain homology or identity to the light chain variable region as set forth in SEQ ID NO:23.
  • heavy chain variable regions and light chain variable regions with homology or identity are further provided as follows.
  • the antibody or antigen binding fragment provided herein comprises a heavy chain variable region having more than 70% homology or identity to the heavy chain variable region as set forth in SEQ ID NO:22.
  • the antibody or antigen binding fragment provided herein comprises a heavy chain variable region having more than 75% homology or identity to the heavy chain variable region as set forth in SEQ ID NO:22. In some embodiments, the antibody or antigen binding fragment provided herein comprises a heavy chain variable region having more than 80% homology or identity to the heavy chain variable region as set forth in SEQ ID NO:22. In some embodiments, the antibody or antigen binding fragment provided herein comprises a heavy chain variable region having more than 85% homology or identity to the heavy chain variable region as set forth in SEQ ID NO:22. In some embodiments, the antibody or antigen binding fragment provided herein comprises a heavy chain variable region having more than 90% homology or identity to the heavy chain variable region as set forth in SEQ ID NO:22.
  • the antibody or antigen binding fragment provided herein comprises a heavy chain variable region having more than 95% homology or identity to the heavy chain variable region as set forth in SEQ ID NO:22. In certain embodiments, the antibody or antigen binding fragment provided herein comprises a heavy chain variable region having any of the provided homology or identity to the heavy chain variable region as set forth in SEQ ID NO:22, wherein the CDRs (CDR-H1, CDR-H2, and CDR-H3) are identical to the CDRs in the heavy chain variable region as set forth in SEQ ID NO:22. In some embodiments, the antibody or antigen binding fragment provided herein comprises a light chain variable region having more than 70% homology or identity to the light chain variable region as set forth in SEQ ID NO:23.
  • the antibody or antigen binding fragment provided herein comprises a light chain variable region having more than 75% homology or identity to the light chain variable region as set forth in SEQ ID NO:23. In some embodiments, the antibody or antigen binding fragment provided herein comprises a light chain variable region having more than 80% homology or identity to the light chain variable region as set forth in SEQ ID NO:23. In some embodiments, the antibody or antigen binding fragment provided herein comprises a light chain variable region having more than 85% homology or identity to the light chain variable region as set forth in SEQ ID NO:23. In some embodiments, the antibody or antigen binding fragment provided herein comprises a light chain variable region having more than 90% homology or identity to the light chain variable region as set forth in SEQ ID NO:23.
  • the antibody or antigen binding fragment provided herein comprises a light chain variable region having more than 95% homology or identity to the light chain variable region as set forth in SEQ ID NO:23.
  • the antibody or antigen binding fragment provided herein comprises a light chain variable region having any of the provided homology or identity to the light chain variable region as set forth in SEQ ID NO:23, wherein the CDRs (CDR-L1, CDR-L2, and CDR-L3) are identical to the CDRs in the light chain variable region as set forth in SEQ ID NO:23.
  • the antibody or antigen binding fragment provided herein comprises any homologous light chain variable region and any homologous heavy chain variable region as provided in this paragraph in any combination or permutation.
  • the anti-nectin-4 antibody provided herein comprises heavy and light chain CDR regions of an antibody designated Ha22-2(2, 4)6.1 produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267, or heavy and light chain CDR regions comprising amino acid sequences that are homologous to the amino acid sequences of the heavy and light chain CDR regions of Ha22- 2(2,4)6.1, and wherein the antibodies retain the desired functional properties of the anti- nectin-4 antibody designated Ha22-2(2,4)6.1 produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • ATCC American Type Culture Collection
  • the anti-nectin-4 antibody provided herein comprises heavy and light chain CDR regions (CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3) of an antibody designated Ha22-2(2, 4)6.1 produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267, or heavy and light chain CDR regions consisting of amino acid sequences that are homologous to the amino acid sequences of the heavy and light chain CDR regions of Ha22-2(2, 4)6.1, and wherein the antibodies retain the desired functional properties of the anti-nectin-4 antibody designated Ha22-2(2,4)6.1 produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • ATC American Type Culture Collection
  • the antibody or antigen binding fragment thereof provided herein comprises a humanized heavy chain variable region and a humanized light chain variable region, wherein:
  • the heavy chain variable region comprises CDRs (CDR-H1, CDR-H2, and CDR- H3) comprising the amino acid sequences of the heavy chain variable region CDRs set forth in the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267;
  • the light chain variable region comprises CDRs (CDR-L1, CDR-L2, and CDR-L3) comprising the amino acid sequences of the light chain variable region CDRs set forth in the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequences of the light chain variable region CDRs set forth in the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the antibody or antigen binding fragment thereof provided herein comprises a humanized heavy chain variable region and a humanized light chain variable region, wherein:
  • the heavy chain variable region comprises CDRs (CDR-H1, CDR-H2, and CDR- H3) consisting of the amino acid sequences of the heavy chain variable region CDRs set forth in the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267;
  • the light chain variable region comprises CDRs (CDR-L1, CDR-L2, and CDR-L3) consisting of the amino acid sequences of the light chain variable region CDRs set forth in the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • CDR-L1, CDR-L2, and CDR-L3 consisting of the amino acid sequences of the light chain variable region CDRs set forth in the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the anti-nectin-4 antibody provided herein comprises heavy and light chain variable regions of an antibody designated Ha22-2(2, 4)6.1 produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267, or heavy and light variable regions comprising amino acid sequences that are homologous to the amino acid sequences of the heavy and light chain variable regions of Ha22-2(2,4)6.1, and wherein the antibodies retain the desired functional properties of the anti-nectin-4 antibody provided herein.
  • ATC American Type Culture Collection
  • the anti-nectin-4 antibody provided herein comprises heavy and light chain variable regions of an antibody designated Ha22-2(2, 4)6.1 produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267, or heavy and light variable regions consisting of amino acid sequences that are homologous to the amino acid sequences of the heavy and light chain variable regions of Ha22-2(2, 4)6.1, and wherein the antibodies retain the desired functional properties of the anti-nectin-4 antibody provided herein.
  • the constant region of the antibody of the disclosure any subclass of constant region can be chosen. In one embodiment, human IgGl constant region as the heavy chain constant region and human Ig kappa constant region as the light chain constant region can be used.
  • the anti-nectin-4 antibody provided herein comprises heavy and light chains of an antibody designated Ha22-2(2, 4)6.1 produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267, or heavy and light chains comprising amino acid sequences that are homologous to the amino acid sequences of the heavy and light chains of Ha22-2(2, 4)6.1, and wherein the antibodies retain the desired functional properties of the anti-nectin-4 antibody provided herein.
  • ATCC American Type Culture Collection
  • the anti-nectin-4 antibody provided herein comprises heavy and light chains of an antibody designated Ha22-2(2,4)6.1 produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267, or heavy and light chains consisting of amino acid sequences that are homologous to the amino acid sequences of the heavy and light chains of Ha22-2(2, 4)6.1, and wherein the antibodies retain the desired functional properties of the anti-nectin-4 antibody provided herein.
  • ATCC American Type Culture Collection
  • the antibody or antigen binding fragment thereof provided herein comprises a heavy chain variable region and a light chain variable region, wherein:
  • the heavy chain variable region comprises an amino acid sequence that is at least 80% homologous or identical to the heavy chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267; and
  • the light chain variable region comprises an amino acid sequence that is at least 80% homologous or identical to the light chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the antibody or antigen binding fragment provided herein comprises a heavy chain variable region having certain homology or identity to the heavy chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267 and a light chain variable region having certain homology or identity to the light chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • ATC American Type Culture Collection
  • the heavy chain variable region comprises an amino acid sequence that is at least 85% homologous or identical to the heavy chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267. In other embodiments, the heavy chain variable region comprises an amino acid sequence that is at least 90% homologous or identical to the heavy chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the heavy chain variable region comprises an amino acid sequence that is at least 95% homologous or identical to the heavy chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the heavy chain variable region can be 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous or identical to the heavy chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the light chain variable region comprises an amino acid sequence that is at least 85% homologous or identical to the light chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267. In other embodiments, the light chain variable region comprises an amino acid sequence that is at least 90% homologous or identical to the light chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the light chain variable region comprises an amino acid sequence that is at least 95% homologous or identical to the light chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the light chain variable region can be 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous or identical to the light chain variable region amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the antibody or antigen binding fragment provided herein comprises any homologous light chain variable region and any homologous heavy chain variable region as provided in this paragraph in any combination or permutation.
  • the antibody or antigen binding fragment thereof provided herein comprises a heavy chain and a light chain, wherein:
  • the heavy chain comprises an amino acid sequence that is at least 80% homologous or identical to the heavy chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267; and
  • the light chain comprises an amino acid sequence that is at least 80% homologous or identical to the light chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the antibody or antigen binding fragment provided herein comprises a heavy chain having certain homology or identity to the heavy chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267 and a light chain having certain homology or identity to the light chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the heavy chain comprises an amino acid sequence that is at least 85% homologous or identical to the heavy chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267. In other embodiments, the heavy chain comprises an amino acid sequence that is at least 90% homologous or identical to the heavy chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the heavy chain comprises an amino acid sequence that is at least 95% homologous or identical to the heavy chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the heavy chain can be 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous or identical to the heavy chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the light chain comprises an amino acid sequence that is at least 85% homologous or identical to the light chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267. In other embodiments, the light chain comprises an amino acid sequence that is at least 90% homologous or identical to the light chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267. In yet other embodiments, the light chain comprises an amino acid sequence that is at least 95% homologous or identical to the light chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the light chain can be 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous or identical to the light chain amino acid sequence of the antibody produced by a hybridoma deposited under the American Type Culture Collection (ATCC) Accession NO: PTA-11267.
  • the antibody or antigen binding fragment provided herein comprises any homologous light chain and any homologous heavy chain as provided in this paragraph in any combination or permutation.
  • the antibody or antigen binding fragment thereof provided herein binds to a specific epitope in 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to VC1 domain of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to VC1 domain but not to C1C2 domain of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 1st to 147th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to an epitope located in the 1st to 147th amino acid residues of 191P4D12.
  • the antibody or antigen binding fragment thereof provided herein binds to the 1st to 10th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 11th to 20th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 21st to 30th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 31st to 40th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 41st to 50th amino acid residues of 191P4D12.
  • the antibody or antigen binding fragment thereof provided herein binds to the 51st to 60th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 61st to 70th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 71st to 80th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 81st to 90th amino acid residues of 191P4D12.
  • the antibody or antigen binding fragment thereof provided herein binds to the 91st to 100th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 101st to 110th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 111th to 120th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 121st to 130th amino acid residues of 191P4D12.
  • the antibody or antigen binding fragment thereof provided herein binds to the 131st to 140th amino acid residues of 191P4D12. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to the 141st to 147th amino acid residues of 191P4D12.
  • the binding epitopes of certain embodiments the antibodies or antigen binding fragments thereof provided herein have been determined and described in WO 2012/047724, which is incorporated herein in its entirety by reference. [00339] In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to epitopes in 191P4D12 that are common between the 191P4D12 variants observed in human.
  • the antibody or antigen binding fragment thereof provided herein binds to epitopes in 191P4D12 that are common between the 191P4D12 polymorphysm observed in human. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to epitopes in 191P4D12 that are common between the 191P4D12 polymorphysm observed in human cancers. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to epitopes in 191P4D12 that would bind, internalize, disrupt or modulate the biological function of 191P4D12 or 191P4D12 variants. In some embodiments, the antibody or antigen binding fragment thereof provided herein binds to epitopes in 191P4D12 that would disrupt the interaction between 191P4D12 with ligands, substrates, and binding partners.
  • Engineered antibodies provided herein include those in which modifications have been made to framework residues within VH and/or VL (e.g. to improve the properties of the antibody). Typically, such framework modifications are made to decrease the immunogenicity of the antibody. For example, one approach is to "backmutate" one or more framework residues to the corresponding germline sequence. More specifically, an antibody that has undergone somatic mutation can contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived.
  • the somatic mutations can be "backmutated” to the germline sequence by, for example, site-directed mutagenesis or PCR-mediated mutagenesis (e.g., “backmutated” from leucine to methionine).
  • site-directed mutagenesis e.g., "backmutated” from leucine to methionine.
  • PCR-mediated mutagenesis e.g., "backmutated” from leucine to methionine.
  • Such “backmutated” antibodies are also intended to be encompassed by the disclosure.
  • Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T-cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as "deimmunization" and is described in further detail in U.S. Patent Publication No. 2003/0153043 by Carr et al.
  • antibodies of the disclosure can be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
  • modifications within the Fc region typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
  • an anti-191P4D12 antibody provided herein can be chemically modified (e.g., one or more chemical moi eties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody.
  • the hinge region of CHI is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased.
  • This approach is described further in U.S. Pat. No. 5,677,425 by Bodmer et al.
  • the number of cysteine residues in the hinge region of CHI is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the anti-191P4D12 antibody.
  • the Fc hinge region of an antibody is mutated to decrease the biological half-life of the anti-191P4D12 antibody. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding.
  • SpA Staphylococcyl protein A
  • the anti-191P4D12 antibody is modified to increase its biological half-life.
  • Various approaches are possible. For example, mutations can be introduced as described in U.S. Pat. No. 6,277,375 to Ward.
  • the antibody can be altered within the CHI or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022 by Presta et al.
  • the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody.
  • one or more amino acids selected from amino acid specific residues can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen-binding ability of the parent antibody.
  • the effector ligand to which affinity is altered can be, for example, an Fc receptor or the Cl component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260, both by Winter et al.
  • Reactivity of the anti-191P4D12 antibodies with a 191P4D12-related protein can be established by a number of well-known means, including Western blot, immunoprecipitation, ELISA, and FACS analyses using, as appropriate, 191P4D12-related proteins, 191P4D12-expressing cells or extracts thereof.
  • a 191P4D12 antibody or fragment thereof can be labeled with a detectable marker or conjugated to a second molecule. Suitable detectable markers include, but are not limited to, a radioisotope, a fluorescent compound, a bioluminescent compound, chemiluminescent compound, a metal chelator or an enzyme.
  • bi-specific antibodies specific for two or more 191P4D12 epitopes are generated using methods generally known in the art.
  • Homodimeric antibodies can also be generated by cross-linking techniques known in the art (e.g., Wolff et a!.. Cancer Res. 53: 2560-2565).
  • the anti-191P4D12 antibody provided herein is an antibody comprising heavy and light chain of an antibody designated Ha22-2(2,4)6.1.
  • the heavy chain of Ha22-2(2, 4)6.1 consists of the amino acid sequence ranging from 20 th E residue to the 466 th K residue of SEQ ID NO:7 and the light chain of Ha22-2(2,4)6.1 consists of amino acid sequence ranging from 23 rd D residue to the 236 th C residue of SEQ ID NO:8 sequence.
  • the hybridoma producing the antibody designated Ha22-2(2, 4)6.1 was sent (via Federal Express) to the American Type Culture Collection (ATCC), P.O. Box 1549, Manassas, VA 20108 on 18-August-2010 and assigned Accession number PTA-11267.
  • the disclosure further provides various embodiments for the cytotoxic agent as part of the ADC for use in the methods.
  • the cytotoxic agent as part of any of the ADCs provided herein for the methods comprises, consists of, or is a tubulin disrupting agent.
  • the cytotoxic agent is a tubulindisrupting agent.
  • the tubulin disrupting agent is selected from the group consisting of a dolastatin, an auristatin, a hemiasterlin, a vinca alkaloid, a maytansinoid, an eribulin, a colchicine, a plocabulin, a phomopsin, an epothilone, a cryptophycin, and a taxane.
  • the tubulin disrupting agent is an auristatin.
  • the auristatin is monomethyl auristatin E (MMAE), monomethyl auristatin F (MMAF), AFP, or auristain T.
  • the auristatin is monomethyl auristatin E (MMAE).
  • the cytotoxic agent as part of any of the ADCs provided herein for the methods comprises, consists of, or is any agent selected from the cytotoxic agents described in US Patent No. 8,637,642 and International Application No. PCT/US2019/056214 (Publication No. W02020/117373), both of which are hereby incorporated in their entireties by reference
  • the auristatin is MMAE (wherein the wavy line indicates the covalent attachment to a linker of an antibody drug conjugate).
  • an exemplary embodiment comprising MMAE and a linker component has the following structure (wherein L presents the antibody (e.g. anti-nectin-4 antibody or antigen binding fragment thereof) and p ranges from 1 to 12):
  • p ranges from 1 to 20, 1 to 19, 1 to 18, 1 to 17, 1 to 16, 1 to 15, 1 to 14, 1 to 13, 1 to 12, 1 to 11, 1 to 10, 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2. In some embodiments of the formula described in the preceding paragraph, p ranges from 2 to 20, 2 to 19, 2 to 18, 2 to 17, 2 to 16, 2 to 15, 2 to 14, 2 to 13, 2 to 12, 2 to 11, 2 to 10, 2 to 9, 2 to 8, 2 to 7, 2 to 6, 2 to 5, 2 to 4 or 2 to 3.
  • p ranges from 3 to 20, 3 to 19, 3 to 18, 3 to 17, 3 to 16, 3 to 15, 3 to 14, 3 to 13, 3 to 12, 3 to 11, 3 to 10, 3 to 9, 3 to 8, 3 to 7, 3 to 6, 3 to 5, or 3 to 4.
  • p is about 1.
  • p is about 2.
  • p is about 3.
  • p is about 4.
  • p is about 3.8.
  • p is about 5.
  • p is about 6. In some embodiments of the formula described in the preceding paragraph, p is about 7. In some embodiments of the formula described in the preceding paragraph, p is about 8. In some embodiments of the formula described in the preceding paragraph, p is about 9. In some embodiments of the formula described in the preceding paragraph, p is about 10. In some embodiments of the formula described in the preceding paragraph, p is about 11. In some embodiments of the formula described in the preceding paragraph, p is about 12. In some embodiments of the formula described in the preceding paragraph, p is about 13. In some embodiments of the formula described in the preceding paragraph, p is about 14. In some embodiments of the formula described in the preceding paragraph, p is about 15.
  • p is about 16. In some embodiments of the formula described in the preceding paragraph, p is about 17. In some embodiments of the formula described in the preceding paragraph, p is about 18. In some embodiments of the formula described in the preceding paragraph, p is about 19. In some embodiments of the formula described in the preceding paragraph, p is about 20.
  • peptide-based drug units can be prepared by forming a peptide bond between two or more amino acids and/or peptide fragments.
  • Such peptide bonds can be prepared, for example, according to the liquid phase synthesis method (see E. Schroder and K. Liibke, “The Peptides”, volume 1, pp 76-136, 1965, Academic Press) that is well-known in the field of peptide chemistry.
  • the auristatin/dolastatin drug units can be prepared according to the methods of: US 5635483; US 5780588; Pettit et al (1989) J. Am. Chem. Soc.
  • the antibody drug conjugates comprise a linker unit between the drug unit (e.g., MMAE) and the antibody unit (e.g., the anti-191P4D12 antibody or antigen binding fragment thereof).
  • the linker is cleavable under intracellular conditions, such that cleavage of the linker releases the drug unit from the antibody in the intracellular environment.
  • the linker unit is not cleavable and the drug is released, for example, by antibody degradation.
  • the linker is cleavable by a cleaving agent that is present in the intracellular environment (e.g., within a lysosome or endosome or caveolea).
  • the linker can be, e.g., a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including, but not limited to, a lysosomal or endosomal protease.
  • a peptidyl linker that is cleavable by the thiol-dependent protease cathepsin-B, which is highly expressed in cancerous tissue can be used (e.g., a Phe- Leu or a Gly-Phe-Leu-Gly linker (SEQ ID NO: 15)).
  • the peptidyl linker is at least two amino acids long or at least three amino acids long.
  • the cleavable linker is pH-sensitive, i.e., sensitive to hydrolysis at certain pH values.
  • the pH-sensitive linker hydrolyzable under acidic conditions.
  • an acid-labile linker that is hydrolyzable in the lysosome e.g., a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like
  • the linker is cleavable under reducing conditions (e.g., a disulfide linker).
  • disulfide linkers are known in the art, including, for example, those that can be formed using SATA (N-succinimidyl-S-acetylthioacetate), SPDP (N-succinimidyl-3- (2-pyridyldithio)propionate), SPDB (N-succinimidyl-3-(2-pyridyldithio)butyrate) and SMPT (N-succinimidyl-oxycarbonyl-alpha-methyl-alpha-(2-pyridyl-dithio)toluene), SPDB and SMPT.
  • SATA N-succinimidyl-S-acetylthioacetate
  • SPDP N-succinimidyl-3- (2-pyridyldithio)propionate
  • SPDB N-succinimidyl-3-(2-pyridyldithio)butyrate
  • SMPT N-succ
  • a “linker unit” is a bifunctional compound that can be used to link a drug unit and an antibody unit to form an antibody drug conjugate.
  • the linker unit has the formula:
  • a is 0 or 1, w is 0 or 1, and y is 0, 1 or 2. In some embodiments, a is 0 or 1, w is 0 or 1, and y is 0 or 1. In some embodiments, when w is 1 to 12, y is 1 or 2. In some embodiments, w is 2 to 12 and y is 1 or 2. In some embodiments, a is 1 and w and y are 0.
  • the linker and each of the stretcher unit, the amino acid unit, and the spacer unit have been described in US Patent No. 8,637,642 and International Application No. PCT/US2019/056214 (Publication No. W02020/117373), both of which are hereby incorporated in their entireties by reference.
  • Embodiments of the antibody-drug conjugates can include: wherein w and y are each 0, 1 or 2, and, wherein w and y are each 0,
  • Drug loading is represented by p and is the average number of drug units per antibody in a molecule. Drug loading can range from 1 to 20 drug units (D) per antibody.
  • the ADCs provided herein include collections of antibodies or antigen binding fragments conjugated with a range of drug units, e.g., from 1 to 20.
  • the average number of drug units per antibody in preparations of ADC from conjugation reactions can be characterized by conventional means such as mass spectroscopy and, ELISA assay.
  • the quantitative distribution of ADC in terms of p can also be determined. In some instances, separation, purification, and characterization of homogeneous ADC where p is a certain value from ADC with other drug loadings can be achieved by means such as electrophoresis.
  • the drug loading for an ADC provided herein ranges from 1 to 20. In certain embodiments, the drug loading for an ADC provided herein ranges from 1 to 18. In certain embodiments, the drug loading for an ADC provided herein ranges from 1 to 15. In certain embodiments, the drug loading for an ADC provided herein ranges from 1 to
  • the drug loading for an ADC provided herein ranges from 1 to 12.
  • the drug loading for an ADC provided herein ranges from 1 to 9.
  • the drug loading for an ADC provided herein ranges from 1 to 8. In certain embodiments, the drug loading for an ADC provided herein ranges from 1 to 7. In certain embodiments, the drug loading for an ADC provided herein ranges from 1 to 6. In certain embodiments, the drug loading for an ADC provided herein ranges from 1 to 5. In certain embodiments, the drug loading for an ADC provided herein ranges from 1 to 4. In certain embodiments, the drug loading for an ADC provided herein ranges from 1 to 3. In certain embodiments, the drug loading for an ADC provided herein ranges from 2 to 12. In certain embodiments, the drug loading for an ADC provided herein ranges from 2 to 10. In certain embodiments, the drug loading for an ADC provided herein ranges from 2 to 9.
  • the drug loading for an ADC provided herein ranges from 2 to 8. In certain embodiments, the drug loading for an ADC provided herein ranges from 2 to 7. In certain embodiments, the drug loading for an ADC provided herein ranges from 2 to 6. In certain embodiments, the drug loading for an ADC provided herein ranges from 2 to 5. In certain embodiments, the drug loading for an ADC provided herein ranges from 2 to 4. In certain embodiments, the drug loading for an ADC provided herein ranges from 3 to 12. In certain embodiments, the drug loading for an ADC provided herein ranges from 3 to 10. In certain embodiments, the drug loading for an ADC provided herein ranges from 3 to 9. In certain embodiments, the drug loading for an ADC provided herein ranges from 3 to 8.
  • the drug loading for an ADC provided herein ranges from 3 to 7. In certain embodiments, the drug loading for an ADC provided herein ranges from 3 to 6. In certain embodiments, the drug loading for an ADC provided herein ranges from 3 to 5. In certain embodiments, the drug loading for an ADC provided herein ranges from 3 to 4.
  • the drug loading for an ADC provided herein ranges from 1 to about 8; from about 2 to about 6; from about 3 to about 5; from about 3 to about 4; from about 3.1 to about 3.9; from about 3.2 to about 3.8; from about 3.2 to about 3.7; from about 3.2 to about 3.6; from about 3.3 to about 3.8; or from about 3.3 to about 3.7.
  • the drug loading for an ADC provided herein is about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, or more. In some embodiments, the drug loading for an ADC provided herein is about 3.1, about 3.2, about 3.3, about 3.4, about 3.5, about 3.6, about 3.7, about 3.8, or about 3.9.
  • the drug loading for an ADC provided herein ranges from 2 to 20, 2 to 19, 2 to 18, 2 to 17, 2 to 16, 2 to 15, 2 to 14, or 2 to 13. In some embodiments, the drug loading for an ADC provided herein ranges from 3 to 20, 3 to 19, 3 to 18, 3 to 17, 3 to 16, 3 to 15, 3 to 14, or 3 to 13. In some embodiments, the drug loading for an ADC provided herein is about 1. In some embodiments, the drug loading for an ADC provided herein is about 2. In some embodiments, the drug loading for an ADC provided herein is about 3. In some embodiments, the drug loading for an ADC provided herein is about 4. In some embodiments, the drug loading for an ADC provided herein is about 3.8.
  • the drug loading for an ADC provided herein is about 5. In some embodiments, the drug loading for an ADC provided herein is about 6. In some embodiments, the drug loading for an ADC provided herein is about 7. In some embodiments, the drug loading for an ADC provided herein is about 8. In some embodiments, the drug loading for an ADC provided herein is about 9. In some embodiments, the drug loading for an ADC provided herein is about 10. In some embodiments, the drug loading for an ADC provided herein is about 11. In some embodiments, the drug loading for an ADC provided herein is about 12. In some embodiments, the drug loading for an ADC provided herein is about 13. In some embodiments, the drug loading for an ADC provided herein is about 14.
  • the drug loading for an ADC provided herein is about 15. In some embodiments, the drug loading for an ADC provided herein is about 16. In some embodiments, the drug loading for an ADC provided herein is about 17. In some embodiments, the drug loading for an ADC provided herein is about 18. In some embodiments, the drug loading for an ADC provided herein is about 19. In some embodiments, the drug loading for an ADC provided herein is about 20.
  • an antibody can contain, for example, lysine residues that do not react with the drug-linker intermediate or linker reagent.
  • antibodies do not contain many free and reactive cysteine thiol groups which can be linked to a drug unit; indeed most cysteine thiol residues in antibodies exist as disulfide bridges.
  • an antibody can be reduced with a reducing agent such as dithiothreitol (DTT) or tricarbonylethylphosphine (TCEP), under partial or total reducing conditions, to generate reactive cysteine thiol groups.
  • DTT dithiothreitol
  • TCEP tricarbonylethylphosphine
  • an antibody is subjected to denaturing conditions to reveal reactive nucleophilic groups such as lysine or cysteine.
  • the linker unit or a drug unit is conjugated via a lysine residue on the antibody unit.
  • the linker unit or a drug unit is conjugated via a cysteine residue on the antibody unit.
  • the amino acid that attaches to a linker unit or a drug unit is in the heavy chain of an antibody or antigen binding fragment thereof. In some embodiments, the amino acid that attaches to a linker unit or a drug unit is in the light chain of an antibody or antigen binding fragment thereof. In some embodiments, the amino acid that attaches to a linker unit or a drug unit is in the hinge region of an antibody or antigen binding fragment thereof. In some embodiments, the amino acid that attaches to a linker unit or a drug unit is in the Fc region of an antibody or antigen binding fragment thereof.
  • the amino acid that attaches to a linker unit or a drug unit is in the constant region (e.g, CHI, CH2, or CH3 of a heavy chain, or CHI of a light chain) of an antibody or antigen binding fragment thereof.
  • the amino acid that attaches to a linker unit or a drug unit is in the VH framework regions of an antibody or antigen binding fragment thereof.
  • the amino acid that attaches to a linker unit or a drug unit is in the VL framework regions of an antibody or antigen binding fragment thereof.
  • the loading (drug/antibody ratio) of an ADC can be controlled in different ways, e.g, by: (i) limiting the molar excess of drug-linker intermediate or linker reagent relative to antibody, (ii) limiting the conjugation reaction time or temperature, (iii) partial or limiting reductive conditions for cysteine thiol modification, (iv) engineering by recombinant techniques the amino acid sequence of the antibody such that the number and position of cysteine residues is modified for control of the number and/or position of linker-drug attachments (such as thioMab or thioFab prepared as disclosed herein and in W02006/034488 (herein incorporated by reference in its entirety)).
  • linker-drug attachments such as thioMab or thioFab prepared as disclosed herein and in W02006/034488 (herein incorporated by reference in its entirety)
  • the resulting product is a mixture of ADC compounds with a distribution of one or more drug unit attached to an antibody unit.
  • the average number of drugs per antibody can be calculated from the mixture by a dual ELISA antibody assay, which is specific for antibody and specific for the drug.
  • Individual ADC molecules can be identified in the mixture by mass spectroscopy and separated by HPLC, e.g. hydrophobic interaction chromatography (see, e.g., Hamblett, K.J., et al.
  • a homogeneous ADC with a single loading value can be isolated from the conjugation mixture by electrophoresis or chromatography.
  • the antibody drug conjugate for the methods provided herein is AGS-22M6E, which is prepared according to the methods described in US Patent No. 8,637,642 and has the following formula: wherein L is Ha22-2(2,4)6.1 and p is from 1 to 20.
  • p ranges from Ito 20, 1 to 10, 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, or 1 to 2. In some embodiments, p ranges from 2 to 10, 2 to 9, 2 to 8, 2 to 7, 2 to 6, 2 to 5, 2 to 4 or 2 to 3. In other embodiments, p is about 1. In other embodiments, p is about 2. In other embodiments, p is about 3. In other embodiments, p is about 4. In other embodiments, p is about 5. In other embodiments, p is about 6. In other embodiments, p is about 7. In other embodiments, p is about 8. In other embodiments, p is about 9. In other embodiments, p is about 10.
  • p is about 3.1. In some embodiments, p is about 3.2. In some embodiments, p is about 3.3. In some embodiments, p is about 3.4. In some embodiments, p is about 3.5. In other embodiments, p is about 3.6. In some embodiments, p is about 3.7. In some embodiments, p is about 3.8. In some embodiments, p is about 3.9. In some embodiments, p is about 4.0. In some embodiments, p is about 4.1. In some embodiments, p is about 4.2. In some embodiments, p is about 4.3. In some embodiments, p is about 4.4. In some embodiments, p is about 4.5. In other embodiments, p is about 4.6. In some embodiments, p is about 4.7. In some embodiments, p is about 4.8. In some embodiments, p is about 4.9. In some embodiments, p is about 5.0.
  • the ADC used in the methods provided herein is enfortumab vedotin.
  • Enfortumab vedotin is an ADC comprised of a fully human immunoglobulin G1 kappa (IgGl K ) antibody conjugated to the microtubule-disrupting agent (MMAE) via a protease-cleavable linker (Challita-Eid PM et al, Cancer Res.
  • Enfortumab vedotin induces antitumor activity by binding to 191P4D12 protein on the cell surface leading to internalization of the ADC-191P4D12 complex, which then traffics to the lysosomal compartment where MMAE is released via proteolytic cleavage of the linker. Intracellular release of MMAE subsequently disrupts tubulin polymerization resulting in G2/M phase cell cycle arrest and apoptotic cell death (Francisco JA et al, Blood. 2003 Aug 15; 102(4): 1458-65).
  • AGS-22M6E is an ADC derived from a murine hybridoma cell line.
  • Enfortumab vedotin is the a Chinese hamster ovary (CHO) cell line-derived equivalent of AGS-22M6E ADC and is an exemplary product used for human treatment.
  • Enfortumab vedotin has the same amino acid sequence, linker and cytotoxic drug as AGS-22M6E.
  • the ADC provided herein is enfortumab vedotin, also known as EV, PADCEV, AGS-22M6E, AGS-22C3E, ASG-22C3E.
  • the enfortumab vedotin includes an anti-191P4D12 antibody, wherein the antibody or antigen binding fragment thereof comprises a heavy chain comprising amino acid residue 20 to amino acid residue 466 of SEQ ID NO: 7 and a light chain comprising amino acid residue 23 to amino acid residue 236 of SEQ ID NO:8.
  • Enfortumab vedotin is a Nectin-4 directed antibody -drug conjugate (ADC) comprised of a fully human anti-nectin-4 IgGl kappa monoclonal antibody (AGS-22C3) conjugated to the small molecule microtubule disrupting agent, monomethyl auristatin E (MMAE) via a protease-cleavable maleimidocaproyl valine-citrulline (vc) linker (SGD- 1006). Conjugation takes place on cysteine residues that comprise the interchain disulfide bonds of the antibody to yield a product with a drug-to-antibody ratio of approximately 3.8: 1. The molecular weight is approximately 152 kDa.
  • Enfortumab vedotin has the following structural formula:
  • Enfortumab vedotin is produced by chemical conjugation of the antibody and small molecule components.
  • the antibody is produced by mammalian (Chinese hamster ovary) cells and the small molecule components are produced by chemical synthesis.
  • Enfortumab vedotin injection is provided as a sterile, preservative-free, white to off-white lyophilized powder in single-dose vials for intravenous use.
  • Enfortumab vedotin is supplied as a 20 mg per vial and a 30 mg per vial and requires reconstitution with Sterile Water for Injection, USP, (2.3 mL and 3.3 mL, respectively) resulting in a clear to slightly opalescent, colorless to slightly yellow solution with a final concentration of 10 mg/mL. After reconstitution, each vial allows the withdrawal of 2 mL (20 mg) and 3 mL (30 mg).
  • Each mL of reconstituted solution contains 10 mg of enfortumab vedotin, histidine (1.4 mg), histidine hydrochloride monohydrate (2.31 mg), polysorbate 20 (0.2 mg) and trehalose dihydrate (55 mg) with a pH of 6.0.
  • the ADC used in the methods is provided in “pharmaceutical compositions.”
  • Such pharmaceutical compositions include an antibody drug conjugate provided herein, and one or more pharmaceutically acceptable or physiologically acceptable excipients.
  • the antibody drug conjugate are provided in combination with, or separate from, one or more additional agents.
  • a composition comprising such one or more additional agents and one or more pharmaceutically acceptable or physiologically acceptable excipients.
  • the antibody drug conjugate and an additional agent(s) are present in a therapeutically acceptable amount.
  • the pharmaceutical compositions can be used in accordance with the methods and uses provided herein.
  • compositions can be administered ex vivo or in vivo to a subject in order to practice treatment methods and uses provided herein.
  • Pharmaceutical compositions provided herein can be formulated to be compatible with the intended method or route of administration; exemplary routes of administration are set forth herein.
  • compositions of antibody drug conjugates that modulate a cancer or tumor are provided.
  • the pharmaceutical compositions comprising the ADCs can further comprise other therapeutically active agents or compounds disclosed herein or known to the skilled artisan which can be used in the treatment or prevention of various diseases and disorders as set forth herein (e.g., a cancer).
  • the additional therapeutically active agents or compounds can be present in a separate pharmaceutical composition(s).
  • compositions typically comprise a therapeutically effective amount of at least one of the antibody drug conjugates provided herein and one or more pharmaceutically acceptable formulation agents.
  • the pharmaceutical composition further comprises one or more additional agents described herein.
  • a pharmaceutical composition comprises an antibody drug conjugate provided herein. In some embodiments, a pharmaceutical composition comprises a therapeutically effective amount of an antibody drug conjugate provided herein. In certain embodiments, the pharmaceutical composition comprises a pharmaceutically acceptable excipient.
  • the antibody drug conjugate in the pharmaceutical composition provided herein is selected from the antibody drug conjugates described in Section 5.3 above.
  • the pharmaceutical composition comprises the antibody drug conjugate at a concentration of from 0.1 -100 mg/mL. In some embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of from 1 to 20 mg/mL. In other embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of from 5 to 15 mg/mL. In other embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of from 8 to 12 mg/mL. In other embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of from 9 to 11 mg/mL. In some embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 9.5 mg/mL.
  • the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 9.6 mg/mL. In some embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 9.7 mg/mL. In some embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 9.8 mg/mL. In some embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 9.9 mg/mL. In yet other embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 10 mg/mL. In yet other embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 10.1 mg/mL. In some embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 10.2 mg/mL.
  • the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 10.3 mg/mL. In some embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 10.3 mg/mL. In some embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 10.4 mg/mL. In some embodiments, the pharmaceutical composition comprises the antibody drug conjugate at a concentration of about 10.5 mg/mL.
  • the pharmaceutical composition provided herein comprises [00389] L-histidine, TWEEN-20, and at least one of trehalose dihydrate or sucrose. In some embodiments, the pharmaceutical composition provided herein further comprises hydrochloric acid (HC1) or succinic acid.
  • the concentration of L-histidine useful in the pharmaceutical compositions provided herein is in the range of between 5 and 50 mM. In some embodiments, the concentration of L-histidine in the pharmaceutical compositions provided herein is in the range of between 10 and 40 mM. In some embodiments, the concentration of L-histidine in the pharmaceutical compositions provided herein is in the range of between 15 and 35 mM.
  • the concentration of L-histidine in the pharmaceutical compositions provided herein is in the range of between 15 and 30 mM. In some embodiments, the concentration of L-histidine in the pharmaceutical compositions provided herein is in the range of between 15 and 25 mM. In some embodiments, the concentration of L-histidine in the pharmaceutical compositions provided herein is in the range of between 15 and 35 mM. In some embodiments, the concentration of L-histidine in the pharmaceutical compositions provided herein is about 16 mM. In some embodiments, the concentration of L- histidine in the pharmaceutical compositions provided herein is about 17 mM. In some embodiments, the concentration of L-histidine in the pharmaceutical compositions provided herein is about 18 mM.
  • the concentration of L-histidine in the pharmaceutical compositions provided herein is about 19 mM. In some embodiments, the concentration of L-histidine in the pharmaceutical compositions provided herein is about 20 mM. In some embodiments, the concentration of L-histidine in the pharmaceutical compositions provided herein is about 21 mM. In some embodiments, the concentration of L- histidine in the pharmaceutical compositions provided herein is about 22 mM. In some embodiments, the concentration of L-histidine in the pharmaceutical compositions provided herein is about 23 mM. In some embodiments, the concentration of L-histidine in the pharmaceutical compositions provided herein is about 24 mM. In some embodiments, the concentration of L-histidine in the pharmaceutical compositions provided herein is about 25 mM.
  • the concentration of TWEEN-20 useful in the pharmaceutical compositions provided herein is in the range of from 0.001 to 0.1% (v/v). In another embodiment, the concentration of TWEEN-20 is in the range of from 0.0025 to 0.075% (v/v). In one embodiment, the concentration of TWEEN-20 is in the range of from 0.005 to 0.05% (v/v). In another embodiment, the concentration of TWEEN-20 is in the range of from 0.0075 to 0.025% (v/v). In another embodiment, the concentration of TWEEN-20 is in the range of from 0.0075 to 0.05% (v/v). In another embodiment, the concentration of TWEEN-20 is in the range of from 0.01 to 0.03% (v/v).
  • the concentration of TWEEN-20 is about 0.01% (v/v). In one particular embodiment, the concentration of TWEEN-20 is about 0.015% (v/v). In one particular embodiment, the concentration of TWEEN-20 is about 0.016% (v/v). In one particular embodiment, the concentration of TWEEN-20 is about 0.017% (v/v). In one particular embodiment, the concentration of TWEEN-20 is about 0.018% (v/v). In one particular embodiment, the concentration of TWEEN-20 is about 0.019% (v/v). In one particular embodiment, the concentration of TWEEN-20 is about 0.02% (v/v). In one particular embodiment, the concentration of TWEEN-20 is about 0.021% (v/v).
  • the concentration of TWEEN-20 is about 0.022% (v/v). In one particular embodiment, the concentration of TWEEN-20 is about 0.023% (v/v). In one particular embodiment, the concentration of TWEEN-20 is about 0.024% (v/v). In one particular embodiment, the concentration of TWEEN-20 is about 0.025% (v/v).
  • the concentration of trehalose dihydrate useful in the pharmaceutical compositions provided herein is in the range of between 1% and 20% (w/v). In another embodiment, the concentration of trehalose dihydrate is in the range of 2% and 15% (w/v). In one embodiment, the concentration of trehalose dihydrate is in the range of 3% and 10% (w/v). In another embodiment, the concentration of trehalose dihydrate is in the range of 4% and 9% (w/v). In another embodiment, the concentration of trehalose dihydrate is in the range of 4% and 8% (w/v). In another embodiment, the concentration of trehalose dihydrate is in the range of 4% and 7% (w/v).
  • the concentration of trehalose dihydrate is in the range of 4% and 6% (w/v). In another embodiment, the concentration of trehalose dihydrate is in the range of 4.5% and 6% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 4.6% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 4.7% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 4.8% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 4.9% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 5.0% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 5.1% (w/v).
  • the concentration of trehalose dihydrate is about 5.2% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 5.3% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 5.4% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 5.5% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 5.6% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 5.7% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 5.8% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 5.9% (w/v).
  • the concentration of trehalose dihydrate is about 6.0% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 6.1% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 6.2% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 6.3% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 6.4% (w/v). In another embodiment, the concentration of trehalose dihydrate is about 6.5% (w/v).
  • the molarity of the trehalose dihydrate is from 50 to 300 mM. In other embodiments, the molarity of the trehalose dihydrate is from 75 to 250 mM. In some embodiments, the molarity of the trehalose dihydrate is from 100 to 200 mM. In other embodiments, the molarity of the trehalose dihydrate is from 130 to 150 mM. In some embodiments, the molarity of the trehalose dihydrate is from 135 to 150 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 135 mM.
  • the molarity of the trehalose dihydrate is about 136 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 137 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 138 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 139 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 140 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 141 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 142 mM.
  • the molarity of the trehalose dihydrate is about 143 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 144 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 145 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 146 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 150 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 151 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 151 mM.
  • the molarity of the trehalose dihydrate is about 152 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 153 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 154 mM. In certain embodiments, the molarity of the trehalose dihydrate is about 155 mM.
  • the concentration of sucrose useful in the pharmaceutical compositions provided herein is in the range of between 1% and 20% (w/v). In another embodiment, the concentration of sucrose is in the range of 2% and 15% (w/v). In one embodiment, the concentration of sucrose is in the range of 3% and 10% (w/v). In another embodiment, the concentration of sucrose is in the range of 4% and 9% (w/v). In another embodiment, the concentration of sucrose is in the range of 4% and 8% (w/v). In another embodiment, the concentration of sucrose is in the range of 4% and 7% (w/v). In another embodiment, the concentration of sucrose is in the range of 4% and 6% (w/v).
  • the concentration of sucrose is in the range of 4.5% and 6% (w/v). In another embodiment, the concentration of sucrose is about 4.6% (w/v). In another embodiment, the concentration of sucrose is about 4.7% (w/v). In another embodiment, the concentration of sucrose is about 4.8% (w/v). In another embodiment, the concentration of sucrose is about 4.9% (w/v). In another embodiment, the concentration of sucrose is about 5.0% (w/v). In another embodiment, the concentration of sucrose is about 5.1% (w/v). In another embodiment, the concentration of sucrose is about 5.2% (w/v). In another embodiment, the concentration of sucrose is about 5.3% (w/v). In another embodiment, the concentration of sucrose is about 5.4% (w/v).
  • the concentration of sucrose is about 5.5% (w/v). In another embodiment, the concentration of sucrose is about 5.6% (w/v). In another embodiment, the concentration of sucrose is about 5.7% (w/v). In another embodiment, the concentration of sucrose is about 5.8% (w/v). In another embodiment, the concentration of sucrose is about 5.9% (w/v). In another embodiment, the concentration of sucrose is about 6.0% (w/v). In another embodiment, the concentration of sucrose is about 6.1% (w/v). In another embodiment, the concentration of sucrose is about 6.2% (w/v). In another embodiment, the concentration of sucrose is about 6.3% (w/v). In another embodiment, the concentration of sucrose is about 6.4% (w/v). In another embodiment, the concentration of sucrose is about 6.5% (w/v).
  • the molarity of the sucrose is from 50 to 300 mM. In other embodiments, the molarity of the sucrose is from 75 to 250 mM. In some embodiments, the molarity of the sucrose is from 100 to 200 mM. In other embodiments, the molarity of the sucrose is from 130 to 150 mM. In some embodiments, the molarity of the sucrose is from 135 to 150 mM. In certain embodiments, the molarity of the sucrose is about 135 mM. In certain embodiments, the molarity of the sucrose is about 136 mM. In certain embodiments, the molarity of the sucrose is about 137 mM.
  • the molarity of the sucrose is about 138 mM. In certain embodiments, the molarity of the sucrose is about 139 mM. In certain embodiments, the molarity of the sucrose is about 140 mM. In certain embodiments, the molarity of the sucrose is about 141 mM. In certain embodiments, the molarity of the sucrose is about 142 mM. In certain embodiments, the molarity of the sucrose is about 143 mM. In certain embodiments, the molarity of the sucrose is about 144 mM. In certain embodiments, the molarity of the sucrose is about 145 mM.
  • the molarity of the sucrose is about 146 mM. In certain embodiments, the molarity of the sucrose is about 150 mM. In certain embodiments, the molarity of the sucrose is about 151 mM. In certain embodiments, the molarity of the sucrose is about 151 mM. In certain embodiments, the molarity of the sucrose is about 152 mM. In certain embodiments, the molarity of the sucrose is about 153 mM. In certain embodiments, the molarity of the sucrose is about 154 mM. In certain embodiments, the molarity of the sucrose is about 155 mM.
  • the pharmaceutical composition provided herein comprises HC1. In other embodiments, the pharmaceutical composition provided herein comprises succinic acid.
  • the pharmaceutical composition provided herein [00398] has a pH in a range of 5.5 to 6.5. In other embodiments, the pharmaceutical composition provided herein has a pH in a range of 5.7 to 6.3. In some embodiments, the pharmaceutical composition provided herein has a pH of about 5.7. In some embodiments, the pharmaceutical composistion provided herein has a pH of about 5.8. In some embodiments, the pharmaceutical composistion provided herein has a pH of about 5.9. In some embodiments, the pharmaceutical composistion provided herein has a pH of about 6.0. In some embodiments, the pharmaceutical composistion provided herein has a pH of about 6.1. In some embodiments, the pharmaceutical composistion provided herein has a pH of about 6.2. In some embodiments, the pharmaceutical composistion provided herein has a pH of about 6.3.
  • the pH is taken at room temperature. In other embodiments,
  • the pH is taken at 15°C to 27°C. In yet other embodiments, the pH is taken at 4°C. In yet other embodiments, the pH is taken at 25°C.
  • the pH is adjusted by HC1.
  • the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH in a range of 5.5 to 6.5 at room temperature.
  • the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH in a range of 5.7 to 6.3 at room temperature.
  • the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 5.7 at room temperature.
  • the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 5.8 at room temperature.
  • the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 5.9 at room temperature.
  • the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 6.0 at room temperature. In some more specific embodiments, the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 6.1 at room temperature. In some more specific embodiments, the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 6.2 at room temperature. In some more specific embodiments, the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 6.3 at room temperature.
  • the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH in a range of 5.5 to 6.5 at 15°C to 27°C. In some embodiments, the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH in a range of 5.7 to 6.3 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 5.7 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 5.8 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 5.9 at 15°C to 27°C.
  • the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 6.0 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 6.1 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 6.2 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises HC1, and the pharmaceutical composition has a pH of about of 6.3 at 15°C to 27°C.
  • the pH is adjusted by succinic acid.
  • the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH in a range of 5.5 to 6.5 at room temperature.
  • the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH in a range of 5.7 to 6.3 at room temperature.
  • the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 5.7 at room temperature.
  • the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 5.8 at room temperature.
  • the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 5.9 at room temperature.
  • the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 6.0 at room temperature. In some more specific embodiments, the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 6.1 at room temperature. In some more specific embodiments, the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 6.2 at room temperature. In some more specific embodiments, the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 6.3 at room temperature.
  • the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH in a range of 5.5 to 6.5 at 15°C to 27°C. In some embodiments, the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH in a range of 5.7 to 6.3 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 5.7 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 5.8 at 15°C to 27°C.
  • the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 5.9 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 6.0 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 6.1 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 6.2 at 15°C to 27°C. In some more specific embodiments, the pharmaceutical composition comprises succinic acid, and the pharmaceutical composition has a pH of about of 6.3 at 15°C to 27°C.
  • the pharmaceutical composition provided herein comprises about 20 mM L-histidine, about 0.02% (w/v) TWEEN-20, and at least one of about 5.5% (w/v) trehalose dihydrate or about 5% (w/v) sucrose.
  • the pharmaceutical composition provided herein further comprises HC1 or succinic acid.
  • the pH is about 6.0 at room temperature. In some embodiments, the pH is about 6.0 at 25°C.
  • the pharmaceutical composition provided herein comprises about 20 mM L-histidine, about 0.02% (w/v) TWEEN-20, about 5.5% (w/v) trehalose dihydrate and HC1.
  • the pH is about 6.0 at room temperature. In some embodiments, the pH is about 6.0 at 25°C.
  • the pharmaceutical composition provided herein comprises about 20 mM L-histidine, about 0.02% (w/v) TWEEN-20, about 5% (w/v) sucrose and HC1.
  • the pH is about 6.0 at room temperature. In some embodiments, the pH is about 6.0 at 25°C.
  • the pharmaceutical composition provided herein comprises about 20 mM L-histidine, about 0.02% (w/v) TWEEN-20, about 5.5% (w/v) trehalose dihydrate and succinic acid.
  • the pH is about 6.0 at room temperature. In some embodiments, the pH is about 6.0 at 25°C.
  • the pharmaceutical composition provided herein comprises about 20 mM L-histidine, about 0.02% (w/v) TWEEN-20, about 5% (w/v) sucrose and succinic acid.
  • the pH is about 6.0 at room temperature. In some embodiments, the pH is about 6.0 at 25°C.
  • an antibody drug conjugate comprising the following structure: wherein L- represents the antibody or antigen binding fragment (e.g. anti-nectin-4 antibody or antigen binding fragment thereof) thereof and p is from 1 tolO; and
  • a pharmaceutically acceptable excipient comprising about 20 mM L-histidine, about 0.02% (w/v) TWEEN-20, about 5.5% (w/v) trehalose dihydrate, and HC1, wherein the antibody drug conjugate is at the concentration of about 10 mg/mL, and wherein the pH is about 6.0 at 25°C.
  • composition provided herein comprises:
  • an antibody drug conjugate comprising the following structure: wherein L- represents the antibody or antigen binding fragment thereof (e.g. anti-nectin-4 antibody or antigen binding fragment thereof) and p is from 1 to 10; and
  • the pharmaceutical composition provided herein comprises:
  • an antibody drug conjugate comprising the following structure: wherein L- represents the antibody or antigen binding fragment thereof e.g. anti-nectin-4 antibody or antigen binding fragment thereof) and p is from 1 to 10; and
  • a pharmaceutically acceptable excipient comprising about 20 mM L-histidine, about 0.02% (w/v) TWEEN-20, about 5.0% (w/v) sucrose, and HC1, wherein the antibody drug conjugate is at the concentration of about 10 mg/mL, and wherein the pH is about 6.0 at 25°C.
  • a primary solvent in a vehicle can be either aqueous or non-aqueous in nature.
  • the vehicle can contain other pharmaceutically acceptable excipients for modifying or maintaining the pH, osmolarity, viscosity, sterility or stability of the pharmaceutical composition.
  • the pharmaceutically acceptable vehicle is an aqueous buffer.
  • a vehicle comprises, for example, sodium chloride and/or sodium citrate.
  • compositions provided herein can contain still other pharmaceutically acceptable formulation agents for modifying or maintaining the rate of release of an antibody drug conjugate and/or an additional agent, as described herein.
  • formulation agents include those substances known to artisans skilled in preparing sustained- release formulations.
  • Remington s Pharmaceutical Sciences, 18th Ed. (1990, Mack Publishing Co., Easton, Pa. 18042) pages 1435-1712, The Merck Index, 12th Ed. (1996, Merck Publishing Group, Whitehouse, NJ); and Pharmaceutical Principles of Solid Dosage Forms (1993, Technonic Publishing Co., Inc., Lancaster, Pa.). Additional pharmaceutical compositions appropriate for administration are known in the art and are applicable in the methods and compositions provided herein.
  • the pharmaceutical composition provided herein is in a liquid form. In other embodiments, the pharmaceutical composition provided herein is lyophilized.
  • a pharmaceutical composition can be formulated to be compatible with its intended route of administration.
  • pharmaceutical compositions include excipients suitable for administration by routes including parenteral (e.g., subcutaneous (s.c.), intravenous, intramuscular, or intraperitoneal), intradermal, oral (e.g., ingestion), inhalation, intracavity, intracranial, and transdermal (topical).
  • parenteral e.g., subcutaneous (s.c.), intravenous, intramuscular, or intraperitoneal
  • intradermal e.g., oral (e.g., ingestion), inhalation, intracavity, intracranial, and transdermal (topical).
  • routes of administration include parenteral (e.g., subcutaneous (s.c.), intravenous, intramuscular, or intraperitoneal), intradermal, oral (e.g., ingestion), inhalation, intracavity, intracranial, and transdermal (topical).
  • compositions can be in the form of a sterile injectable aqueous or oleagenous suspension.
  • This suspension can be formulated using suitable dispersing or wetting agents and suspending agents disclosed herein or known to the skilled artisan.
  • the sterile injectable preparation can also be a sterile injectable solution or suspension in a nontoxic parenterally-acceptable diluent or solvent, for example, as a solution in 1,3-butane diol.
  • Acceptable diluents, solvents and dispersion media that can be employed include water, Ringer’s solution, isotonic sodium chloride solution, Cremophor ELTM (BASF, Parsippany, NJ) or phosphate buffered saline (PBS), ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol), and suitable mixtures thereof.
  • sterile, fixed oils are conventionally employed as a solvent or suspending medium.
  • any bland fixed oil can be employed, including synthetic mono- or diglycerides.
  • fatty acids such as oleic acid find use in the preparation of injectables. Prolonged absorption of particular injectable formulations can be achieved by including an agent that delays absorption (e.g., aluminum monostearate or gelatin).
  • the pharmaceutical compositions provided herein can be administered parenterally by injection, infusion, or implantation, for local or systemic administration.
  • Parenteral administration include intravenous, intraarterial, intraperitoneal, intrathecal, intraventricular, intraurethral, intrasternal, intracranial, intramuscular, intrasynovial, and subcutaneous administration.
  • the pharmaceutical compositions provided herein can be formulated in any dosage forms that are suitable for parenteral administration, including solutions, suspensions, emulsions, micelles, liposomes, microspheres, nanosystems, and solid forms suitable for solutions or suspensions in liquid prior to injection.
  • dosage forms can be prepared according to conventional methods known to those skilled in the art of pharmaceutical science (see, e.g., Remington, The Science and Practice of Pharmacy, supra).
  • the pharmaceutical compositions intended for parenteral administration can include one or more pharmaceutically acceptable excipients, including, but not limited to, aqueous vehicles, water-miscible vehicles, non-aqueous vehicles, antimicrobial agents or preservatives against the growth of microorganisms, stabilizers, solubility enhancers, isotonic agents, buffering agents, antioxidants, local anesthetics, suspending and dispersing agents, wetting or emulsifying agents, complexing agents, sequestering or chelating agents, cryoprotectants, lyoprotectants, thickening agents, pH adjusting agents, and inert gases.
  • aqueous vehicles water-miscible vehicles, non-aqueous vehicles
  • antimicrobial agents or preservatives against the growth of microorganisms stabilizers, solubility enhancers, isotonic agents, buffering agents, antioxidants, local anesthetics, suspending and dispersing agents, wetting or emulsifying agents, complexing agents,
  • suitable aqueous vehicles include, but are not limited to, water, saline, physiological saline or phosphate buffered saline (PBS), sodium chloride injection, Ringers injection, isotonic dextrose injection, sterile water injection, dextrose and lactated Ringers injection.
  • Non-aqueous vehicles include, but are not limited to, fixed oils of vegetable origin, castor oil, com oil, cottonseed oil, olive oil, peanut oil, peppermint oil, safflower oil, sesame oil, soybean oil, hydrogenated vegetable oils, hydrogenated soybean oil, and medium-chain triglycerides of coconut oil, and palm seed oil.
  • Water-miscible vehicles include, but are not limited to, ethanol, 1,3 -butanediol, liquid polyethylene glycol (e.g., polyethylene glycol 300 and polyethylene glycol 400), propylene glycol, glycerin, -methyl- 2-pyrrolidone, 7V,7V-dimethylacetamide, and dimethyl sulfoxide.
  • suitable antimicrobial agents or preservatives include, but are not limited to, phenols, cresols, mercurials, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoates, thimerosal, benzalkonium chloride (e.g., benzethonium chloride), methyl- and propyl-parabens, and sorbic acid.
  • Suitable isotonic agents include, but are not limited to, sodium chloride, glycerin, and dextrose.
  • Suitable buffering agents include, but are not limited to, phosphate and citrate.
  • Suitable antioxidants are those as described herein, including bisulfite and sodium metabisulfite.
  • Suitable local anesthetics include, but are not limited to, procaine hydrochloride.
  • Suitable suspending and dispersing agents are those as described herein, including sodium carboxymethylcelluose, hydroxypropyl methylcellulose, and polyvinylpyrrolidone.
  • Suitable emulsifying agents include those described herein, including polyoxyethylene sorbitan monolaurate, polyoxyethylene sorbitan monooleate 80, and triethanolamine oleate.
  • Suitable sequestering or chelating agents include, but are not limited to EDTA.
  • Suitable pH adjusting agents include, but are not limited to, sodium hydroxide, hydrochloric acid, citric acid, and lactic acid.
  • Suitable complexing agents include, but are not limited to, cyclodextrins, including ⁇ -cyclodextrin, ⁇ -cyclodextrin, hydroxypropyl- ⁇ -cyclodextrin, sulfobutylether- ⁇ -cyclodextrin, and sulfobutylether 7- ⁇ - cyclodextrin (CAPTISOL®, CyDex, Lenexa, KS).
  • cyclodextrins including ⁇ -cyclodextrin, ⁇ -cyclodextrin, hydroxypropyl- ⁇ -cyclodextrin, sulfobutylether- ⁇ -cyclodextrin, and sulfobutylether 7- ⁇ - cyclodextrin (CAPTISOL®, CyDex, Lenexa, KS).
  • the pharmaceutical compositions provided herein can be formulated for single or multiple dosage administration.
  • the single dosage formulations are packaged in an ampoule, a vial, or a syringe.
  • the multiple dosage parenteral formulations can contain an antimicrobial agent at bacteriostatic or fungistatic concentrations. All parenteral formulations must be sterile, as known and practiced in the art.
  • the pharmaceutical compositions are provided as ready -to-use sterile solutions.
  • the pharmaceutical compositions are provided as sterile dry soluble products, including lyophilized powders and hypodermic tablets, to be reconstituted with a vehicle prior to use.
  • the pharmaceutical compositions are provided as ready -to-use sterile suspensions.
  • the pharmaceutical compositions are provided as sterile dry insoluble products to be reconstituted with a vehicle prior to use.
  • the pharmaceutical compositions are provided as ready-to-use sterile emulsions.
  • compositions provided herein can be formulated as immediate or modified release dosage forms, including delayed-, sustained, pulsed-, controlled, targeted-, and programmed-release forms.
  • Dispersible powders and granules suitable for preparation of an aqueous suspension by addition of water provide the active ingredient in admixture with a dispersing or wetting agent, suspending agent and one or more preservatives.
  • a dispersing or wetting agent e.g., kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin,
  • compositions can also include excipients to protect the composition against rapid degradation or elimination from the body, such as a controlled release formulation, including implants, liposomes, hydrogels, prodrugs and microencapsulated delivery systems.
  • a time delay material such as glyceryl monostearate or glyceryl stearate alone, or in combination with a wax, can be employed.
  • Prolonged absorption of injectable pharmaceutical compositions can be achieved by including an agent that delays absorption, for example, aluminum monostearate or gelatin.
  • Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • the pharmaceutical composition provided herein can be stored at -80°C, 4°C, 25°C or 37°C.
  • a lyophilized composition can be made by freeze-drying the liquid pharmaceutical composition provided herein.
  • the pharmaceutical composition provided here is a lyophilized pharmaceutical composition.
  • the pharmaceutical formulations are lyophilized powders, which can be reconstituted for administration as solutions, emulsions and other mixtures. They can also be reconstituted and formulated as solids or gels.
  • preparation of the lyophilized formulation provided herein involves batching of the formulated bulk solution for lyophilization, aseptic filtration, filling in vials, freezing vials in a freeze-dryer chamber, followed by lyophilization, stoppering and capping.
  • a lyophilizer can be used in preparing the lyophilized formulation.
  • a VirTis Genesis Model EL pilot unit can be employed.
  • the unit incorporates a chamber with three working shelves (to a total usable shelf area of ca 0.4 square meters), an external condenser, and a mechanical vacuum pumping system. Cascaded mechanical refrigeration allows the shelves to be cooled to -70°C or lower, and the external condenser to -90°C or lower. Shelf temperature and chamber pressure were controlled automatically to +/- 0.5°C and +/- 2 microns (milliTorr), respectively.
  • the unit was equipped with a capacitance manometer vacuum gauge, a Pirani vacuum gauge, a pressure transducer (to measure from 0 to 1 atmosphere), and a relative humidity sensor.
  • the lyophilized powder can be prepared by dissolving an antibody drug conjugate provided herein, or a pharmaceutically acceptable derivative thereof, in a suitable solvent.
  • the lyophilized powder is sterile. Subsequent sterile filtration of the solution followed by lyophilization under standard conditions known to those of skill in the art provides the desired formulation.
  • the resulting solution will be apportioned into vials for lyophilization. Each vial will contain a single dosage or multiple dosages of the antibody drug conjugate.
  • the lyophilized powder can be stored under appropriate conditions, such as at about 4 °C to room temperature.
  • Reconstitution of this lyophilized powder with water for injection provides a formulation for use in parenteral administration.
  • the lyophilized powder is added to sterile water or other suitable excipient. Such amount can be empirically determined and adjusted according to specific needs.
  • An exemplary reconstitution procedure is illustrated as follows: (1) fit the 5 mL or 3 mL syringe with a with a 18 or 20 Gauge needle and filled the syringe with water of the grade Water for Injection (WFI); (2) measure appropriate amount of WFI using the syringe graduations, ensuring that the syringe was free of air bubbles; (3) inserted the needle through the rubber stopper; (4) dispense the entire contents of the syringe into the container down the vial wall, removed the syringe and needle and put into the sharp container; (4) swirl the vial continuously to carefully solubilize the entire vial contents until fully reconstituted (e.g., about 20-40 seconds) and minimize excessive agitation of the protein solution that could result in foaming.
  • WFI Water for Injection
  • the pharmaceutical composition provided herein is supplied as a dry sterilized lyophilized powder or water free concentrate in a hermetically sealed container and can be reconstituted, e.g., with water or saline to the appropriate concentration for administration to a subject.
  • the antibody drug conjugate is supplied as a dry sterile lyophilized powder in a hermetically sealed container at a unit dosage of at least 0.1 mg, at least 0.5 mg, at least 1 mg, at least 2 mg, at least 3 mg, at least 5 mg, at least 10 mg, at least 15 mg, at least 25 mg, at least 30 mg, at least 35 mg, at least 45 mg, at least 50 mg, at least 60 mg, at least 75 mg, at least 80 mg, at least 85 mg, at least 90 mg, at least 95 mg, or at least 100 mg.
  • the lyophilized antibody drug conjugate can be stored at between 2 and 8° C in its original container and the antibody drug conjugate can be administered within 12 hours, such as within 6 hours, within 5 hours, within 3 hours, or within 1 hour after being reconstituted.
  • the pharmaceutical composition comprising the antibody drug conjugate provided herein is supplied in liquid form in a hermetically sealed container indicating the quantity and concentration of the antibody drug conjugate.
  • the liquid form of the antibody drug conjugate is supplied in a hermetically sealed container at least 0.1 mg/ml, at least 0.5 mg/ml, at least 1 mg/ml, at least 5 mg/ml, at least 10 mg/ml, at least 15 mg/ml, at least 25 mg/ml, at least 30 mg/ml, at least 40 mg/ml, at least 50 mg/ml, at least 60 mg/ml, at least 70 mg/ml, at least 80 mg/ml, at least 90 mg/ml, or at least 100 mg/ml.
  • the method for inhibiting growth of tumor cells using the pharmaceutical composition provided herein in combination with chemotherapy or radiation or both comprises administering the present pharmaceutical composition before, during, or after commencing chemotherapy or radiation therapy, as well as any combination thereof (i.e. before and during, before and after, during and after, or before, during, and after commencing the chemotherapy and/or radiation therapy).
  • the method is performed in a manner that will provide the most efficacious treatment and ultimately prolong the life of the patient. Additional embodiments for such combination therapy have been described in US Patent No. 8,637,642 and International Application No. PCT/US2019/056214 (Publication No. W02020/117373), both of which are hereby incorporated in their entireties by reference.
  • the amount of the checkpoint inhibitor for the various methods provided herein be determined by standard clinical techniques.
  • a dosage of the checkpoint inhibitor results in a serum titer of from about 0.1 ⁇ g/ml to about 450 ⁇ g/ml, and in some embodiments at least 0.1 ⁇ g/ml, at least 0.2 ⁇ g/ml, at least 0.4 ⁇ g/ml, at least 0.5 ⁇ g/ml, at least 0.6 ⁇ g/ml, at least 0.8 ⁇ g/ml, at least 1 ⁇ g/ml, at least 1.5 ⁇ g/ml, such as at least 2 ⁇ g/ml, at least 5 ⁇ g/ml, at least 10 ⁇ g/ml, at least 15 ⁇ g/ml, at least 20 ⁇ g/ml, at least 25 ⁇ g/ml, at least 30 ⁇ g/ml, at least 35 ⁇ g/ml, at least 40 ⁇ g/ml, at least 50 ⁇ g/ml, at least 75 ⁇ g/ml, at least 100 ⁇ g/ml
  • the dosage of the checkpoint inhibitor (e.g., a PD-1 inhibitor or a PD-L1 inhibitor) administered to a patient is typically 0.1 mg/kg to 100 mg/kg of the subject’s body weight. In some embodiments, the dosage administered to the patient is about 1 mg/kg to about 75 mg/kg of the subject’s body weight. In some embodiments, the dosage administered to a patient is between 1 mg/kg and 20 mg/kg of the subject’s body weight, such as 1 mg/kg to 5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 1 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 1.5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 2 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about
  • dosage administered to a patient is about 3 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 3.5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 4 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 4.5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about
  • dosage administered to a patient is about 6 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 6.5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 7 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 7.5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 8 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about
  • dosage administered to a patient is about 9.0 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 10.0 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 15.0 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 20.0 mg/kg of the subject’s body weight.
  • the amount of a prophylactic or therapeutic agent e.g., an antibody drug conjugate provided herein
  • the ADC of the methods for which the various dosages are described in this Section is enfortumab vedotin (EV).
  • a dosage of an antibody drug conjugate in the pharmaceutical composition that results in a serum titer of from about 0.1 ⁇ g/ml to about 450 ⁇ g/ml, and in some embodiments at least 0.1 ⁇ g/ml, at least 0.2 ⁇ g/ml, at least 0.4 ⁇ g/ml, at least 0.5 ⁇ g/ml, at least 0.6 ⁇ g/ml, at least 0.8 ⁇ g/ml, at least 1 ⁇ g/ml, at least 1.5 ⁇ g/ml, such as at least 2 ⁇ g/ml, at least 5 ⁇ g/ml, at least 10 ⁇ g/ml, at least 15 ⁇ g/ml, at least 20 ⁇ g/ml, at least 25 ⁇ g/ml, at least 30 ⁇ g/ml, at least 35 ⁇ g/ml, at least 40 ⁇ g/ml, at least 50 ⁇ g/ml, at least 75 ⁇ g/ml
  • Effective doses can be extrapolated from dose-response curves derived from in vitro or animal model test systems.
  • the dosage of the antibody drug conjugate administered to a patient is typically 0.1 mg/kg to 100 mg/kg of the subject’s body weight. In some embodiments, the dosage administered to the patient is about 1 mg/kg to about 75 mg/kg of the subject’s body weight. In some embodiments, the dosage administered to a patient is between 1 mg/kg and 20 mg/kg of the subject’s body weight, such as 1 mg/kg to 5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 0.5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 0.75 mg/kg of the subject’s body weight.
  • dosage administered to a patient is about 1 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 1.25 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 1.5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 2 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about
  • dosage administered to a patient is about 3 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 3.5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 4 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 4.5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about
  • dosage administered to a patient is about 6 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 6.5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 7 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 7.5 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about 8 mg/kg of the subject’s body weight. In some embodiments, dosage administered to a patient is about
  • the antibody drug conjugate formulated in the pharmaceutical composition provided herein is administered based on the patient’s actual body weight at baseline and doses will not change unless the patient’s weight changes by >10% from baseline of the previous cycle, or the dose adjustment criteria is met.
  • actual weight will be used except for patients weighing greater than 100 kg, in such cases, the dose will be calculated based on a weight of 100 kg.
  • the maximum doses are 100 mg for patients receiving the 1.00 mg/kg dose level and 125 mg for patients receiving the 1.25 mg/kg dose level.
  • the pharmaceutical composition comprising the antibody drug conjugate provided herein is administered about 1-12 times, wherein the doses can be administered as necessary, e.g., weekly, biweekly, monthly, bimonthly, trimonthly, etc., as determined by a physician.
  • a lower dose e.g., 0.1-15 mg/kg
  • a higher dose e.g., 25-100 mg/kg
  • can be administered less frequently e.g., 1-3 times).
  • a single dose of an antibody drug conjugate formulated in the pharmaceutical composition provided herein is administered to a patient to prevent and/or treat a cancer 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26 times for every two-week cycle (e.g., about 14 day) over a time period (e.g., a year), wherein the dose is selected from the group consisting of about 0.1 mg/kg, about 0.5 mg/kg, about 0.75 mg/kg, about 1 mg/kg, about 1.25 mg/kg, about 1.5 mg/kg, about 2 mg/kg, about
  • each dose monthly dose may or may not be identical).
  • a single dose of an antibody drug conjugate formulated in the pharmaceutical composition provided herein is administered to a patient to prevent and/or treat a cancer 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26 times for every three-week cycle (e.g., about 21 day) over a time period (e.g., a year), wherein the dose is selected from the group consisting of about 0.1 mg/kg, about 0.5 mg/kg, about 0.75 mg/kg, about 1 mg/kg, about 1.25 mg/kg, about 1.5 mg/kg, about 2 mg/kg, about 2.5 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, about 30 mg/kg, about 35 mg/kg, about 40 mg/kg, about 45 mg/kg, about 50 mg/kg, about 55 mg/kg, about 60 mg/kg, about 65 mg/
  • a single dose of an antibody drug conjugate formulated in the pharmaceutical composition provided herein is administered to a patient to prevent and/or treat a cancer 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26 times for every four-week cycle (e.g., about 28 day) over a time period (e.g., a year), wherein the dose is selected from the group consisting of about 0.1 mg/kg, about 0.5 mg/kg, about 0.75 mg/kg, about 1 mg/kg, about 1.25 mg/kg, about 1.5 mg/kg, about 2 mg/kg, about 2.5 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, about 30 mg/kg, about 35 mg/kg, about 40 mg/kg, about 45 mg/kg, about 50 mg/kg, about 55 mg/kg, about 60 mg/kg, about 65 mg/
  • a single dose of an antibody drug conjugate formulated in the pharmaceutical composition provided herein is administered to patient to prevent and/or treat a cancer 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 times at about monthly (e.g., about 30 day) intervals over a time period (e.g., a year), wherein the dose is selected from the group consisting of about 0.1 mg/kg, about 0.5 mg/kg, about 0.75 mg/kg, about 1 mg/kg, about 1.25 mg/kg, about 1.5 mg/kg, about 2 mg/kg, about 2.5 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, about 30 mg/kg, about 35 mg/kg, about 40 mg/kg, about 45 mg/kg, about 50 mg/kg, about 55 mg/kg, about 60 mg/kg, about 65 mg/kg, about 70 mg/kg, about 75 mg/kg, about 80 mg/
  • a single dose of an antibody drug conjugate formulated in the pharmaceutical composition provided herein is administered to patient to prevent and/or treat a cancer 1, 2, 3, 4, 5, or 6 times at about bi-monthly (e.g., about 60 day) intervals over a time period (e.g., a year), wherein the dose is selected from the group consisting of about 0.1 mg/kg, about 0.5 mg/kg, about 0.75 mg/kg, about 1 mg/kg, about 1.25 mg/kg, about 1.5 mg/kg, about 2 mg/kg, about 2.5 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, about 30 mg/kg, about 35 mg/kg, about 40 mg/kg, about 45 mg/kg, about 50 mg/kg, about 55 mg/kg, about 60 mg/kg, about 65 mg/kg, about 70 mg/kg, about 75 mg/kg, about 80 mg/kg, about
  • a single dose of an antibody drug conjugate formulated in the pharmaceutical composition provided herein is administered to patient to prevent and/or treat a cancer 1, 2, 3 or 4 times at about tri-monthly (e.g., about 120 day) intervals over a time period (e.g., a year), wherein the dose is selected from the group consisting of about 0.1 mg/kg, about 0.5 mg/kg, about 0.75 mg/kg, about 1 mg/kg, about 1.25 mg/kg, about 1.5 mg/kg, about 2 mg/kg, about 2.5 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, about 30 mg/kg, about 35 mg/kg, about 40 mg/kg, about 45 mg/kg, about 50 mg/kg, about 55 mg/kg, about 60 mg/kg, about 65 mg/kg, about 70 mg/kg, about 75 mg/kg, about 80 mg/kg, about 85
  • the route of administration for a dose of an antibody drug conjugate formulated in the pharmaceutical composition provided herein to a patient is intranasal, intramuscular, intravenous, or a combination thereof, but other routes described herein are also acceptable.
  • Each dose may or may not be administered by an identical route of administration.
  • an antibody drug conjugate formulated in the pharmaceutical composition provided herein can be administered via multiple routes of administration simultaneously or subsequently to other doses of one or more additional therapeutic agents.
  • the antibody drug conjugate formulated in the pharmaceutical composition provided herein is administered at a dose of about 0.5 mg/kg, about 0.75 mg/kg, about 1 mg/kg, about 1.25 mg/kg, or about 1.5 mg/kg of the subject’s body weight by an intravenous (IV) injection or infusion.
  • IV intravenous
  • the antibody drug conjugate formulated in the pharmaceutical composition provided herein is administered at a dose of about 0.5 mg/kg, about 0.75 mg/kg, about 1 mg/kg, about 1.25 mg/kg, or about 1.5 mg/kg of the subject’s body weight by an intravenous (IV) injection or infusion over about 30 minutes twice every three- week cycle.
  • the antibody drug conjugate formulated in the pharmaceutical composition is administered by an intravenous (IV) injection or infusion over about 30 minutes on Days 1 and 8 of every three-week cycle.
  • the method further comprises administering an immune checkpoint inhibitor by an intravenous (IV) injection or infusion one or more times in each three-week cycle.
  • the method further comprises administering an immune checkpoint inhibitor by an intravenous (IV) injection or infusion on Day 1 of every three-week cycle.
  • the immune checkpoint inhibitor is pembrolizumab, and wherein pembrolizumab is administered at amount of about 200 mg over about 30 minutes.
  • the immune checkpoint inhibitor is atezolizumab, and wherein atezolizumab is administered at amount of about 1200 mg over about 60 minutes or 30 minutes.
  • the antibody drug conjugate is administered to patients with urothelial or bladder cancer who have shown disease progression or relapse during or after treatment with another cancer treatment.
  • the antibody drug conjugate is administered to patients with metastatic urothelial or bladder cancer who have shown disease progression or relapse during or after treatment with another cancer treatment. In some embodiments, the antibody drug conjugate is administered to patients with locally advanced urothelial or bladder cancer who have shown disease progression or relapse during or after treatment with another cancer treatment. In some embodiments, the ADC of the methods for which the various dosages are described in this paragraph is enfortumab vedotin (EV).
  • EV enfortumab vedotin
  • the antibody drug conjugate formulated in the pharmaceutical composition provided herein is administered at a dose of about about 0.5 mg/kg, about 0.75 mg/kg, 1 mg/kg, about 1.25 mg/kg, or about 1.5 mg/kg of the subject’s body weight by an intravenous (IV) injection or infusion over about 30 minutes three times every four-week cycle.
  • the antibody drug conjugate formulated in the pharmaceutical composition is administered on Days 1, 8 and 15 of every 28-day (four-week) cycle.
  • the antibody drug conjugate formulated in the pharmaceutical composition is administered by an intravenous (IV) injection or infusion over about 30 minutes on Days 1, 8 and 15 of every 28-day (four-week) cycle.
  • the method further comprises administering an immune checkpoint inhibitor by an intravenous (IV) injection or infusion one or more times in each four-week cycle.
  • the immune checkpoint inhibitor is pembrolizumab.
  • the immune checkpoint inhibitor is atezolizumab.
  • the antibody drug conjugate is administered to patients with urothelial or bladder cancer who have shown disease progression or relapse during or after treatment with another cancer treatment.
  • the antibody drug conjugate is administered to patients with metastatic urothelial or bladder cancer who have shown disease progression or relapse during or after treatment with another cancer treatment.
  • the antibody drug conjugate is administered to patients with locally advanced urothelial or bladder cancer who have shown disease progression or relapse during or after treatment with another cancer treatment.
  • the ADC of the methods for which the various dosages are described in this paragraph is enfortumab vedotin (EV).
  • the ADC is administered at a dose of about 0.25 to about 10 mg/kg of the subject’s body weight, about 0.25 to about 5 mg/kg of the subject’s body weight, about 0.25 to about 2.5 mg/kg of the subject’s body weight, about 0.25 to about 1.25 mg/kg of the subject’s body weight, about 0.5 to about 10 mg/kg of the subject’s body weight, about 0.5 to about 5 mg/kg of the subject’s body weight, about 0.5 to about 2.5 mg/kg of the subject’s body weight, about 0.5 to about 1.25 mg/kg of the subject’s body weight, about 0.75 to about 10 mg/kg of the subject’s body weight, about 0.75 to about 5 mg/kg of the subject’s body weight, about 0.75 to about 2.5 mg/kg of the subject’s body weight, or about 0.75 to about 1.25 mg/kg of the subject’s body weight.
  • the ADC is administered at a dose of about 1 to about 10 mg/kg of the subject’s body weight. In certain embodiments, the ADC is administered at a dose of about 1 to about 5 mg/kg of the subject’s body weight. In other embodiments, the ADC is administered at a dose of about 1 to about 2.5 mg/kg of the subject’s body weight. In further embodiments, the ADC is administered at a dose of about 1 to about 1.25 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of about 0.25 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of about 0.5 mg/kg of the subject’s body weight.
  • the ADC is administered at a dose of about 0.75 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of about 1.0 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of about 1.25 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of about 1.5 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of about 1.75 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of about 2.0 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of about 2.25 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of about 2.5 mg/kg of the subject’s body weight.
  • the ADC is administered at a dose of 0.25 to 10 mg/kg of the subject’s body weight, 0.25 to 5 mg/kg of the subject’s body weight, 0.25 to 2.5 mg/kg of the subject’s body weight, 0.25 to 1.25 mg/kg of the subject’s body weight, 0.5 to 10 mg/kg of the subject’s body weight, 0.5 to 5 mg/kg of the subject’s body weight, 0.5 to 2.5 mg/kg of the subject’s body weight, 0.5 to 1.25 mg/kg of the subject’s body weight, 0.75 to 10 mg/kg of the subject’s body weight, 0.75 to 5 mg/kg of the subject’s body weight, 0.75 to 2.5 mg/kg of the subject’s body weight, or 0.75 to 1.25 mg/kg of the subject’s body weight.
  • the ADC is administered at a dose of 1 to 10 mg/kg of the subject’s body weight. In certain embodiments, the ADC is administered at a dose of 1 to 5 mg/kg of the subject’s body weight. In other embodiments, the ADC is administered at a dose of 1 to 2.5 mg/kg of the subject’s body weight. In further embodiments, the ADC is administered at a dose of 1 to 1.25 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of 0.25 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of 0.5 mg/kg of the subject’s body weight.
  • the ADC is administered at a dose of 0.75 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of 1.0 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of 1.25 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of 1.5 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of 1.75 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of 2.0 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of 2.25 mg/kg of the subject’s body weight. In some embodiments, the ADC is administered at a dose of 2.5 mg/kg of the subject’s body weight.
  • the first dose of the ADC is a dose of about 0.25 to about 10 mg/kg of the subject’s body weight, about 0.25 to about 5 mg/kg of the subject’s body weight, about 0.25 to about 2.5 mg/kg of the subject’s body weight, about 0.25 to about 1.25 mg/kg of the subject’s body weight, about 0.5 to about 10 mg/kg of the subject’s body weight, about 0.5 to about 5 mg/kg of the subject’s body weight, about 0.5 to about 2.5 mg/kg of the subject’s body weight, about 0.5 to about 1.25 mg/kg of the subject’s body weight, about 0.75 to about 10 mg/kg of the subject’s body weight, about 0.75 to about 5 mg/kg of the subject’s body weight, about 0.75 to about 2.5 mg/kg of the subject’s body weight, or about 0.75 to about 1.25 mg/kg of the subject’s body weight.
  • the first dose of the ADC is a dose of about 1 to about 10 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the first dose of the ADC is a dose of about 1 to about 5 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the first dose of the ADC is a dose of about 1 to about 2.5 mg/kg of the subject’s body weight.
  • the first dose of the ADC is a dose of about 1 to about 1.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the first dose of the ADC is a dose of about 0.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the first dose of the ADC is a dose of about 0.5 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of about 0.75 mg/kg of the subject’s body weight.
  • the first dose of the ADC is a dose of about 1.0 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of about 1.25 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of about 1.5 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of about 1.75 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of about 2.0 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of about 2.25 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of or about 2.5 mg/kg of the subject’s body weight.
  • the first dose of the ADC is a dose of 0.25 to 10 mg/kg of the subject’s body weight, 0.25 to 5 mg/kg of the subject’s body weight, 0.25 to 2.5 mg/kg of the subject’s body weight, 0.25 to 1.25 mg/kg of the subject’s body weight, 0.5 to 10 mg/kg of the subject’s body weight, 0.5 to 5 mg/kg of the subject’s body weight, 0.5 to 2.5 mg/kg of the subject’s body weight, 0.5 to 1.25 mg/kg of the subject’s body weight, 0.75 to 10 mg/kg of the subject’s body weight, 0.75 to 5 mg/kg of the subject’s body weight, 0.75 to 2.5 mg/kg of the subject’s body weight, or 0.75 to 1.25 mg/kg of the subject’s body weight.
  • the first dose of the ADC is a dose of 1 to 10 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the first dose of the ADC is a dose of 1 to 5 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the first dose of the ADC is a dose of 1 to 2.5 mg/kg of the subject’s body weight.
  • the first dose of the ADC is a dose of 1 to 1.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the first dose of the ADC is a dose of 0.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the first dose of the ADC is a dose of 0.5 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of 0.75 mg/kg of the subject’s body weight.
  • the first dose of the ADC is a dose of 1.0 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of 1.25 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of 1.5 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of 1.75 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of 2.0 mg/kg of the subject’s body weight. In some embodiments, the first dose of the ADC is a dose of 2.25 mg/kg of the subject’s body weight.
  • the first dose of the ADC is a dose of 2.5 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by about 0.1 mg/kg to about 2 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by about 0.1 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by about 0.2 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 0.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 0.3 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by about 0.4 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 0.5 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 0.6 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by about 0.7 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 0.75 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 0.8 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by about 0.9 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 1 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 1.1 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by about 1.2 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 1.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 1.3 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by about 1.4 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 1.5 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 1.6 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by about 1.7 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 1.75 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 1.8 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by about 1.9 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by about 2 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by 0.1 mg/kg to 2 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 0.1 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 0.2 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by 0.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 0.3 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 0.4 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by 0.5 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 0.6 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 0.7 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by 0.75 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 0.8 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 0.9 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by 1 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 1.1 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 1.2 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by 1.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 1.3 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 1.4 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by 1.5 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 1.6 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 1.7 mg/kg of the subject’s body weight.
  • the second dose of the ADC is lower than the first dose by 1.75 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 1.8 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 1.9 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is lower than the first dose by 2 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of about 0.25 to about 10 mg/kg of the subject’s body weight, about 0.25 to about 5 mg/kg of the subject’s body weight, about 0.25 to about 2.5 mg/kg of the subject’s body weight, about 0.25 to about 1.25 mg/kg of the subject’s body weight, about 0.5 to about 10 mg/kg of the subject’s body weight, about 0.5 to about 5 mg/kg of the subject’s body weight, about 0.5 to about 2.5 mg/kg of the subject’s body weight, about 0.5 to about 1.25 mg/kg of the subject’s body weight, about 0.75 to about 10 mg/kg of the subject’s body weight, about 0.75 to about 5 mg/kg of the subject’s body weight, about 0.75 to about 2.5 mg/kg of the subject’s body weight, or about 0.75 to about 1.25 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of about 1 to about 10 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of about 1 to about 5 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of about 1 to about 2.5 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of about 1 to about 1.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of about 0.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of about 0.5 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of about 0.75 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of about 1.0 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of about 1.25 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of about 1.5 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of about 1.75 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of about 2.0 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of about 2.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of about 2.5 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of 0.25 to 10 mg/kg of the subject’s body weight, 0.25 to 5 mg/kg of the subject’s body weight, 0.25 to 2.5 mg/kg of the subject’s body weight, 0.25 to 1.25 mg/kg of the subject’s body weight, 0.5 to 10 mg/kg of the subject’s body weight, 0.5 to 5 mg/kg of the subject’s body weight, 0.5 to 2.5 mg/kg of the subject’s body weight, 0.5 to 1.25 mg/kg of the subject’s body weight, 0.75 to 10 mg/kg of the subject’s body weight, 0.75 to 5 mg/kg of the subject’s body weight, 0.75 to 2.5 mg/kg of the subject’s body weight, or 0.75 to 1.25 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of 1 to 10 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of 1 to 5 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of 1 to 2.5 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of 1 to 1.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of 0.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of 0.5 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of 0.75 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of 1.0 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of 1.25 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of 1.5 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of 1.75 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of 2.0 mg/kg of the subject’s body weight.
  • the second dose of the ADC is a dose of 2.25 mg/kg of the subject’s body weight. In some embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is a dose of 2.5 mg/kg of the subject’s body weight. [00468] In certain embodiments of the various methods provided herein, including those methods requiring a first and a second dose, the second dose of the ADC is identical to the first dose of the ADC.
  • the ADC is administered by an intravenous (IV) injection or infusion.
  • the first dose of the ADC is administered by an IV injection.
  • the first dose of the ADC is administered by an IV infusion.
  • the second dose of the ADC is administered by an IV injection.
  • the second dose of the ADC is administered by an IV injection infusion.
  • the first dose of the ADC is administered by an IV injection and the second dose of the ADC is administered by an IV injection.
  • the first dose of the ADC is administered by an IV infusion and the second dose of the ADC is administered by an IV injection.
  • the second dose of the ADC is administered by an IV injection and the second dose of the ADC is administered by an IV injection infusion.
  • the second dose of the ADC is administered by an IV injection infusion and the second dose of the ADC is administered by an IV injection infusion.
  • the ADC of the methods for which the various dosages are described in this paragraph is enfortumab vedotin (EV).
  • the ADC is administered by an IV injection or infusion three times every four- week cycle.
  • the first dose of the ADC is administered by an IV injection or infusion three times every four-week cycle.
  • the second dose of the ADC is administered by an IV injection or infusion three times every four-week cycle.
  • the first dose of the ADC is administered by an IV injection or infusion three times every four-week cycle and the second dose of the ADC is administered by an IV injection or infusion three times every four-week cycle.
  • the ADC of the methods for which the various dosages are described in this paragraph is enfortumab vedotin (EV).
  • the ADC is administered by an IV injection or infusion on Days 1, 8 and 15 of every four- week cycle.
  • the first dose of ADC is administered by an IV injection or infusion on Days 1, 8 and 15 of every four-week cycle.
  • the second dose of ADC is administered by an IV injection or infusion on Days 1, 8 and 15 of every four-week cycle.
  • the first dose of ADC is administered by an IV injection or infusion on Days 1, 8 and 15 of every four-week cycle and the second dose of ADC is administered by an IV injection or infusion on Days 1, 8 and 15 of every four-week cycle.
  • the ADC of the methods for which the various dosages are described in this paragraph is enfortumab vedotin (EV).
  • the ADC is administered by an IV injection or infusion over about 30 minutes three times every four-week cycle.
  • the first dose of the ADC is administered by an IV injection or infusion over about 30 minutes three times every four-week cycle.
  • the second dose of the ADC is administered by an IV injection or infusion over about 30 minutes three times every four-week cycle.
  • the first dose of the ADC is administered by an IV injection or infusion over about 30 minutes three times every four-week cycle and the second dose of the ADC is administered by an IV injection or infusion over about 30 minutes three times every four-week cycle.
  • the ADC of the methods for which the various dosages are described in this paragraph is enfortumab vedotin (EV).
  • the ADC is administered by an IV injection or infusion over about 30 minutes on Days 1, 8 and 15 of every four-week cycle.
  • the first dose of the ADC is administered by an IV injection or infusion over about 30 minutes on Days 1, 8 and 15 of every four-week cycle.
  • the second dose of the ADC is administered by an IV injection or infusion over about 30 minutes on Days 1, 8 and 15 of every four-week cycle.
  • the first dose of the ADC is administered by an IV injection or infusion over about 30 minutes on Days 1, 8 and 15 of every four-week cycle and the second dose of the ADC is administered by an IV injection or infusion over about 30 minutes on Days 1, 8 and 15 of every four-week cycle.
  • the ADC of the methods for which the various dosages are described in this paragraph is enfortumab vedotin (EV).
  • the antibody drug conjugate formulated in the pharmaceutical composition provided herein is administered at a dose of about 1 mg/kg, 1.25 mg/kg, or about 1.5 mg/kg of the subject’s body weight by an intravenous (IV) injection or infusion over about 30 minutes three times every 28-day cycle.
  • the antibody drug conjugate formulated in the pharmaceutical composition is administered by an intravenous (IV) injection or infusion over about 30 minutes on Days 1, 8 and 15 of every 28- day cycle.
  • the method further comprises administering an immune checkpoint inhibitor by an intravenous (IV) injection or infusion one or more times in each four-week cycle.
  • the ADC is administered three times within a 28 day cycle. In some embodiments of the methods provided herein, the ADC is administered on Days 1, 8 and 15 of a 28 day cycle. In some embodiments, the ADC of the methods for which the various dosages are described in this paragraph is enfortumab vedotin (EV).
  • EV vedotin
  • the expression of any of the markers provided herein can be determined by various methods known in the field.
  • the expression of the markers can be determined by the amount or relative amount of mRNA transcribed from the marker genes.
  • the expression of the marker genes can be determined by the amount or relative amount of the protein products encoded by the marker genes.
  • the expression of the marker genes can be determined by the level of biological or chemical response induced by the protein products encoded by the marker genes.
  • the expression of the marker genes can be determined by the expression of one or more genes that correlates with the expression of the marker genes.
  • levels or amounts of gene transcripts (e.g. mRNA) of the marker genes can be used as a proxy for the expression levels of markers genes.
  • PCR or qPCR protocols are known in the art including those exemplified herein.
  • the various PCR or qPCR methods are applied or adapted for determining the mRNA level of the various marker genes.
  • Quantitative PCR (qPCR) also referred as real-time PCR is applied and adapted in some embodiments as it provides not only a quantitative measurement, but also reduced time and contamination.
  • Quantitative PCR refers to the direct monitoring of the progress of PCR amplification as it is occurring without the need for repeated sampling of the reaction products.
  • the reaction products can be monitored via a signaling mechanism e.g., fluorescence) as they are generated and are tracked after the signal rises above a background level but before the reaction reaches a plateau.
  • the number of cycles required to achieve a detectable or “threshold” level of fluorescence varies directly with the concentration of amplifiable targets at the beginning of the PCR process, enabling a measure of signal intensity to provide a measure of the amount of target nucleic acid in a sample in real time.
  • RNA transcripts of the marker genes can also be used for the quantification of RNA transcripts of the marker genes in a sample as the proxy for the expression of the marker genes, including northern blotting and in situ hybridization (Parker & Barnes, Methods in Molecular Biology 106:247-283 (1999)); RNAse protection assays (Hod, Biotechniques 13:852- 854 (1992)); microarrays (Hoheisel et al., Nature Reviews Genetics 7:200-210 (2006); Jaluria et al., Microbial Cell Factories 6:4 (2007)); and polymerase chain reaction (PCR) (Weis et al, Trends in Genetics 8:263-264 (1992)).
  • northern blotting and in situ hybridization Parker & Barnes, Methods in Molecular Biology 106:247-283 (1999)
  • RNAse protection assays Hod, Biotechniques 13:852- 854 (1992)
  • microarrays Hoheisel et al
  • RNA in situ hybridization is a molecular biology technique widely used to measure and localize specific RNA sequences, for example, messenger RNAs (mRNAs), long non-coding RNAs (IncRNAs), and microRNAs (miRNAs) within cells, such as circulating tumor cells (CTCs) or tissue sections, while preserving the cellular and tissue context.
  • mRNAs messenger RNAs
  • IncRNAs long non-coding RNAs
  • miRNAs microRNAs
  • CTCs circulating tumor cells
  • ISH is a type of hybridization that uses a directly or indirectly labeled complementary DNA or RNA strand, such as a probe, to bind to and localize a specific nucleic acid, such as DNA or RNA, in a sample, in particular a portion or section of tissue or cells (in situ).
  • the probe types can be double stranded DNA (dsDNA), single stranded DNA (ssDNA), single stranded complimentary RNA (sscRNA), messenger RNA (mRNA), micro RNA (miRNA), ribosomal RNA, mitochondrial RNA, and/or synthetic oligonucleotides.
  • dsDNA double stranded DNA
  • ssDNA single stranded DNA
  • sscRNA single stranded complimentary RNA
  • mRNA messenger RNA
  • miRNA micro RNA
  • ribosomal RNA mitochondrial RNA
  • synthetic oligonucleotides synthetic oligonucleotides.
  • FISH fluorescent in situ hybridization
  • CISH chromogenic in situ hybridization
  • ISH ISH, FISH and CISH methods are well known to those skilled in the art (see, for example, Stoler, Clinics in Laboratory Medicine 10(l):215-236 (1990); In situ hybridization. A practical approach, Wilkinson, ed., IRL Press, Oxford (1992); Schwarzacher and Heslop- Harrison, Practical in situ hybridization, BIOS Scientific Publishers Ltd, Oxford (2000)).
  • RNA ISH therefore provides for spatial-temporal visualization as well as quantification of gene expression within cells and tissues. It has wide applications in research and in diagnostics (Hu et al., Biomark. Res. 2(1): 1-13, doi: 10.1186/2050-7771-2-3 (2014); Ratan et al., Cureus 9(6):el325.
  • Fluorescent RNA ISH utilizes fluorescent dyes and fluorescent microscopes for RNA labeling and detection, respectively. Fluorescent RNA ISH can provides for multiplexing of four to five target sequences.
  • RNA transcripts of the marker genes in a sample as the proxy for the expression of the marker genes can be determined by sequencing techniques.
  • Representative methods for sequencing-based gene expression analysis include Serial Analysis of Gene Expression (SAGE), and gene expression analysis by massively parallel signature sequencing (MPSS).
  • expression of the marker genes can be determined by the relative abundance of the RNA transcripts (including for example mRNA) of the marker genes in a pool of total transcribed RNA.
  • RNA transcripts including for example mRNA
  • Such relative abundance of the RNA transcripts of the marker genes can be determined by next generation sequencing, which is known as RNA- seq.
  • RNA-seq RNAs from different sources (blood, tissue, cells) are purified, optionally enriched (e.g. with oligo (dT) primers), converted to cDNA, and fragmented. Millions or even billions of short sequence reads are generated from the randomly fragmented cDNA library. See Zhao et al. BMC genomics 16: 97 (2015); Zhao et al.
  • each mRNA transcript of the marker genes is determined by the total number of mapped fragments upon normalization, which is directly proportional to its abundance level.
  • a few normalization schemes are known and used to facilitate the use of the abundance of the RNA transcripts as the parameter for determining gene expression, including RPKM (Reads Per Kilobase Million), FPKM (Fragments Per Kilobase Million), and/or TPM (Transcripts Per Kilobase Million).
  • RPKM can be calculated as follows: count up the total reads in a sample and divide that number by 1,000,000 - which is the “per million” scaling factor; divide the read counts by the “per million” scaling factor, which normalizes for sequencing depth, giving the reads per million (RPM); and divide the RPM values by the length of the gene, in kilobases, which gives RPKM.
  • FPKM is closely related to RPKM except with fragment replacing read. RPKM was made for single-end RNA-seq, where every read corresponded to a single fragment that was sequenced.
  • FPKM was made for paired-end RNA-seq, in which two reads can correspond to a single fragment, or, if one read in the pair did not map, one read can correspond to a single fragment.
  • TPM is very similar to RPKM and FPKM and is calculated as follows: divide the read counts by the length of each gene in kilobases, which gives the reads per kilobase (RPK); count up all the RPK values in a sample and divide this number by 1,000,000, which gives the “per million” scaling factor; divide the RPK values by the “per million” scaling factor, which gives TPM.
  • the expression of the marker genes is determined by RNA- seq, for example by TPM, RPKM, and/or FPKM. In some embodiments, the expression of the marker genes is determined by TPM. In some embodiments, the expression of the marker genes is determined by RPKM. In some embodiments, the expression of the marker genes is determined by FPKM.
  • the expression of the marker genes can be determined in a sample from a subject.
  • the samepie is a blood sample, a serum sample, a plasma sample, bodily fluid (e.g. tissue fluid including cancer tissue fluid), or a tissue (e.g. cancer tissue or the tissue surrounding the cancer).
  • the sample is a tissue sample.
  • the tissue sample is tissue fractions isolated or extracted from a mammal, in particular a human.
  • the tissue sample is a population of cells isolated or extracted from a mammal, in particular a human.
  • the tissue sample is a sample obtained from a biopsy.
  • the samples can be obtained from a variety of organs of a subject, including a human subject.
  • the samples are obtained from organs of a subject having a cancer.
  • the samples are obtained from organs having a cancer in a subject having a cancer.
  • the samples for example reference samples, are obtained from normal organs from the patient or from a second human subject.
  • the tissue includes a tissue from bladder, ureter, breast, lung, colon, rectum, ovary, Fallopian tube, esophagus, cervix, uterine endometrium, skin, larynx, bone marrow, salivary gland, kidney, prostate, brain, spinal cord, placenta, adrenal, pancreas, parathyroid, hypophysis, testis, thyroid, spleen, tonsil, thymus, heart, stomach, small intestine, liver, skeletal muscle, peripheral nerve, mesothelium, or eye.
  • the expression of the various marker genes can be detected by a variety of immunoassays known in the art, including an immunohistochemistrcy (IHC) assay, an immunoblotting assay, a FACS assay, and an ELISA.
  • immunohistochemistrcy IHC
  • immunoblotting assay
  • FACS FACS assay
  • ELISA ELISA
  • the expression of the various marker genes can be detected by antibodies against the protein products encoded by the marker genes in a variety of IHC assays.
  • IHC staining of tissue sections has been shown to be a reliable method of assessing or detecting the presence of proteins in a sample.
  • IHC techniques utilize an antibody to probe and visualize cellular antigens in situ, generally by chromogenic or fluorescent methods.
  • Primary antibodies or antisera such as polyclonal antisera and monoclonal antibodies that specifically target the protein products encoded by the marker genes, can be used to detect expression of the marker genes in an IHC assay.
  • the tissue sample is contacted with a primary antibody for a specific target for a period of time sufficient for the antibody -target binding to occur.
  • the antibodies can be detected by direct labels on the antibodies themselves, for example, radioactive labels, fluorescent labels, hapten labels such as biotin, or an enzyme such as horse radish peroxidase or alkaline phosphatase.
  • unlabeled primary antibody is used in conjunction with a labeled secondary antibody, comprising antisera, polyclonal antisera or a monoclonal antibody specific for the primary antibody.
  • IHC protocols and kits are well known in the art and are commercially available. Automated systems for slide preparation and IHC processing are available commercially. The Leica BOND Autostainer and Leica Bond Refine Detection system is an example of such an automated system.
  • an IHC assay is performed with an unlabeled primary antibody in conjunction with a labeled secondary antibody in an indirect assay.
  • the indirect assay utilizes two antibodies for the detection of the protein products encoded by the marker genes in a tissue sample. First, an unconjugated primary antibody was applied to the tissue (first layer), which reacts with the target antigen in the tissue sample. Next, an enzyme- labeled secondary antibody is applied, which specifically recognize the antibody isotype of the primary antibody (second layer). The secondary antibody reacts with the primary antibody, followed by substrate-chromogen application.
  • the second-layer antibody can be labeled with an enzyme such as a peroxidase, which reacts with the chromogen 3, 3’- diaminobenzidine (DAB) to produce brown precipitate at the reaction site.
  • an enzyme such as a peroxidase, which reacts with the chromogen 3, 3’- diaminobenzidine (DAB) to produce brown precipitate at the reaction site.
  • DAB diaminobenzidine
  • a signal amplification system in certain embodiments to increase the sensitivity of the detection, can be used.
  • a signal amplification system means a system of reagents and methods that can be used to increase the signal from detecting the bound primary or the secondary antibody.
  • a signal amplification system increases the sensitivity of the target protein detection, increases the detected signal, and decreases the lower boundary of the detection limits.
  • signal amplification systems including an enzyme labeling system and macrolabeling system. These systems/approaches are not mutually exclusive and can be used in combination for additive effect.
  • Macrolabels or macrolabeling system are collections of labels numbering in the tens (e.g. phycobiliproteins) to millions (e.g. fluorescent microspheres) attached to or incorporated in a common scaffold.
  • the scaffold can be coupled to a target-specific affinity reagent such as an antibody, and the incorporated labels are thereby collectively associated with the target upon binding.
  • the labels in the macrolabels can be any of the labels described herein such as fluorophores, haptens, enzymes, and/or radioisotopes.
  • a labeled chain polymer-conjugated secondary antibody was used.
  • the polymer technology utilized an HRP enzyme-labeled inert “spine” molecule of dextran to which 1, 2, 3, 4, 5, 6, 7, 8, 9 10, 15, 20, 25, 30, 50 or more molecules of secondary antibodies can be attached, making the system even more sensitive.
  • Signal amplification system based on an enzyme labeling system utilizes the catalytic activity of enzymes, such as horseradish peroxidase (HRP) or alkaline phosphatase to generate high-density labeling of a target protein or nucleic acid sequence in situ.
  • enzymes such as horseradish peroxidase (HRP) or alkaline phosphatase to generate high-density labeling of a target protein or nucleic acid sequence in situ.
  • tyramide can be used to increase the signal of HRP.
  • HRP enzymatically converts the labeled tyramide derivative into highly reactive, short-lived tyramide radicals.
  • the labeled active tyramide radicals then covalently couple to residues (principally the phenol moiety of protein tyrosine residues) in the vicinity of the HRP- antibody-target interaction site, resulting amplification of the number of labels at the site with minimal diffusion-related loss of signal localization. Consequently, the signal can be amplified 1, 2, 3, 4, 5, 6, 7, 8, 9 10, 15, 20, 25, 30, 50, 75, or 100 folds.
  • the labels on the tyramide can be any labels described herein, including fluorophores, enzymes, haptens, radioisotopes, and/or photophores. Other enzyme-based reactions can be utilized to create signal amplification as well.
  • Enzyme-Labeled Fluorescence (ELF) signal amplification is available for alkaline phosphatase, wherein the alkaline phosphatase enzymatically cleaves a weakly blue-fluorescent substrate (ELF 97 phosphate) and converts it into a bright yellow-green-fluorescent precipitate that exhibits an unusually large Stokes shift and excellent photostability.
  • ELF Enzyme-Labeled Fluorescence
  • the expression level of the marker genes is detected with IHC using a signal amplification system.
  • the specimen is then counterstained to identify cellular and subcellular elements.
  • the expression level of the protein products encoded by the marker genes can also be detected with antibodies against the protein products encoded by the marker genes using an immunoblotting assay.
  • proteins are often (but do not have to be) separated by electrophoresis and transferred onto membranes (usually nitrocellulose or PVDF membrane).
  • membranes usually nitrocellulose or PVDF membrane.
  • primary antibodies or antisera such as polyclonal antisera and monoclonal antibodies that specifically target the protein products encoded by the marker genes, can be used to detect expression of the marker genes.
  • the membrane is contacted with a primary antibody for a specific target for a period of time sufficient for the antibody-antigen binding to occur and the bound antibodies can be detected by direct labels on the primary antibodies themselves, e.g. with radioactive labels, fluorescent labels, hapten labels such as biotin, or enzymes such as horseradish peroxidase or alkaline phosphatase.
  • unlabeled primary antibody is used in an indirect assay as described above in conjunction with a labeled secondary antibody specific for the primary antibody.
  • the secondary antibodies can be labeled, for example, with enzymes or other detectable labels such as fluorescent labels, luminescent labels, colorimetric labels, or radioisotopes.
  • Immunoblotting protocols and kits are well known in the art and are commercially available. Automated systems for immunoblotting, e.g. iBind Western Systems for Western blotting (ThermoFisher, Waltham, MA USA 02451), are available commercially. Immunoblotting includes, but is not limited to, Western blot, in-cell Western blot, and dot blot. Dot blot is a simplified procedure in which protein samples are not separated by electrophoresis but are spotted directly onto a membrane. In cell Western blot involves seeding cells in microtiter plates, fixing/permeabilizing the cells, and subsequent detection with a primary labeled primary antibody or unlabelled primary antibody followed by labeled secondary antibody as described herein.
  • the expression levels of the protein products encoded by the marker genes can also be detected with the antibodies described herein in a flow cytometry assay, including a fluorescence-activated cell sorting (FACS) assay.
  • FACS fluorescence-activated cell sorting
  • primary antibodies or antisera such as polyclonal antisera and monoclonal antibodies that specifically target the protein products encoded by the marker genes, can be used to detect protein expression in a FACS assay.
  • cells are stained with primary antibodies against specific target protein for a period of time sufficient for the antibody-antigen binding to occur and the bound antibodies can be detected by direct labels on the primary antibodies, for example, fluorescent labels or hapten labels such as biotin on the primary antibodies.
  • unlabeled primary antibody is used in an indirect assay as described above in conjunction with a fluorescently labeled secondary antibody specific for the primary antibody.
  • FACS provides a method for sorting or analyzing a mixture of fluorescently labeled biological cells, one cell at a time, based upon the specific light scattering and fluorescent characteristics of each cell. The flow cytometer thus detects and reports the intensity of the fluori chrome-tagged antibody, which indicates the expression level of the target protein. Therefore, the expression level of the protein products encoded by the marker genes can be detected using antibodies against such protein products. Non-fluore scent cytoplasmic proteins can also be observed by staining permeablized cells.
  • the expression levels of the protein products encoded by the marker genes can also be detected using immunoassays such as an Enzyme Immune Assay (EIA) or an ELISA.
  • EIA and ELISA assays are known in the art, e.g. for assaying a wide variety of tissues and samples, including blood, plasma, serum or bone marrow.
  • a wide range of ELISA assay formats are available, see, e.g., U.S. Pat. Nos. 4,016,043, 4,424,279, and 4,018,653, which are hereby incorporated by reference in their entireties.
  • sandwich assays are commonly used assay format.
  • sandwich assay technique A number of variations of the sandwich assay technique exist. For example, in a typical forward assay, an unlabelled antibody is immobilized on a solid substrate, and the sample to be tested brought into contact with the bound molecule.
  • a second antibody specific to the antigen, labeled with a reporter molecule capable of producing a detectable signal is then added and incubated, allowing time sufficient for the formation of another complex of antibody-antigen-labeled antibody. Any unreacted material is washed away, and the presence of the antigen is determined by observation of a signal produced by the reporter molecule.
  • the results can either be qualitative, by simple observation of the visible signal, or can be quantitated by comparing with a control sample containing known amounts of target protein.
  • an enzyme is conjugated to the second antibody.
  • fluorescently labeled secondary antibodies can be used in lieu of the enzyme-labeled secondary antibody to produce a detectable signal an ELISA assay format.
  • the fluorochrome-labeled antibody When activated by illumination with light of a particular wavelength, the fluorochrome-labeled antibody adsorbs the light energy, inducing a state to excitability in the molecule, followed by emission of the light at a characteristic color visually detectable with a light microscope.
  • the fluorescent labeled antibody is allowed to bind to the first antibody -target protein complex.
  • any of a number of enzymes or nonenzyme labels can be utilized so long as the enzymatic activity or non-enzyme label, respectively, can be detected.
  • the enzyme thereby produces a detectable signal, which can be utilized to detect a target protein.
  • Particularly useful detectable signals are chromogenic or fluorogenic signals.
  • particularly useful enzymes for use as a label include those for which a chromogenic or fluorogenic substrate is available. Such chromogenic or fluorogenic substrates can be converted by enzymatic reaction to a readily detectable chromogenic or fluorescent product, which can be readily detected and/or quantified using microscopy or spectroscopy.
  • Such enzymes are well known to those skilled in the art, including but not limited to, horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, glucose oxidase, and the like (see Hermanson, Bioconjugate Techniques, Academic Press, San Diego (1996)).
  • Other enzymes that have well known chromogenic or fluorogenic substrates include various peptidases, where chromogenic or fluorogenic peptide substrates can be utilized to detect proteolytic cleavage reactions.
  • chromogenic and fluorogenic substrates are also well known in bacterial diagnostics, including but not limited to the use of a- and ⁇ -galactosidase, ⁇ -glucuronidase,6-phospho- ⁇ -D-galatoside 6- phosphogalactohydrolase, ⁇ -gluosidase, a-glucosidase, amylase, neuraminidase, esterases, lipases, and the like (Manafi et al., Microbiol. Rev. 55:335-348 (1991)), and such enzymes with known chromogenic or fluorogenic substrates can readily be adapted for use in methods of the present disclosure.
  • chromogenic or fluorogenic substrates to produce detectable signals are well known to those skilled in the art and are commercially available.
  • Exemplary substrates that can be utilized to produce a detectable signal include, but are not limited to, 3,3'-diaminobenzidine (DAB), 3,3’,5,5’-tetramethylbenzidine (TMB), Chloronaphthol (4- CN)(4-chl oro-1 -naphthol), 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid) (ABTS), o-phenylenediamine dihydrochloride (OPD), and 3-amino-9-ethylcarbazole (AEC) for horseradish peroxidase; 5-bromo-4-chloro-3-indolyl-l-phosphate (BCIP), nitroblue tetrazolium (NBT), Fast Red (Fast Red TR/AS-MX
  • fluorogenic substrates include, but are not limited to, 4-(Trifluoromethyl)umbelliferyl phosphate for alkaline phosphatase; 4-Methylumbelliferyl phosphate bis (2-amino- 2-methyl- 1,3-propanediol), 4-Methylumbelliferyl phosphate bis (cyclohexylammonium) and 4- Methylumbelliferyl phosphate for phosphatases; QuantaBluTM and QuantaRedTM for horseradish peroxidase; 4-Methylumbelliferyl ⁇ -D-galactopyranoside, Fluorescein di( ⁇ -D- galactopyranoside) and Naphthofluorescein di-( ⁇ -D-galactopyranoside) for ⁇ -galactosidase; 3-Acetylumbelliferyl ⁇ -D-glucopyranoside and 4-Methylumbelliferyl- ⁇ - D-glucopyranoside for ⁇ -glucos
  • Exemplary enzymes and substrates for producing a detectable signal are also described, for example, in US publication 2012/0100540.
  • Various detectable enzyme substrates including chromogenic or fluorogenic substrates, are well known and commercially available (Pierce, Rockford IL; Santa Cruz Biotechnology, Dallas TX; Invitrogen, Carlsbad CA; 42 Life Science; Biocare).
  • the substrates are converted to products that form precipitates that are deposited at the site of the target nucleic acid.
  • exemplary substrates include, but are not limited to, HRP-Green (42 Life Science), Betazoid DAB, Cardassian DAB, Romulin AEC, Bajoran Purple, Vina Green, Deep Space BlackTM, Warp RedTM, Vulcan Fast Red and Ferangi Blue from Biocare (Concord CA; bi ocare . net/ products/ detecti on/ chromogens) .
  • a detectable label can be directly coupled to either the primary antibody or the secondary antibody that detects the unlabeled primary antibody can have.
  • Exemplary detectable labels are well known to those skilled in the art, including but not limited to chromogenic or fluorescent labels (see Hermanson, Bioconjugate Techniques, Academic Press, San Diego (1996)).
  • fluorophores useful as labels include, but are not limited to, rhodamine derivatives, for example, tetramethylrhodamine, rhodamine B, rhodamine 6G, sulforhodamine B, Texas Red (sulforhodamine 101), rhodamine 110, and derivatives thereof such as tetramethylrhodamine- 5-(or 6), lissamine rhodamine B, and the like; 7-nitrobenz-2-oxa-l,3-diazole (NBD); fluorescein and derivatives thereof; napthalenes such as dansyl (5-dimethylaminonapthalene- 1-sulfonyl); coumarin derivatives such as 7-amino-4-methylcoumarin-3-acetic acid (AMCA), 7-diethylamino-3-[(4'-(iodoacetyl)amino)phenyl]-4-methylcoumarin (DCIA
  • Exemplary chromophores include, but are not limited to, phenolphthalein, malachite green, nitroaromatics such as nitrophenyl, diazo dyes, dabsyl (4- dimethylaminoazobenzene-4'-sulfonyl), and the like.
  • Methods well known to a person skilled in the art such as microscopy or spectroscopy can be utilized to visualize chromogenic or fluorescent detectable signals associated with the bound primary or secondary antibodies.
  • T-24 and UM-UC-3 cells are purchased from ATCC and cultured using the recommended media conditions.
  • the T-24 hNectin-4 (human nectin-4) and the UM-UC-3 Nectin-4 cells are generated by transducing parental cells with lentivirus containing the human Nectin-4 using the pRCDCMEP-CMV-hNectin-4 EFl-Puro construct and selected using puromycin.
  • T-24 Nectin-4 (clone 1 A9) cells are implanted into nude mice and passaged via trocar, allowed to reach approximately 200mm 3 tumor volume, and subsequently treated with a single intraperitoneal (IP) dose of enfortumab vedotin (3mg/kg) or non-binding ADC (3 mg/kg) with 7 animals per treatment group.
  • IP intraperitoneal
  • enfortumab vedotin 3mg/kg
  • non-binding ADC 3 mg/kg
  • the immunohistochemically stained slides sections are scanned with a Leica AT2 digital whole slide scanner, and the images are analyzed with Visiopharm software by use of custom-made algorithms for Nectin 4, CD11c and F4/80 staining.
  • the algorithms are optimized on the basis of staining intensity and background staining. Percent positive staining is calculated for Nectin 4 and positive cells per mm 2 is calculated for F480 and CD11c.
  • Sections of tumor are lysed in Cell Lysis Buffer 2 (R&D Systems®, Catalog # 895347).
  • the cytokines and chemokines from the tumor samples are measured using the MILLIPLEX MAP mouse cytokine/chemokine magnetic bead panel (Millipore) and read on the LUMINEX MAGPIX system.
  • RNA from flash frozen tumors is isolated using the TRIZOL Plus RNA Purification Kit (Life Technologies) according to the manufacturer’s protocol yielding high quality RNA (average RNA integrity number > 8).
  • RNA selection method is using Poly(A) selection and the mRNA Library Prep Kit from Illumina and read on the Hi-Seq 2 x 150bp, single index (Illumina). The sequence reads are mapped to the human and mouse transcriptome and total reads per million were determined.
  • the disclosure is generally provided using affirmative language to describe the numerous embodiments.
  • the disclosure also specifically includes embodiments in which particular subject matter is excluded, in full or in part, such as substances or materials, method steps and conditions, protocols, procedures, assays or analysis.
  • particular subject matter is excluded, in full or in part, such as substances or materials, method steps and conditions, protocols, procedures, assays or analysis.
  • aspects that are not expressly included in the disclosure are nevertheless disclosed herein.
  • Particular embodiments of this disclosure are described herein, including the best mode known to the inventors for carrying out the disclosure. Upon reading the foregoing description, variations of the disclosed embodiments can become apparent to individuals working in the art, and it is expected that those skilled artisans can employ such variations as appropriate.
  • Example 1 An Open-Label, Randomized Phase 3 Study to Evaluate Enfortumab Vedotin vs Chemotherapy in Subjects with Previously Treated Locally Advanced or Metastatic Urothelial Cancer (EV-301).
  • the ADC provided herein is enfortumab vedotin, also known as PADCEV.
  • the enfortumab vedotin-ejfv included an anti-191P4D12 antibody, wherein the antibody or antigen binding fragment thereof comprises a heavy chain comprising amino acid residue 20 to amino acid residue 466 of SEQ ID NO: 7 and a light chain comprising amino acid residue 23 to amino acid residue 236 of SEQ ID NO: 8.
  • Enfortumab vedotin-ejfv is a Nectin-4 directed antibody -drug conjugate (ADC) comprised of a fully human anti-nectin-4 IgGl kappa monoclonal antibody (AGS-22C3) conjugated to the small molecule microtubule disrupting agent, monomethyl auristatin E (MMAE) via a protease-cleavable maleimidocaproyl valine-citrulline (vc) linker (SGD- 1006). Conjugation takes place on cysteine residues that comprise the interchain disulfide bonds of the antibody to yield a product with a drug-to-antibody ratio of approximately 3.8: 1. The molecular weight is approximately 152 kDa.
  • Enfortumab vedotin-ejfv has the following structural formula:
  • MMAE Approximately 4 molecules of MMAE are attached to each antibody molecule.
  • Enfortumab vedotin-ejfv is produced by chemical conjugation of the antibody and small molecule components.
  • the antibody is produced by mammalian (Chinese hamster ovary) cells and the small molecule components are produced by chemical synthesis.
  • PADCEV (enfortumab vedotin-ejfv) for injection was provided as a sterile, preservative-free, white to off-white lyophilized powder in single-dose vials for intravenous use.
  • PADCEV was supplied as a 20 mg per vial and a 30 mg per vial and requires reconstitution with Sterile Water for Injection, USP, (2.3 mL and 3.3 mL, respectively) resulting in a clear to slightly opalescent, colorless to slightly yellow solution with a final concentration of 10 mg/mL (see Dosage and Administration (6.1.6.1(i))). After reconstitution, each vial allows the withdrawal of 2 mL (20 mg) and 3 mL (30 mg).
  • Each mL of reconstituted solution contained 10 mg of enfortumab vedotin-ejfv, histidine (1.4 mg), histidine hydrochloride monohydrate (2.31 mg), polysorbate 20 (0.2 mg) and trehalose dihydrate (55 mg) with a pH of 6.0.
  • the planned study enrollment is approximately 24 months from first subject enrolled with an additional 12 months anticipated for overall survival (OS) follow-up after the last subject enrolled.
  • the total study duration will be approximately 36 months.
  • HRU Healthcare resources utilization
  • OS is the primary endpoint. OS is defined as the time from randomization to the date of death. Secondary endpoints include PFS1, ORR, DOR, DCR, safety and QOL/PRO. [00533] Subjects in Arm A will receive EV on Days 1, 8 and 15 of each 28-day cycle. Subjects in arm B will receive either docetaxel, paclitaxel or vinflunine (as decided by the investigator prior to randomization: vinflunine is a choice of comparator only in countries where it is approved for urothelial cancer) on Day 1 of every 21 -day cycle. Within the control arm, the overall proportion of subjects receiving vinflunine will be capped at approximately 35%.
  • Screening will take place up to 28 days prior to randomization. Subjects will start with cycle 1 and continue on to subsequent 21 -day or 28-day cycles until one of the discontinuation criteria are met.
  • a treatment cycle is defined as 28 days for Arm A and 21 days for Arm B. Subjects randomized to Arm A (EV) will receive treatment and evaluation on Days 1, 8 and 15 of all treatment cycles. Subjects randomized to Arm B (docetaxel, paclitaxel or vinflunine) will receive treatment and evaluation on Day 1 of all treatment cycles.
  • Subj ects will be evaluated for response according to the RECIST VI .1. Imaging for both arms will be performed at baseline and every 56 days ( ⁇ 7 days) from the first dose of study treatment throughout the study until PFS1 is documented by radiological disease progression or the subject is lost to follow-up, death, withdraws study consent or starts a subsequent anti-cancer therapy.
  • Baseline imaging performed prior to informed consent as standard of care may be used so long as it is performed within 28 days prior to randomization. All subjects will have a bone scan (scintigraphy) performed at screening/baseline. Subjects with positive bone scans at baseline will have a bone scan performed every 56 days ( ⁇ 7 days) throughout the study or more frequently if clinically indicated. Subjects should have a follow-up bone scan performed if clinically indicated regardless of baseline status. Brain scans (computed tomography with contrast/magnetic resonance imaging (MRI)) will only be performed if clinically indicated at screening/baseline and repeated as clinically indicated or per standard of care throughout the study.
  • MRI magnetic resonance imaging
  • QOL assessments and PRO will be collected at protocol-specified time points from all randomized subjects.
  • the following validated tools will be used: European Organisation for Research and Treatment of Cancer (EORTC) Quality of Life Questionnaire (QLQ-C30) and EuroQOL 5-dimensions (EQ-5D-5L).
  • EORTC European Organisation for Research and Treatment of Cancer
  • QLQ-C30 Quality of Life Questionnaire
  • EQ-5D-5L EuroQOL 5-dimensions
  • HRU Healthcare Resource Utilization
  • Blood samples for pharmacokinetics and ATA will be collected throughout the study for subjects randomized into Arm A. Validated assays will be used to measure the concentrations of EV ADC and MMAE in serum or plasma and to assess ATA. Pharmacokinetic samples will not be collected from subjects randomized into Arm B. Samples for exploratory biomarkers will be collected at protocol-specified timepoints. Biomarker assessments will not be used for subject selection.
  • PFS2 Following PFS1, subjects will enter the long-term follow-up period and be followed per institutional guidelines, but not less than every 3 months from the date of the follow-up visit for survival status and progression status on subsequent therapy (i.e., PFS2). [00541] Subjects will be followed until PFS2 is documented or the subject starts another anticancer treatment, whichever occurs earlier. All subsequent anticancer therapy including date and site of progression for PFS2 will be recorded on the case report form.
  • IDMC Independent Data Monitoring Committee
  • OS events about 65% of the total planned events
  • the primary analysis will occur at 439 OS events.
  • the IDMC may recommend to the sponsor whether the trial should be terminated, modified or continue unchanged based on ongoing reviews of safety data and interim efficacy analysis. Further details will be outlined in the IDMC charter.
  • Subject is legally an adult according to local regulation at the time of signing informed consent.
  • Subject has histologically or cytologically confirmed urothelial carcinoma (i.e., cancer of the bladder, renal pelvis, ureter or urethra).
  • Subjects with urothelial carcinoma (transitional cell) with squamous differentiation or mixed cell types are eligible.
  • Subject must have experienced radiographic progression or relapse during or after a CPI (anti- programmed cell death- 1 (PD-1) or anti-programmed cell death-ligand 1 (PD-L1)) for locally advanced or metastatic disease.
  • Subjects who discontinued CPI treatment due to toxicity are eligible provided that they have evidence of disease progression following discontinuation. The CPI need not be the most recent therapy.
  • Subjects for whom the most recent therapy has been a non-CPI based regimen are eligible if they have progressed/relapsed during or after their most recent therapy.
  • Locally advanced disease must not be amenable to resection with curative intent per the treating physician.
  • Subject must have received a platinum containing regimen (cisplatin or carboplatin) in the metastatic/locally advanced, neoadjuvant or adjuvant setting. If platinum was administered in the adjuvant/neoadjuvant setting subject must have progressed within 12 months of completion.
  • Subject has radiologically documented metastatic or locally advanced disease at baseline. An archival tumor tissue sample should be available for submission to central laboratory prior to study treatment.
  • Subject has ECOG PS of 0 or 1 The subject has the following baseline laboratory data:
  • Docetaxel should not be chosen as a comparator for subjects if total bilirubin > ULN, or if AST and/or ALT ⁇ 1.5 x ULN concomitant with alkaline phosphatase ⁇ 2.5 x ULN.
  • Female subject must either:
  • Postmenopausal defined as at least 1 year without any menses for which there is no other obvious pathological or physiological cause

Landscapes

  • Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2021/050627 2020-09-17 2021-09-16 Methods for treating cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins Ceased WO2022060955A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
PH1/2023/550745A PH12023550745A1 (en) 2020-09-17 2021-09-16 Methods for treating cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins
CN202311192917.1A CN117224698A (zh) 2020-09-17 2021-09-16 用结合于191p4d12蛋白的抗体药物偶联物(adc)治疗癌症的方法
CA3194339A CA3194339A1 (en) 2020-09-17 2021-09-16 Methods for treating cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins
MX2023003059A MX2023003059A (es) 2020-09-17 2021-09-16 Métodos para tratar cáncer con conjugados de anticuerpo-fármaco (adc) que se unen a las proteínas 191p4d12.
KR1020237012738A KR20230091885A (ko) 2020-09-17 2021-09-16 191p4d12 단백질에 결합하는 항체 약물 접합체(adc)로 암을 치료하는 방법
AU2021344976A AU2021344976A1 (en) 2020-09-17 2021-09-16 Methods for treating cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins
IL301163A IL301163A (en) 2020-09-17 2021-09-16 Methods for treating cancer with antibody-drug conjugates (ADC) that bind to proteins 191P4D12
CN202180077229.3A CN116710483A (zh) 2020-09-17 2021-09-16 用结合于191p4d12蛋白的抗体药物偶联物(adc)治疗癌症的方法
EP21870200.9A EP4213888A4 (en) 2020-09-17 2021-09-16 METHODS OF TREATING CANCERS USING ANTIBODY-DRUG CONJUGATES (ADCs) BINDING TO 191P4D12 PROTEINS
US18/025,349 US20230330251A1 (en) 2020-09-17 2021-09-16 Methods for treating cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins
JP2023517259A JP2023542879A (ja) 2020-09-17 2021-09-16 191p4d12タンパク質に結合する抗体薬物複合体(adc)を用いたがんの治療方法

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US202063080013P 2020-09-17 2020-09-17
US63/080,013 2020-09-17
US202163196641P 2021-06-03 2021-06-03
US63/196,641 2021-06-03
US202163240794P 2021-09-03 2021-09-03
US63/240,794 2021-09-03

Publications (1)

Publication Number Publication Date
WO2022060955A1 true WO2022060955A1 (en) 2022-03-24

Family

ID=80777582

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/050627 Ceased WO2022060955A1 (en) 2020-09-17 2021-09-16 Methods for treating cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins

Country Status (11)

Country Link
US (1) US20230330251A1 (cg-RX-API-DMAC7.html)
EP (1) EP4213888A4 (cg-RX-API-DMAC7.html)
JP (1) JP2023542879A (cg-RX-API-DMAC7.html)
KR (1) KR20230091885A (cg-RX-API-DMAC7.html)
AU (1) AU2021344976A1 (cg-RX-API-DMAC7.html)
CA (1) CA3194339A1 (cg-RX-API-DMAC7.html)
IL (1) IL301163A (cg-RX-API-DMAC7.html)
MX (1) MX2023003059A (cg-RX-API-DMAC7.html)
PH (1) PH12023550745A1 (cg-RX-API-DMAC7.html)
TW (1) TWI911277B (cg-RX-API-DMAC7.html)
WO (1) WO2022060955A1 (cg-RX-API-DMAC7.html)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023235754A1 (en) * 2022-06-01 2023-12-07 ALX Oncology Inc. Combination therapies for treating urothelial carcinoma
US12257340B2 (en) 2018-12-03 2025-03-25 Agensys, Inc. Pharmaceutical compositions comprising anti-191P4D12 antibody drug conjugates and methods of use thereof
EP4225379A4 (en) * 2020-10-11 2025-11-19 Agensys Inc METHODS FOR TREATING CANCERS WITH ANTIBODY-DRUG CONJUGATES (ADCs) BINDING TO 191P4D12 PROTEINS

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180296693A1 (en) * 2010-09-29 2018-10-18 Agensys, Inc. Antibody drug conjugates (adc) that bind to 191p4d12 proteins
US20200277383A1 (en) * 2017-09-07 2020-09-03 Dragonfly Therapeutics, Inc. Proteins binding nkg2d, cd16 and a tumor-associated antigen

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3710600B1 (en) * 2017-11-17 2025-03-12 GMDx Co Pty Ltd Systems and methods for predicting the efficacy of cancer therapy
CN109504660B (zh) * 2018-11-02 2021-08-06 温州启星生物技术有限公司 一种第四代car-t细胞及其构建方法和应用
AU2019392090A1 (en) * 2018-12-03 2021-06-17 Agensys, Inc. Pharmaceutical compositions comprising anti-191P4D12 antibody drug conjugates and methods of use thereof
KR20220106779A (ko) * 2019-11-25 2022-07-29 어젠시스 인코포레이티드 191p4d12 단백질에 결합하는 항체 약물 접합체(adc)를 사용한 암의 치료

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180296693A1 (en) * 2010-09-29 2018-10-18 Agensys, Inc. Antibody drug conjugates (adc) that bind to 191p4d12 proteins
US20200277383A1 (en) * 2017-09-07 2020-09-03 Dragonfly Therapeutics, Inc. Proteins binding nkg2d, cd16 and a tumor-associated antigen

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP4213888A4 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12257340B2 (en) 2018-12-03 2025-03-25 Agensys, Inc. Pharmaceutical compositions comprising anti-191P4D12 antibody drug conjugates and methods of use thereof
EP4225379A4 (en) * 2020-10-11 2025-11-19 Agensys Inc METHODS FOR TREATING CANCERS WITH ANTIBODY-DRUG CONJUGATES (ADCs) BINDING TO 191P4D12 PROTEINS
WO2023235754A1 (en) * 2022-06-01 2023-12-07 ALX Oncology Inc. Combination therapies for treating urothelial carcinoma

Also Published As

Publication number Publication date
KR20230091885A (ko) 2023-06-23
JP2023542879A (ja) 2023-10-12
TW202227141A (zh) 2022-07-16
AU2021344976A1 (en) 2023-04-27
CA3194339A1 (en) 2022-03-24
TWI911277B (zh) 2026-01-11
IL301163A (en) 2023-05-01
EP4213888A1 (en) 2023-07-26
EP4213888A4 (en) 2025-10-08
PH12023550745A1 (en) 2024-03-04
US20230330251A1 (en) 2023-10-19
MX2023003059A (es) 2023-06-02

Similar Documents

Publication Publication Date Title
US20250064956A1 (en) Methods for treating muscle invasive urothelial cancer or muscle invasive bladder cancer with antibody drug conjugates (adc) that bind to 191p4d12 proteins
US20230330251A1 (en) Methods for treating cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins
US20230364254A1 (en) Methods for treating cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins
WO2023019236A1 (en) Methods for treating non-muscle invasive bladder cancer (nmibc) with antibody drug conjugates (adc) that bind to 191p4d12 proteins
AU2023316566A1 (en) Methods for treating patients with locally advanced or metastatic urothelial cancer with antibody drug conjugates (adc) that bind 191p4d12 proteins in combination with pembrolizumab
WO2025064741A1 (en) Treating locally advanced or metastatic urothelial cancer with anti-191p4d12 antibody drug conjugates in combination with pembrolizumab
EA051680B1 (ru) Способы лечения рака конъюгатами антитело-лекарственное средство (adc), связывающимися с белками 191p4d12
CN116710147A (zh) 用结合于191p4d12蛋白的抗体药物偶联物(adc)治疗癌症的方法
EA051614B1 (ru) Способы лечения мышечно-инвазивного рака уротелия или мышечно-инвазивного рака мочевого пузыря конъюгатами антител и лекарственных средств (adc), которые связываются с белками 191p4d12
CN116710483A (zh) 用结合于191p4d12蛋白的抗体药物偶联物(adc)治疗癌症的方法
CN118748941A (zh) 用结合于191p4d12蛋白的抗体药物偶联物(adc)治疗肌层浸润性尿路上皮癌或肌层浸润性膀胱癌的方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21870200

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3194339

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: AU2021344976

Country of ref document: AU

Ref document number: DZP2023000244

Country of ref document: DZ

ENP Entry into the national phase

Ref document number: 2023517259

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023004699

Country of ref document: BR

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021870200

Country of ref document: EP

Effective date: 20230417

ENP Entry into the national phase

Ref document number: 2021344976

Country of ref document: AU

Date of ref document: 20210916

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202180077229.3

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 112023004699

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230314