WO2021258213A1 - Bifunctional superkines and uses thereof - Google Patents

Bifunctional superkines and uses thereof Download PDF

Info

Publication number
WO2021258213A1
WO2021258213A1 PCT/CA2021/050872 CA2021050872W WO2021258213A1 WO 2021258213 A1 WO2021258213 A1 WO 2021258213A1 CA 2021050872 W CA2021050872 W CA 2021050872W WO 2021258213 A1 WO2021258213 A1 WO 2021258213A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
mutein
cancer
bispecific
cells
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/CA2021/050872
Other languages
English (en)
French (fr)
Inventor
Fahar Merchant
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Medicenna Therapeutics Inc
Original Assignee
Medicenna Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Medicenna Therapeutics Inc filed Critical Medicenna Therapeutics Inc
Priority to US18/002,824 priority Critical patent/US20230365642A1/en
Priority to CN202180050945.2A priority patent/CN116390744A/zh
Priority to EP21828793.6A priority patent/EP4172216A4/en
Priority to CA3183825A priority patent/CA3183825A1/en
Priority to JP2022579927A priority patent/JP2023532273A/ja
Publication of WO2021258213A1 publication Critical patent/WO2021258213A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/55IL-2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5437IL-13
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin

Definitions

  • Interleukin 2 is a pluripotent cytokine produced primarily by activated CD4+ T cells, which plays a crucial role in producing a normal immune response.
  • IL-2 promotes proliferation and expansion of activated T lymphocytes, potentiates B cell growth, and activates monocytes and natural killer cells. It was by virtue of these activities that IL-2 was tested and is used as an approved treatment of cancer (aldesleukin, Proleukin®).
  • human IL-2 is synthesized as a precursor polypeptide of 153 amino acids, from which 20 amino acids are removed to generate mature secreted IL-2 (Taniguchi 1983). Recombinant human IL-2 has been produced in E. coli (Rosenberg 1984), in insect cells (Smith 1985) and in mammalian COS cells (Taniguchi 1983).
  • Interleukin-2 is a four a-helical bundle type I cytokine first identified as a T cell growth factor (Morgan et al, Science 193: 1007 (1976)) but subsequently shown to have broad actions.
  • IL-2 promotes T helper differentiation (Zhu et al, Annual review of immunology 28: 445 (2010); Liao et al, Nat Immunol 9: 1288 (2008); and Liao et al, Nat Immunol 12: 551 (2011)) and the development of regulatory T (Treg) cells (Cheng et al, Immunol Rev 241: 63 (2011)), induces natural killer and lymphokine activated killer activity (Liao et al, Immunity 38: 13 (2013)), and mediates activation-induced cell death (AICD) (Lenardo et al., Nature 353: 858 (1991)).
  • Treg regulatory T
  • AICD activation-induced cell death
  • IL-2 works by interacting with three different receptors: the interleukin 2 receptor alpha (IL- 2Ra; CD25), the interleukin 2 receptor beta (IL-2Rb;CD122), and the interleukin 2 receptor gamma (IL-2Ry;CD132; common gamma chain).
  • the first receptor to be identified was the IL-2Ra, which is a 55 kD polypeptide (p55) that appears upon T cell activation and was originally called Tac (for T activation) antigen.
  • the IL-2Ra binds IL-2 with a Ka of approximately 10 8 M, and is also known as the “low affinity” IL-2 receptor.
  • IL-2 Binding of IL-2 to cells expressing only the IL-2Ra does not lead to any detectable biologic response.In most circumstances, IL-2 works through three different receptors: the IL-2Ra, the IL-2Rp. and the IL-2Ry. Most cells, such as resting T cells, are not responsive to IL-2 since they only express the IL-2Rp. and the IL-2Ry, which have low affinity for IL-2. Upon stimulation, resting T cells express the relatively high affinity IL-2 receptor IL-2Ra. Binding of IL-2 to the IL-2Ra causes this receptor to sequentially engage the IL-2Rb, and the IL- 2Ry. bringing about T cell activation. IL-2 “superkines” with augmented action due to enhanced binding affinity for IL-2RP were previously developed (Levin et ak, Nature 484: 529 (2012)).
  • the present invention meets this need, providing IL-2 superagonists or agonists as bispecific fusions with a second cytokine.
  • the IL-2 muteins portions of the bispecific fusions comprise substitutions L80F, R81D, L85V, I86V and I92F, numbered in accordance with wild-type IL-2.
  • IL-2 exerts a wide spectrum of effects on the immune system, and it plays crucial roles in regulating both immune activation and homeostasis.
  • bispecific IL-2 cytokine fusions are described and also find use in monotherapies as well as in combination with anti-PD-1 antibodies for the treatment of cancer.
  • the present invention provides a bispecific IL-2 cytokine fusion, comprising an IL-2 mutein as described herein fused to a second cytokine.
  • the IL-2 mutein comprises the following amino acid substitutions: L80F, R81D, L85V, I86V, and I92F, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises Y45A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises an E62A substitution and an F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein is an IL-2 mutein as described in Tables 2, 4, 5, and/or 6.
  • the bispecific IL-2 cytokine fusion comprises a sequence as described in Tables 2, 4, 5, 6, 10, and/or 12 and/or Figure 54.
  • the bispecific IL-2 cytokine fusion comprises SEQ ID NO: 146, SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, or SEQ ID NO:150.
  • the bispecific IL-2 cytokine fusion comprises MDNA413-Fc-MDNA109 or MDNA109FEAA-Fc-MDNA413.
  • the bispecific IL-2 cytokine fusion further comprises an Fc antibody fragment.
  • the Fc antibody fragment is a human Fc antibody fragment.
  • the Fc antibody fragment comprises a N297A substitution.
  • the bispecific IL-2 cytokine fusion further comprises albumin.
  • the second cytokine is selected from the group consisting of IL-4, IL-13, IL-10, IL-12, IL15, and IL-18.
  • the second cytokine is IL-4 or IL-13.
  • the second cytokine is as described in Table 7 and/or Table 8 and/or Table 12 and/or Table 28 and/or Figure 54.
  • the bispecific IL-2 cytokine fusion exhibits increased binding capacity for IL-2R ⁇ 5 as compared to wild-type human IL-2.
  • the bispecific IL-2 cytokine fusion exhibits a greater binding affinity for IL-2R ⁇ as compared to wild-type human IL-2.
  • the bispecific IL-2 cytokine fusion exhibits abrogated IL2Ra binding (i.e., does not significantly bind to IL2Ra).
  • the bispecific IL-2 cytokine fusion exhibits decreased binding affinity for CD25 as compared to wild-type human IL-2.
  • the bispecific IL-2 cytokine fusion comprises SEQ ID NO: 146, SEQ ID NO: 147, SEQ ID NOs:148 and 213, SEQ ID NOs:149 and 213, SEQ ID NO: 150, SEQ ID NOs:151 and 214, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NOs: 157 and 213, SEQ ID NO: 158, SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NOs: 161 and 215, SEQ ID NOs: 162 and 216, SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NOs: 165 and 213, SEQ ID NOs: 166 and 213, or SEQ ID NOs: 167 and 217, or a sequence from Table 12 or Table 28 or Figure 54.
  • the bispecific IL-2 cytokine fusion comprises MDNA413-Fc-MDNA109, MDNA109FEAA-Fc-MDNA413, Fc-MDNA132 (1:1 KiH), Fc-All (1:2), Fc-All (1:2), Fc-MDNA413 (1:2), Fc-MDNA413 (1:2), Fc4-MDNA413 (1:2), MDNA413-Fc (1:1 KIH), MDNA109-Fc (2:1), MDNA-109FEAA-Fc (2:1), Fc-MDNA109 (1:2), MDNA109FEAA-Fc-MDNA132 (2:1:1 KiH), MDNA413-Fc-MDNA132 (2:1:1 KiH), MDNA109FEAA-Fc-MDNA413 (2:1:2) - version 1, MDNA109FEAA-F C-MDNA413 (2:1:2) - version 2, MDNA132
  • the present invention also provides a method of treating cancer comprising administering a bispecific IL-2 cytokine fusion as described herein.
  • the cancer is selected from the group consisting of prostate cancer, ovarian cancer, breast cancer, endometrial cancer, multiple myeloma, melanoma, lymphomas, lung cancers including small cell lung cancer, kidney cancer, liver cancer, colon cancer, colorectal cancer, pancreatic cancer, gastric cancer, and brain cancer.
  • the cancer is colon cancer.
  • the present invention also provides a method of treating cancer comprising administering a combination treatment comprising:
  • the anti-PD-1 antibody or inhibitor is selected from the group consisting ofnivolumab, BMS-936558, MDX-1106, ONO-4538, AMP224, CT-011, and MK- 3475(pembrolizumab), cemipbmab (REGN2810), SHR-1210 (CTR20160175 and CTR20170090), SHR-1210 (CTR20170299 and CTR20170322), JS-001 (CTR20160274), IBI308 (CTR20160735), BGB-A317 (CTR20160872) and aPD-1 antibody as recited in U.S. Patent Publication No. 2017/0081409 or in Table 38.
  • the anti-PD-Ll antibody or inhibitor is selected from the group consisting of atezolizumab, avelumab, and Durvalumab.
  • the cancer is selected from the group consisting of prostate cancer, ovarian cancer, breast cancer, endometrial cancer, multiple myeloma, melanoma, lymphomas, lung cancers including small cell lung cancer, kidney cancer, liver cancer, colon cancer, colorectal cancer, pancreatic cancer, gastric cancer, and brain cancer. In some embodiments, the cancer is colon cancer.
  • the present invention also provides pharmaceutical compositions comprising a bispecific IL-2 cytokine fusion as described herein, and a pharmaceutically acceptable carrier.
  • the present invention also provides a pharmaceutical composition
  • a pharmaceutical composition comprising an anti-PD-1 antibody or inhibitor, a bispecific IL-2 cytokine fusion as described herein, and a pharmaceutically acceptable carrier.
  • Figure 1 Provides examples of IgGl, IgG2, IgG3, and IgG4 sequences.
  • Figure 2 Provides exemplary H9-Fc fusion sequences.
  • Figure 3 Exemplary oncolytic viruses.
  • FIG. 4 SDS-PAGE and HPLC analysis of MDNA132-Fc-MDNA109 (KIH) [Lot: T1848A12] post purification.
  • Figure 5 SDS-PAGE and HPLC analysis of MDNA413-Fc-MDNA109 (KIH) [Lot: T1903A08] post purification.
  • Figure 7 Gating strategy. PBMCs were stimulated with IL-2 (25 nM) for 15 minutes prior to staining and analysis by flow-cytometry. Single lymphocytes were identified from which NK cells (CD3-CD56+), CD8 T cells (CD3+CD8+), Tregs (CD3+CD4+CD25+FOXP3+) and non-
  • Treg CD4 T cells (CD3 + CD25 CD4 + FOXP3 ) were gated. Frequency of pSTAT5 positive cells was determined for each immune subset.
  • Figure 8 Fluorescence minus one (FMO) controls. A) Following stimulation and gating strategy described in Figure 4, all antibodies used to identify the different immune subsets were included except for pSTAT5 to provide an FMO control that could be used to create a pSTAT5 + gate for each population. B) FMOs for FOXP3 and CD25 were used to determine Treg population.
  • Figure 9 Representative dose-response of IL-2, IL2-Fc, MDNA109 variants, and bi-specific superkines on pSTAT5 PBMCs. Graphs and EC50 values were calculated using non-linear regression. Each data point is a singlet.
  • Figure 10 EC50 ratios of naive CD8T cells (left) and NK cells (right) to Tregs.
  • FIG 11 Survival BALB/c mice receiving different doses of MDNA132-Fc-MDNA109 (left) and MDNA413-Fc-MDNA109 (right).
  • FIG. 12 Survival C57B1/6 mice receiving different doses of MDNA132-Fc-MDNA109 (left) and MDNA413-Fc-MDNA109 (right).
  • FIG. 13 MDNA132-Fc-MDNA109 (KIH) inhibits the growth of CT26 colon tumors.
  • Figure 14 CT26 tumor re-challenge (a) Naive untreated mice or mice previously cured of their CT26 tumors by MDNA132-Fc-MDNA109 were re-challenged on the opposite flank with CT26 tumor cells (b) Overall survival to date. [0053]
  • Figure 15 MDNA413-Fc-MDNA109 inhibits the growth of B16 F10 melanomas. Average tumor size of each treatment group (left) Individual tumor growth (right).
  • Figure 16A-16B Treatment of B16F10 tumor bearing mice with Vehicle (PBS) or MDNA1 09FEAA-F C-MDNA413.
  • Figure 17 Efficacy study in 4T1 model with MDNA132-Fc-MDNA109 and MDNA413- Fc-MDNA109 monotherapy and in combination with anti-PDl.
  • FIG 18 B16F10 intra-tumoral injection with PBS or MDNA132-Fc-MDNA109 (KIH). Injections were performed on Day 14, 17, and 20 post-implant.
  • FIG 19 CT26 intra-tumoral injection with MDNA109FEAA-Fc-MDNA413. Injections were performed on Day 11, 14, and 17.
  • Figure 20 Activation of STAT6 signaling pathway in HEK BlueTM IL-4/IL-13 cells in the presence of human IL-4 (hIL4), human IL-13 (hIL13) or mouse IL-13 (mIL13).
  • Figure 21 Inhibition of STAT6 signaling pathway in HEK BlueTM IL-4/IL-13 cells when cells were incubated with hIL13 together with MDNA413-Fc-MDNA109 (KIH), MDNA109-Fc- MDNA413, or Fc- MDNA413.
  • Figure 22 Inhibition of STAT6 signaling pathway in HEK BlueTM IL-4/IL-13 cells when cells were incubated with mIL13 together with MDNA413-Fc-MDNA109 (KIH), MDNA109-Fc- MDNA413, or Fc- MDNA413.
  • Figure 23 Inhibition of STAT6 signaling pathway in HEK BlueTMIL-4/IL-13 cells when cells were incubated with hIL4 together with MDNA413-Fc-MDNA109 (KIH), MDNA109-Fc- MDNA413, or Fc- MDNA413.
  • Figure 24 Proliferation of CTLL2 cells when the cell culture was supplemented with the indicated proteins.
  • Figure 25 Schematic and binding information for MDNA11.
  • FIG. 26 MDNA11 exhibits enhanced potency on naive CD8+ T and NK cells & diminished activity on Tregs.
  • FIG. 27 MDNA11 inhibits tumor growth & induces a strong memory response as
  • CT26 tumor ( ⁇ 60 mm ) bearing Balb/c mice were treated with MDNA11 (5 mg/kg lx/week, 2 weeks) or Anti-CTLA4 (200 mg 2x/week, 2 weeks) by IP injection.
  • Re-challenge experiment performed by implanting 2 x 10 CT26 cells in opposite flank (Day 49, Day 116 and Day 165), without further treatment.
  • Control mice showed robust tumor growth at each re-challenge experiment (representative data for control shown).
  • Figure 28 Development of long-term (gp70) specific CD8 T cells protected mice against CT26 tumors. Mice challenged with CT26 cells 5 days prior to euthanasia; control mice were age matched. Analysis by flow cytometry using APC anti-mouse CD3s, anti-CD8 FITC clone KT15 and H-2Ld MuLV gp70 Tetramer-PE.
  • FIG. 29 MDNA11 delays the growth of B16F10 melanomas as monotherapy & in combination with TA99 MAb by promoting Tumor Infiltrating Lymphocytes (TILs).
  • TILs Tumor Infiltrating Lymphocytes
  • TILs analyzed by flow cytometry 1) CD8 T cells (CD45 CD8 ), 2) NK cells (CD45 + NK1.1 + ), and 3) Tregs (CD4 + CD25 + FoxP3 + ).
  • FIG. 30 MDNA11 displays extended half-life in mice and NHP.
  • FIG. 31 MDNA11 induces proliferation & expansion of CD4+ T, CD8+ T andNK cells but not Tregs in NHP.
  • Figure 32 Targeting immunologic “cold tumors” by modulation of TME with IL-2/IL-13
  • TME pro-tumoral TME: 1) Low CD8 & NK cell counts; high Treg counts and 2) High number of immune-suppressive myeloid cells (i.e. TAM & MDSC).
  • FIG. 33 Bi-specific MDNA109FEAA-Fc-MDNA413 Superkine induces Thl and reduces Th2 immune responses.
  • Figure 34 Enhanced potency on CD8+ T and NK cells; diminished activity on Tregs - Strong Thl response - MDNA109FEAA-Fc (MDNA11) and MDNA109FEAA-F C-MDNA413 inhibits hIL-4/hIL-13 induced signaling in HEK-Blue reporter cells - Suppression of Th2 response.
  • Figure 35 ELISA assay measuring binding of Fc-hIL13 to various IL13 and IL4 receptors, including human IL13Ra2, mouse IL13Ra2, human IL13Ral, mouse IL13Ral, human IL4R and mouse IL4R.
  • Figure 36A ELISA assay measuring binding of MDNA132-Fc-MDNA109 binding to human IL13Ra2.
  • Figure 36B ELISA assay measuring binding of MDNA132-Fc-MDNA109 binding to mouse IL13Ra2.
  • Figure 37A ELISA assay measuring binding of various fusion protein comprising MDNA413 to human IL13Ral.
  • Figure 37B ELISA assay measuring binding of various fusion protein comprising MDNA413 to mouse IL13Ral.
  • Figure 38A-38B Sensograms of the biacore analysis for Fc-MDNA132 (1 : 1 KIH) as ligand and receptors, IL13Ral and IL13Ra2 as antigens.
  • Figure 39A-39B Sensograms of the biacore analysis for Fc-MDNA413 (1:2) as ligand and receptors, IL13Ral as antigens.
  • Figure 40A-40B Sensograms of the biacore analysis for Fc-MDNA413 (1:2) as ligand and receptors, IL13Ra2 as antigens.
  • Figure 41A-41D Binding affinity to IL13Ral by SPR (MCK, multi-cycle kinetics).
  • Figure 42A-42B pSTAT5 Signaling Assay in Human PBMC.
  • Figure 43A-43C Measurement of pSTAT6 signaling.
  • Figure 44A-44B Macrophage polarization assay.
  • Figure 45A-45E Binding affinity to IL13Ral and IL13Ra2 by SPR (MCK, multi-cycle kinetics).
  • Figure 46A-46C Inhibition of tumor growth in a CT26 colon cancer model by bispecific construct MDNA132-Fc-MDNA109.
  • Figure 47 HEK Blue IL2 Assay.
  • Figure 48 CTTL-2 Assay.
  • Figure 49A-49B HEK Blue IL4 Assay.
  • Figure 50A-50B HEK Blue IL13 Assay.
  • Figure 51A-51D TF-1 Assay.
  • Figure 52A-52B pSTAT5 Assay in human PBMCs.
  • Figure 53A-53D SPR Study.
  • Figure 54A-54J Bispecific sequence information for various construct embodiments.
  • Figure 55 Directed evolution combined with yeast display results in tunable superkines.
  • FIG. 56 MDNA109 is an engineered version of human IL-2 showing enhanced agonist activity.
  • Figure 57 Introduction to long-acting IL-2 superkines.
  • FIG. 58 MDNA11 is a ‘beta-only’ superkine with uniquely enhanced affinity for CD122.
  • FIG. 59 MDNA11 preferentially stimulates immune effector cells.
  • FIG. 60 MDNA11 shows monotherapy anti-tumor efficacy and combination effect with anti -PD 1 in MC38 tumor model.
  • FIG. 61 MDNA11+ anti-CTLA4 induces tumor clearance, protects against, re- challenges, and promotes antigen-specific CD8 T-cells.
  • FIG. 62 MDNA11 induces durable and sustained proliferation and expansion of immune effector cells but not T regs in NHP.
  • Figure 63 Superkine targeted with antibody (STAb) enhances accumulation in tumors.
  • Figure 64 STAb overcomes checkpoint resistance and ‘cold’ tumors.
  • Figure 65 Role of IL-4 and IL-13 receptors in cancer.
  • MDNA132 is an engineered version of human IL-13 targeting tumor specific antigen.
  • FIG. 67 MDNA132 plays a role in localizing T-cell engager and checkpoint inhibitor to tumors.
  • FIG. 68 MDNA413 is an engineered version of human IL-13 showing antagonist activity.
  • Figure 69 Fc-MDNA413 inhibits IL-4 and IL-13 induced signaling and function.
  • Figure 70 Mechanism of action of dual specific cytokine (DUCK Cancer)
  • Figure 71 TF-1 Assay.
  • Figure 73A-73B SPR Study.
  • Figure 74A-74B SPR Study.
  • Figure 75A-75D SPR Study.
  • Figure 76A-76E Inhibition of IL-4 induced M2 polarization.
  • Figure 77A-77E Inhibition of IL-13 induced M2 polarization.
  • IL-2 means wild-type IL-2, whether native or recombinant.
  • Mature human IL-2 occurs as a 133 amino acid sequence (less the signal peptide, consisting of an additional 20 N-terminal amino acids), as described in Fujita, et. al, PNAS USA, 80, 7437-7441 (1983).
  • the amino acid sequence of human IL-2 (SEQ ID NO:l; full length) is found in Genbank under accession locator NP_000577.2.
  • the amino acid sequence of mature human IL-2 is depicted in SEQ ID NO:2 (human wild-type mature; position numbering of the substitutions is based on this sequence).
  • the murine ( Mus musculus) IL-2 amino acid sequence is found in Genbank under accession locator (SEQ ID NO: 3).
  • the amino acid sequence of mature murine IL-2 is depicted in SEQ ID NO: 4.
  • IL-2 mutein means an IL-2 polypeptide wherein specific substitutions to the interleukin-2 protein have been made.
  • the IL-2 muteins are characterized by amino acid insertions, deletions, substitutions and modifications at one or more sites in or at the other residues of the native IL-2 polypeptide chain.
  • any such insertions, deletions, substitutions and modifications result in an IL-2 mutein that retains the IL- 2Eb binding activity.
  • Exemplary muteins can include substitutions of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids.
  • Muteins also include conservative modifications and substitutions at other positions of IL-2 (i.e., those that have a minimal effect on the secondary or tertiary structure of the mutein). Such conservative substitutions include those described by Dayhoff in The Atlas of Protein Sequence and Structure 5 (1978), and by Argos in EMBO J., 8:779-785 (1989).
  • amino acids belonging to one of the following groups represent conservative changes: Group I: ala, pro, gly, gin, asn, ser, thr; Group II: cys, ser, tyr, thr; Group IILval, ile, leu, met, ala, phe; Group IV: lys, arg, his; Group V: phe, tyr, trp, his; and Group VI: asp, glu.
  • “Numbered in accordance with IL-2” means identifying a chosen amino acid with reference to the position at which that amino acid normally occurs in the mature sequence of wild type IL-2, for example
  • R81 refers to the eighty -first amino acid, arginine, that occurs in SEQ ID NO:2.
  • L80 refers to the eightieth amino acid, leucine, that occurs in SEQ ID NO:2.
  • L85 refers to the eighty-fifth amino acid, leucine, that occurs in SEQ ID NO:2.
  • 186 refers to the eighty-sixth amino acid, isoleucine, that occurs in SEQ ID NO:2.
  • 192 refers to the ninety-second amino acid, isoleucine, that occurs in SEQ ID NO:2.
  • F42 refers to the forty-second amino acid, phenylalanine, that occurs in SEQ ID NO:2.
  • K43 refers to the forty-third amino acid, lysine, that occurs in SEQ ID NO:2.
  • Hydrophobic Amino Acid refers to an amino acid exhibiting a hydrophobicity of less than zero according to the normalized consensus hydrophobicity scale of Eisenberg etal,
  • hydrophilic amino acids include Thr (T), Ser (S), His (H), Glu (E), Asn (N), Gin (Q), Asp (D), Lys (K) and Arg (R).
  • cell types having the IL-2Ra.py receptor means the cells known to have this receptor type, i.e., T cells, activated T cells, B cells, activated monocytes, and activated NK cells.
  • cell types having the IL-2RPy receptor means the cells known to have that receptor type, i.e., B cells, resting monocytes, and resting NK cells.
  • identity refers to the subunit sequence identity between two molecules. When a subunit position in both of the molecules is occupied by the same monomeric subunit (i.e., the same amino acid residue or nucleotide), then the molecules are identical at that position.
  • the similarity between two amino acid or two nucleotide sequences is a direct function of the number of identical positions. In general, the sequences are aligned so that the highest order match is obtained. If necessary, identity can be calculated using published techniques and widely available computer programs, such as the GCS program package (Devereux et al, Nucleic Acids Res.
  • Sequence identity can be measured using sequence analysis software such as the Sequence Analysis Software Package of the Genetics Computer Group at the University of Wisconsin Biotechnology Center (1710 University Avenue, Madison, Wis. 53705), with the default parameters thereof.
  • polypeptide refers to any chain of amino acid residues, regardless of its length or post-translational modification (e.g., glycosylation or phosphorylation).
  • mutant IL-2 polypeptides of the disclosure are “substantially pure,” they can be at least about 60% by weight (dry weight) the polypeptide of interest, for example, a polypeptide containing the mutant IL-2 amino acid sequence.
  • the polypeptide can be at least about 75%, about 80%, about 85%, about 90%, about 95% or about 99%, by weight, the polypeptide of interest. Purity can be measured by any appropriate standard method, for example, column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis.
  • An “agonist” is a compound that interacts with a target to cause or promote an increase in the activation of the target.
  • a “partial agonist” is a compound that interacts with the same target as an agonist but does not produce as great a magnitude of a biochemical and/or physiological effect as the agonist, even by increasing the dosage of the partial agonist.
  • a “superagonist” (also referred to as a “superkine”) is a type of agonist that is capable of producing a maximal response greater than the endogenous agonist for the target receptor, and thus has an efficacy of more than 100%.
  • “Operably linked” is intended to mean that the nucleotide sequence of interest (i.e., a sequence encoding an IL-2 mutein) is linked to the regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
  • “Regulatory sequences” include promoters, enhancers, and other expression control elements (e.g., polyadenylation signals). See, for example, Goeddel (1990) in Gene Expression Technology: Methods in Enzymology 185 (Academic Press, San Diego, Calif.).
  • Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cells and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, and the like.
  • the expression constructs of the invention can be introduced into host cells to thereby produce the human IL-2 muteins disclosed herein or to produce biologically active variants thereof.
  • host cell and “recombinant host cell” are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell but are still included within the scope of the term as used herein.
  • transformation and “transfection” refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, particle gun, or electroporation.
  • foreign nucleic acid e.g., DNA
  • a host cell including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, particle gun, or electroporation.
  • the term “pharmaceutically acceptable carrier” includes, but is not limited to, saline, solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration.
  • Supplementary active compounds e.g., antibiotics
  • anti-PD-1 antibody refers to any antibody that binds to PD-1, including inhibitory antibodies.
  • An “anti-PD-1 inhibitor” refers to an inhibitor that binds to and inhibits PD-1.
  • Such anti-PD-1 antibodies and/or inhibitors include but are not limited to nivolumab, BMS-936558, MDX-1106, ONO-4538, AMP224, CT-011, and MK-3475, among others.
  • cancer or “cancerous”
  • hyperproliferative or “hyperproliferative”
  • neoplastic to refer to cells having the capacity for autonomous growth (i.e., an abnormal state or condition characterized by rapidly proliferating cell growth).
  • hyperproliferative and neoplastic disease states may be categorized as pathologic (i.e., characterizing or constituting a disease state), or they may be categorized as non-pathologic (i.e., as a deviation from normal but not associated with a disease state).
  • pathologic i.e., characterizing or constituting a disease state
  • non-pathologic i.e., as a deviation from normal but not associated with a disease state.
  • the terms are meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transformed cells, tissues, or organs, irrespective of histopathologic type or stage of invasiveness.
  • “Pathologic hyperproliferative” cells occur in disease states characterized by malignant tumor growth. Examples of non-pathologic hyperproliferative cells include proliferation of cells associated with wound repair.
  • the terms “cancer” or “neoplasm” are used to refer to malignancies of the various organ systems, including those affecting the lung, breast, thyroid, lymph glands and lymphoid tissue, reproductive systems, gastrointestinal organs, and the genitourinary tract, as well as to adenocarcinomas which are generally considered to include malignancies such as most colon cancers, renal-cell carcinoma, prostate cancer and/or testicular tumors, non-small cell carcinoma of the lung, cancer of the small intestine and cancer of the esophagus.
  • Cancers generally can include prostate cancer, ovarian cancer, breast cancer, endometrial cancer, multiple myeloma, melanoma, lymphomas, lung cancers including small cell lung cancer, kidney cancer, colorectal cancer, pancreatic cancer, gastric cancer, and brain cancer.
  • carcinoma is art-recognized and refers to malignancies of epithelial or endocrine tissues including respiratory system carcinomas, gastrointestinal system carcinomas, genitourinary system carcinomas, testicular carcinomas, breast carcinomas, prostatic carcinomas, endocrine system carcinomas, and melanomas.
  • An “adenocarcinoma” refers to a carcinoma derived from glandular tissue or in which the tumor cells form recognizable glandular structures.
  • hematopoietic neoplastic disorders refers to diseases involving hyperplastic/neoplastic cells of hematopoietic origin, e.g., arising from myeloid, lymphoid or erythroid lineages, or precursor cells thereof.
  • the diseases arise from poorly differentiated acute leukemias (e.g., erythroblastic leukemia and acute megakaryoblastic leukemia).
  • Additional exemplary myeloid disorders include, but are not limited to, acute promyeloid leukemia (APML), acute myelogenous leukemia (AML) and chronic myelogenous leukemia (CML) (reviewed in Vaickus, L. (1991) Crit Rev.
  • lymphoid malignancies include, but are not limited to acute lymphoblastic leukemia (ALL) which includes B-lineage ALL and T-lineage ALL, chronic lymphocytic leukemia (CLL), prolymphocytic leukemia (PLL), hairy cell leukemia (HLL) and Waldenstrom's macroglobulinemia (WM).
  • ALL acute lymphoblastic leukemia
  • CLL chronic lymphocytic leukemia
  • PLL prolymphocytic leukemia
  • HLL hairy cell leukemia
  • WM Waldenstrom's macroglobulinemia
  • malignant lymphomas include, but are not limited to non-Hodgkin lymphoma and variants thereof, peripheral T cell lymphomas, adult T cell leukemia/lymphoma (ATL), cutaneous T cell lymphoma (CTCL), large granular lymphocytic leukemia (LGF), Hodgkin's disease and Reed-Stemberg disease.
  • ATL adult T cell leukemia/lymphoma
  • CCL cutaneous T cell lymphoma
  • LGF large granular lymphocytic leukemia
  • Hodgkin's disease Reed-Stemberg disease.
  • treatment refers to obtaining a desired pharmacologic and/or physiologic effect.
  • the effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease.
  • Treatment covers any treatment of a disease in a mammal, particularly in a human, and includes: (a) preventing the disease from occurring in a subject predisposed to the disease or at risk of acquiring the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development; and (c) relieving the disease, i.e., causing regression of the disease.
  • a therapeutically effective amount can be an amount that reduces tumor number, tumor size, and/or increases survival.
  • the terms “individual,” “subject,” and “patient” are used interchangeably herein, and refer to a mammal, including, but not limited to, human and non-human primates, including simians and humans; mammalian sport animals (e.g., horses); mammalian farm animals (e.g., sheep, goats, etc.); mammalian pets (dogs, cats, etc.); and rodents (e.g., mice, rats, etc.).
  • pharmaceutically acceptable and “physiologically acceptable” mean a biologically acceptable formulation, gaseous, liquid or solid, or mixture thereof, suitable for one or more routes of administration, in vivo delivery or contact.
  • a “pharmaceutically acceptable” or “physiologically acceptable” composition is a material that is not biologically or otherwise undesirable, e.g., the material may be administered to a subject without causing substantial undesirable biological effects.
  • a pharmaceutical composition may be used, for example in administering an IL-2 mutein to a subject.
  • an IL-2 mutein comprising the substitutions L80F, R81D, L85V, I86V, and I92F is administered in combination with anti-PD-1 to a subject with cancer.
  • the IL-2 mutein administered further comprises a substitution at position F42A.
  • the IL-2 administered mutein further comprises a substitution at position K43N.
  • a “unit dosage form” as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity optionally in association with a pharmaceutical carrier (excipient, diluent, vehicle or fdling agent) which, when administered in one or more doses, produces a desired effect (e.g., prophylactic or therapeutic effect).
  • a pharmaceutical carrier excipient, diluent, vehicle or fdling agent
  • the therapeutic effect is to reduce tumor number.
  • the therapeutic effect is to reduce tumor size.
  • the therapeutic effect is to increase survival.
  • unit dosage forms may be within, for example, ampules and vials, including a liquid composition, or a composition in a freeze-dried or lyophilized state; a sterile liquid carrier, for example, can be added prior to administration or delivery in vivo.
  • IL-2 muteins in combination with anti-PD-1 antibodies, and pharmaceutical compositions thereof can be packaged in a single or multiple unit dosage form for ease of administration and uniformity of dosage.
  • a “therapeutically effective amount” will fall in a relatively broad range determinable through experimentation and/or clinical trials.
  • injection directly into the tissue or vasculature of a subject for example, liver tissue or veins.
  • an “effective amount” or “sufficient amount” refers to an amount providing, in single or multiple doses, alone or in combination, with one or more other compositions (therapeutic agents such as a drug), treatments, protocols, or therapeutic regimens agents (including, for example, vaccine regimens), a detectable response of any duration of time (long or short term), an expected or desired outcome in or a benefit to a subject of any measurable or detectable degree or for any duration of time (e.g., for minutes, hours, days, months, years, or cured).
  • an “effective amount” or “sufficient amount” for treatment typically are effective to provide a response to one, multiple or all adverse symptoms, consequences or complications of the disease, one or more adverse symptoms, disorders, illnesses, pathologies, or complications, for example, caused by or associated with the disease, to a measurable extent, although decreasing, reducing, inhibiting, suppressing, limiting or controlling progression or worsening of the disease is also a satisfactory outcome.
  • the effective amount is an amount sufficient to reduce tumor number.
  • the effective amount is an amount sufficient to reduce tumor size.
  • the effective amount is an amount sufficient to increase survival.
  • “Prophylaxis” and grammatical variations thereof mean a method in which contact, administration or in vivo delivery to a subject is prior to disease. Administration or in vivo delivery to a subject can be performed prior to development of an adverse symptom, condition, complication, etc. caused by or associated with the disease.
  • a screen e.g., genetic
  • the subject may not manifest the disease.
  • Such subjects therefore include those screened positive for an insufficient amount or a deficiency in a functional gene product (protein), or producing an aberrant, partially functional or non-functional gene product (protein), leading to disease; and subjects screening positive for an aberrant, or defective (mutant) gene prod]uct (protein) leading to disease, even though such subjects do not manifest symptoms of the disease.
  • bispecific IL-2 cytokine fusions which comprise an IL-2 mutein fused to a second cytokine.
  • IL-2 muteins comprising the substitutions L80F, R81D, L85V, I86V, and I92F, which have an increased binding capacity for IL- 2RP receptor, which can be included in the bispecific IL-2 cytokine fusions.
  • uses of bispecific IL-2 cytokine fusions for use in monotherapies as well as in combination treatments with anti-PD-1 antibodies.
  • the IL-2 mutein comprising L80F, R81D, L85V, I86V and I92F, numbered in accordance with wild-type human IL-2 (SEQ ID NO:2; wild-type hIL-2) is referred to as H9.
  • Such IL-2 muteins find use, for example, when combined with anti-PD-1 antibodies for the treatment of cancer.
  • the substituted amino acid residue(s) can be, but are not necessarily, conservative substitutions, which typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. These mutations can be at amino acid residues that contact the IL-2RP and/or the IL-2Ry.
  • a mutation (whether conservative or non-conservative, by way of addition(s) or deletion(s)) can be made at one or more of positions.
  • the mutation can be: I24V, P65H, Q74R, Q74 H, Q74N, Q74S, L80F, L80V, R81I, R81T, R81D, L85V, I86V, I89V, I92F, V93I.
  • sequences of exemplary IL-2 muteins are as follows: 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; B11 SEQ ID NO: 10; C5 SEQ ID NO: 11 ; D10 SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • the substitutions in the IL-2 mutein comprise L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises Y45A substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the substitutions in the IL-2 mutein comprise F42A, L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the substitutions in the IL-2 mutein comprise F42A, Y45A, L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO:2.
  • the substitutions in the IL-2 mutein comprise F42A, E62A, L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the substitutions in the IL-2 mutein comprise F42A, Y45A, E62A, L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the substitutions in the IL-2 mutein comprise E62A, L80F, R81D, L85V,
  • the substitutions in the IL-2 mutein comprise Y45A, E62A, L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the substitutions in the IL-2 mutein comprise Y45A adn E62A , numbered in accordance with wild-type human IL-2 of SEQ ID NO: 2.
  • the substitutions in the IL-2 mutein that lead to increased and/or enhanced IL-2R ⁇ 5 binding include L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO: 2.
  • an IL-2 mutein for use in the invention comprises L80F, R81D, L85V, I86V, and I92F and exhibits increased IE-2Eb binding.
  • an IL-2 mutein for use in the invention further comprises a substitution at position F42A.
  • the IL-2 mutein for use in the invention further comprises a substitution at position K43N.
  • the mutein comprises substitutions L80F, R81D, L85V, I86V, and I92F, and one or more substitutions selected from the group consisting of F42A, Y45A, and E62A, all as compared to wild-type human IL-2 (SEQ ID NO:2).
  • the amino acid substitutions increasing IE-2Eb binding affinity include: L80F, R81D, L85V, I86V, and I92F. In some embodiments, the amino acid substitutions that increase IE-2Eb binding affinity include: L80F, R81D, L85V, I86V, and I92F.
  • the subject IL-2 mutein having a greater binding affinity for IE-2Eb as compared to wild-type human IL-2 includes the amino acid substitutions L80F, R81D, L85V, I86V, and I92F.
  • the IL-2 mutein has the amino acid sequence: APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEE ELKPLEEVLNLAOSKNFHFDPRDVVSNINVFVLELKGSETTFMCEYADETATIVEFLNRWI TFCQSIISTLT (SEQ ID NO: 5; H9 as used in Example 1).
  • the IL-2 mutein has increased capabilities to stimulate one or more signaling pathways that are dependent on IL-2R ⁇ /IL-2Ry c heterodimeri/ation.
  • the subject IL-2 mutein has an enhanced capability to stimulate STAT5 phosphorylation in an IL-2R ⁇ + cell as compared to wild-type human IL-2.
  • the IL-2 mutein stimulates STAT5 phosphorylation in an IL-2R ⁇ + cell at a level that is 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more of the level that wild-type IL-2 stimulates STAT5 phosphorylation in the same cell.
  • the IL-2 mutein stimulates STAT5 phosphorylation in an IL-2R ⁇ + cell at a level that is 105%, 110%, 115%, 120%, 125%, 130%, 135%, 140%, 145%, 150%, 155%, 160%, 165%, 170%, 175%, 180%, 185%, 190%, 195% or more as compared to the level that wild-type IL-2 stimulates STAT5 phosphorylation in the same cell.
  • the IL-2RP+ cell is a T cell.
  • the T cell is a CD8+ T cell.
  • the CD8+ T cell is a freshly isolated CD8+ T cell.
  • the CD8+ T cell T cell is an activated CD8+ T cell.
  • the IL-2R ⁇ + cell is a natural killer (NK) cell.
  • the IL-2 mutein comprises substitutions L80F, R81D, L85V, I86V, and I92F, as compared to wild-type human IL-2 (SEQ ID NO:2).
  • the mutein has an enhanced capability to stimulate ERK1/ERK2 signaling in an IL-2Rb+ cell as compared to wild-type human IL-2.
  • the IL-2 mutein stimulates pERKl/ERK2 signaling in an IL-2Rb+ cell at a level that is 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more of the level that wild-type IL-2 stimulates pERKl/ERK2 signaling in the same cell.
  • the IL-2 mutein stimulates pERKl/ERK2 phosphorylation in an I ⁇ -2Eb+ cell at a level that is 105%, 110%, 115%, 120%, 125%, 130%, 135%, 140%, 145%,
  • the IL-2Rb+ cell is a T cell.
  • the T cell is a CD8+ T cell.
  • the CD8+ T cell is a freshly isolated CD8+ T cell. In other embodiments, the CD8+ T cell T cell is an activated CD8+ T cell. In other embodiments, the IL-2Rb+ cell is a natural killer (NK) cell. In some embodiments, the IL-2 mutein comprises substitutions L80F, R81D, L85V, I86V, and I92F, as compared to wild-type human IL-2 (SEQ ID NO:2).
  • STAT5 and ERK1/2 signaling can be measured, for example, by phosphorylation of STAT5 and ERK1/2 using any suitable method known in the art.
  • STAT5 and ERK1/2 phosphorylation can be measured using antibodies specific for the phosphorylated version of these molecules in combination with flow cytometry analysis as described herein.
  • the mutein has an enhanced capability to stimulate PI 3-kinase signaling in a IE-2Eb+ cell as compared to wild-type human IL-2.
  • the IL-2 mutein stimulates PI 3-kinase signaling in an IR-2Eb+ cell at a level that is 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%,
  • the IL-2 mutein stimulates PI 3-kinase signaling in an IR-2Eb+ cell at a level that is 105%, 110%, 115%, 120%, 125%, 130%, 135%, 140%, 145%, 150%, 155%, 160%, 165%, 170%, 175%, 180%, 185%, 190%, 195% or more as compared to the level that wild-type IL-2 stimulates PI 3-kinase signaling phosphorylation in the same cell.
  • the IL-2R ⁇ $+ cell is a T cell.
  • the T cell is a CD8+ T cell.
  • the CD8+ T cell T cell is an activated CD8+ T cell.
  • the IL-2R ⁇ $+ cell is a natural killer (NK) cell.
  • the IL-2 mutein comprises substitutions L80F, R81D, L85V, I86V, and I92F, as compared to wild-type human IL-2 (SEQ ID NO:2).
  • PI3-kinase signaling can be measured using any suitable method known in the art. For example, PI 3 -kinase signaling can be measured using antibodies that are specific for phospho-S6 ribosomal protein in conjunction with flow cytometry analysis as described herein.
  • the IL-2 mutein is a stimulator of IL-2 and/or IL-15 STAT5 phosphorylation in CD8+ T cells.
  • the mutein is a promoter of IL-2 and/or IL-15 induced proliferation of CD8+ T cells.
  • the mutein is a stimulator of IL-2 dependent, TCR-induced cell proliferation.
  • the IL-2 mutein comprises substitutions L80F, R81D, L85V, I86V, and I92F, as compared to wild-type human IL-2 (SEQ ID NO:2).
  • IL-2 promotes Thl, Th9, and Treg T cell differentiation and inhibits Thl7 differentiation. Therefore, without being bound by any particular theory of operation, it is believed that IL-2 muteins that function as IL-2 superagonists are capable of promoting Thl, Th9, and/or Treg cell differentiation or inhibiting Thl 7 cell differentiation.
  • the IL-2 mutein is a promoter of IL-2 dependent Thl, Th9 and/or Treg differentiation.
  • the mutein is an inhibitor of Thl 7 differentiation.
  • the IL-2 mutein comprises substitutions L80F, R81D, L85V, I86V, and I92F, as compared to wild-type human IL-2 (SEQ ID NO:2).
  • the IL-2 mutein signals less and/or independently of CD25 (for example, has reduced or ablated CD25 binding) as compared to wild-type human IL-2.
  • the reduced and/or independent signaling with regard to CD25 allows for preferential activation of effector T-cells while limiting the stimulation of Tregs.
  • the reduced and/or independent signaling with regard to CD25 allows for reduced toxicity.
  • the mutein comprises substitutions L80F, R81D, L85V, I86V, and I92F, and one or more substitutions selected from the group consisting of F42A, Y45A, and E62A, all as compared to wild-type human IL-2 (SEQ ID NO:2).
  • the IL-2 mutein is capable of increasing and/or restoring responsiveness to anergic NK cells.
  • the IL-2 mutein is capable of increasing and/or restoring responsiveness to anergic NK cells in the tumor microenvironment.
  • the IL-2 mutein comprises substitutions L80F, R81D, L85V, I86V, and I92F, as compared to wild-type human IL-2 (SEQ ID NO:2).
  • the mutein is an inhibitor an inhibitor of IL-2 dependent activation of natural killer (NK) cells.
  • IL-2 activation of NK cells can be measured by any suitable method known in the art, for example, by measuring IL-2 induced CD69 expression and/or cytotoxicity, as described herein.
  • an increase in IL-2RP binding affinity is any binding affinity for IL-2RP that is greater than the wild-type human IL-2 binding affinity for IL-2Rp.
  • the binding affinity is a 2-fold, 5-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60- fold, 70-fold, 80-fold, 90-fold, 100-fold, 120-fold, 150-fold, 170-fold, 190-fold, 200-fold, 220-fold, 240-fold or more increase in binding affinity for IL-2R]3 as compared to the wild-type human IL-2 binding affinity for IL-2R]3.
  • an increase in binding capacity for IL-2R ⁇ is any binding capacity for IL-2R]3 that is greater than the wild-type human IL-2 binding capacity for IL-2Rp.
  • the binding capacity is a 2-fold, 5-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50- fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold, 120-fold, 150-fold, 170-fold, 190-fold, 200-fold, 220-fold, 240-fold or more increase in binding capacity for IL-2R]3 as compared to the wild-type human IL-2 binding capacity for IL-2R ⁇ .
  • the subject IL-2 mutein having a greater binding affinity for IL-2R ⁇ as compared to wild-type human IL-2 also exhibits reduced binding to CD25 and includes the amino acid substitutions F42A, L80F, R81D, L85V, I86V, and I92F.
  • the reduce binding affinity is about 220-fold, i.e., from about Kd of 6.6 nM for wild-type human IL-2 to about 1.4 mM for the mutein comprising F42A, L80F, R81D, L85V, I86V, and I92F.
  • the IL-2 mutein has the amino acid sequence:
  • the subject IL-2 mutein having a greater binding affinity for IL-2R ⁇ as compared to wild-type human IL-2 also exhibits reduced binding to CD25 and includes the amino acid substitutions K43N, L80F, R81D, L85V, I86V, and I92F.
  • the reduce binding affinity is due to allowing for glycosylation at position 43 with the K43N substitution.
  • CD25 binding is reduced and/or ablated in the IL-2 mutein comprising the amino acid substitutions K43N, L80F, R81D, L85V, I86V, and I92F.
  • the IL-2 mutein has the amino acid sequence:
  • a reduction in binding affinity for CD25 is any binding affinity for CD25 that is less than the wild-type human IL-2 binding affinity.
  • the binding affinity is a 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90- fold, 100-fold, 120-fold, 150-fold, 170-fold, 190-fold, 200-fold, 220-fold, 240-fold or more decrease in binding affinity for CD25 as compared to the wild-type human IL-2 binding affinity for CD25.
  • the subject IL-2 mutein having a greater binding affinity for I ⁇ -2Eb and a reduced binding affinity for CD25 as compared to wild-type human IL-2 includes the amino acid substitutions F42A, Y45A L80F, R81D, L85V, I86V, and I92F.
  • the IL-2 mutein has the amino acid sequence:
  • the subject IL-2 mutein having a greater binding affinity for I ⁇ -2Eb and a reduced binding affinity for CD25 as compared to wild-type human IL-2 includes the amino acid substitutions F42A, E62A L80F, R81D, L85V, I86V, and I92F.
  • the IL-2 mutein has the amino acid sequence:
  • the subject IL-2 mutein having a greater binding affinity for IL-2R ⁇ and a reduced binding affinity for CD25 as compared to wild-type human IL-2 includes the amino acid substitutions F42A, Y45A, E62A, L80F, R81D, L85V, I86V, and I92F.
  • the IL-2 mutein has the amino acid sequence:
  • the IL-2 mutein sequence is 90% identical to any one of SEQ ID NO:2 or SEQ ID NO:6 through SEQ ID NO: 10 or SEQ ID NO: 16. In some embodiments, the IL-2 mutein sequence is 95% identical to any one of SEQ ID NO:2 or SEQ ID NO: 6 through SEQ ID NO: 10. In some embodiments, the IL-2 mutein sequence is 98% identical to any one of SEQ ID NO:2 or SEQ ID NO:6 through SEQ ID NO: 10. In some embodiments, the IL-2 mutein sequence is 99% identical to any one of SEQ ID NO:2 or SEQ ID NO:6 through SEQ ID NO: 10.
  • the IL-2 muteins can be prepared as fusion or chimeric polypeptides that include a subject IL-2 mutein and a heterologous polypeptide (i.e., a polypeptide that is not IL-2 or a mutant thereof) (see, e.g.. U.S. Pat. No. 6,451,308), including for example, bispecific IL-2 cytokine fusions.
  • a heterologous polypeptide i.e., a polypeptide that is not IL-2 or a mutant thereof
  • Exemplary heterologous polypeptides can increase the circulating half-life of the chimeric polypeptide in vivo, and may, therefore, further enhance the properties of the mutant IL-2 polypeptides.
  • the polypeptide that increases the circulating half-life may be a serum albumin, such as human serum albumin, PEG, PEG-derivatives, or the Fc region of the IgG subclass of antibodies that lacks the IgG heavy chain variable region.
  • exemplary Fc regions can include a mutation that inhibits complement fixation and Fc receptor binding, or it may be lytic, i.e., able to bind complement or to lyse cells via another mechanism, such as antibody-dependent complement lysis (ADCC; USSN 08/355,502 filed Dec. 12, 1994).
  • the “Fc region” can be a naturally occurring or synthetic polypeptide that is homologous to the IgG C-terminal domain produced by digestion of IgG with papain.
  • IgG Fc has a molecular weight of approximately 50 kDa.
  • the mutant IL-2 polypeptides can include the entire Fc region, or a smaller portion that retains the ability to extend the circulating half-life of a chimeric polypeptide of which it is a part.
  • full-length or fragmented Fc regions can be variants of the wild-type molecule.
  • the IL-2 mutein fusion protein (e.g., an IL-2 mutein as described herein) includes an IgGl, IgG2, IgG3, or IgG4 Fc region (see, for example, sequences in Figure 2A-2B).
  • the Fc region comprises the substitution N297A.
  • the IL-2 mutein is linked directly or indirectly to the heterologous fusion polypeptide.
  • the IL-2 mutein is linked directly to the Fc region. In some embodiments, the IL-2 mutein is linked to the Fc region via a linker peptide, such as GGGGS. In some embodiments, the linker is (GGGGS)/?. wherein n is an integer between 1 and 10. In some embodiments, the linker is GGGGS. In some embodiments, the linker is GGGGSGGGGS (SEQ ID NO: 16). In some embodiments, the linker is GGGGS GGGGS GGGGS (SEQ ID NO: 17). In some embodiments, the linker is GGGGS GGGGS GGGGS GGGGS (SEQ ID NO: 18).
  • the linker is GGGGS GGGGS GGGGS GGGGS (SEQ ID NO: 19).
  • the linker cotains one or more protease cleavge sites (e.g., is a protease cleavable linke).
  • Linkers additionally can contain one or more protease cleavage sites or be sensitive to cleavage via oxidation and/or reduction.
  • a linker may comprise disulfide bonds (for example, the disulfide bonds on a cysteine molecule).
  • a linker may comprise a protease-cleavable Val- Cit (VC) linker, a Phe-Arg linker, a Val-Lys linker, a Val-Ala linker, a Val-Arg linker, a Val-Leu- Lys linker, a Gly-Phe-Leu-Gly linker, an Ala-Phe-Lys linker, a pol-L-lysine linker, a beta- Ala-Leu- Ala-Leu linker, an Arg-Arg-Ala-Leu- Ala-Leu linker, a peptidomimetic linker, a legumain- cleavable Ala-Ala- Asn tripeptide linker, a peptide linker that is cleaved by cathepsin B and other lysosomal proteases, such as Gly-Phe-Leu-Gly and Ala-Leu- Ala-Leu,
  • linkers disclosed in Poreba, M, FEES J. 287(10): 1936-1969 (2020), incorporated by reference herein, are contemplated by the present disclosure. Since many tumors naturally release high levels of glutathione (a reducing agent) this can reduce the disulfide bonds with subsequent release of the cargo moiety at the site of delivery.
  • the linkers is a protease-cleavable linkers is a linker cleavable by a matrix metalloprotease (MMP). MMPs are overexpressed in situ at tumors, and linkers cleavable in such contexts are contemplated by the presentation disclosure.
  • MMPs matrix metalloprotease
  • the MMP linker sequence is selected from the group consisting of SGARYRWLTA (SEQ ID NO: 234), SGRSYAILTA(SEQ ID NO: 235), SRSGRSPAIFTATG (SEQ ID NO: 236), GSSGRSPAIFTAGS (SEQ ID NO: 237), and SGFIANPVTA (SEQ ID NO: 238).
  • the MMP linker sequence is SGARYRWLTA.
  • the MMP linker sequence is SGRSYAILTA.
  • the MMP linker sequence is SRSGRSPAIFTATG.
  • the MMP linker sequence is GSSGRSPAIFTAGS.
  • the MMP linker sequence is SGFIANPVTA.
  • the Fc region can be “lytic” or “non-lytic,” but is typically non-lytic.
  • a non-lytic is typically non-lytic.
  • the Fc region typically lacks a high affinity Fc receptor binding site and a C'lq binding site.
  • the high affinity Fc receptor binding site of murine IgG Fc includes the Leu residue at position 235 of IgG Fc.
  • the Fc receptor binding site can be destroyed by mutating or deleting Leu 235.
  • substitution of Glu for Leu 235 inhibits the ability of the Fc region to bind the high affinity Fc receptor.
  • the murine C'lq binding site can be functionally destroyed by mutating or deleting the Glu 318, Lys 320, and Lys 322 residues of IgG.
  • a lytic IgG Fc region has a high affinity Fc receptor binding site and a C'lq binding site.
  • the high affinity Fc receptor binding site includes the Leu residue at position 235 of IgG Fc
  • the C'lq binding site includes the Glu 318, Lys 320, and Lys 322 residues of IgGl.
  • Lytic IgG Fc has wild-type residues or conservative amino acid substitutions at these sites. Lytic IgG Fc can target cells for antibody dependent cellular cytotoxicity or complement directed cytolysis (CDC). Appropriate mutations for human IgG are also known (see, e.g., Morrison et al., The Immunologist 2:119-124, 1994; and Brekke et al, The Immunologist 2: 125, 1994).
  • the chimeric polypeptide can include a subject IL-2 mutein and a polypeptide that functions as an antigenic tag, such as a FLAG sequence.
  • FLAG sequences are recognized by biotinylated, highly specific, anti-FLAG antibodies, as described herein (see also Blanar et al, Science 256:1014, 1992; LeClair et al, Proc. Natl. Acad. Sci. USA 89:8145, 1992).
  • the chimeric polypeptide further comprises a C-terminal c-myc epitope tag.
  • the chimeric polypeptide includes the mutant IL-2 polypeptide and a heterologous polypeptide that functions to enhance expression or direct cellular localization of the mutant IL-2 polypeptide, such as the Aga2p agglutinin subunit (see, e.g., Boder and Wittrup, Nature Biotechnol. 15:553-7, 1997).
  • a heterologous polypeptide that functions to enhance expression or direct cellular localization of the mutant IL-2 polypeptide, such as the Aga2p agglutinin subunit (see, e.g., Boder and Wittrup, Nature Biotechnol. 15:553-7, 1997).
  • a chimeric polypeptide including a mutant IL-2 and an antibody or antigen-binding portion thereof can be generated.
  • the antibody or antigen-binding component of the chimeric protein can serve as a targeting moiety. For example, it can be used to localize the chimeric protein to a particular subset of cells or target molecule. Methods of generating cytokine-antibody chimeric polypeptides are described, for example, in U.S. Pat. No. 6,617,135.
  • the chimeric polypeptide comprises a fusion to an antibody or an antigen-binding portion thereof that disrupts the interaction between the PD-1 receptor and its ligand, PD-L1, and/or is an antibody to a component of the PD-1/PD-L1 signaling pathway.
  • Antibodies known in the art which bind to PD-1 and disrupt the interaction between the PD-1 and its ligand, PD-L1, and stimulate an anti -tumor immune response, are suitable for use in the chimeric polypeptides disclosed herein.
  • the antibody or antigen-binding portion thereof binds specifically to PD-1.
  • antibodies that target PD-1 and which can find used in the present invention include, e.g., but are not limited to nivolumab (BMS-936558, Bristol-Myers Squibb), pembrolizumab (lambrolizumab, MK03475 or MK-3475, Merck), humanized anti-PD-1 antibody JS001 (ShangHai JunShi), monoclonal anti-PD-1 antibody TSR-042 (Tesaro, Inc.), Pidilizumab (anti-PD-1 mAh CT-011, Medivation), anti-PD-1 monoclonal Antibody BGB-A317 (BeiGene), and/or anti-PD-1 antibody SHR-1210 (ShangHai HengRui), human monoclonal antibody REGN2810 (cemiplimab, Regeneron), human monoclonal antibody MDX- 1106 (Bristol-Myers Squibb), and/or humanized anti-PD-1 IgG4 antibody PDR001
  • the PD-1 antibody is from clone: RMPl-14 (rat IgG) - BioXcell cat# BP0146.
  • Other suitable antibodies include anti-PD-1 antibodies disclosed in U.S. Patent No. 8,008,449, herein incorporated by reference.
  • the antibody or antigen-binding portion thereof binds specifically to PD-L1 and inhibits its interaction with PD-1, thereby increasing immune activity. Any antibodies known in the art which bind to PD-L1 and disrupt the interaction between the PD-1 and PD-L1, and stimulates an anti-tumor immune response, are suitable for use in the chimeric polypeptides disclosed herein.
  • antibodies that target PD-L1 and are in clinical trials include BMS-936559 (Bristol-Myers Squibb) and MPDL3280A (Genetech).
  • BMS-936559 Bristol-Myers Squibb
  • MPDL3280A Genetech
  • Other suitable antibodies that target PD-L1 are disclosed in U.S. Patent No. 7,943,743, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to PD-1 or PD-L1, disrupts the PD-1/PD-L1 interaction, and stimulates an anti -tumor immune response, is suitable for use in the chimeric polypeptides disclosed herein.
  • the chimeric polypeptide comprises a fusion to an anti-PD-1 antibody.
  • the chimeric polypeptide comprises a fusion to an anti-PD-Ll antibody.
  • the chimeric polypeptide comprises a fusion to an antibody or an antigen-binding portion thereof that targets CTLA-4 and disrupts its interaction with CD80 and CD86.
  • exemplary antibodies that target CTLA-4 include ipilimumab (MDX-010, MDX-101, Bristol-Myers Squibb), which is FDA approved, and tremelimumab (ticilimumab, CP-675, 206, Pfizer), currently undergoing human trials.
  • Other suitable antibodies that target CTLA-4 are disclosed in WO 2012/120125, U.S. Patents No. 6,984720, No. 6,682,7368, and U.S.
  • the chimeric polypeptide comprises a fusion to an anti-CTLA-4 antibody.
  • the chimeric polypeptide comprises a fusion to an antibody or an antigen- binding portion thereof that targets LAG-3 and disrupts its interaction with MHC class II molecules.
  • An exemplary antibody that targets LAG-3 is IMP321 (Immutep), currently undergoing human trials.
  • Other suitable antibodies that target LAG-3 are disclosed in U.S. Patent Application 2011/0150892, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to LAG-3, disrupts its interaction with MHC class II molecules, and stimulates an anti-tumor immune response, is suitable for use in the chimeric polypeptides disclosed herein.
  • the chimeric polypeptide comprises a fusion to an anti-LAG-3 antibody.
  • the chimeric polypeptide comprises a fusion to an antibody or an antigen- binding portion thereof that targets B7-H3 or B7-H4.
  • the B7 family does not have any defined receptors but these ligands are upregulated on tumor cells or tumor-infiltrating cells.
  • exemplary antibody that targets B7-H3 is MGA271 (Macrogenics) is currently undergoing human trials.
  • Other suitable antibodies that target B7 family members are disclosed in U.S. Patent Application 2013/0149236, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to B7-H3 or H4, and stimulates an anti -tumor immune response, is suitable for use in the chimeric polypeptides disclosed herein.
  • the chimeric polypeptide comprises a fusion to an anti- B7-H3 or B7-H4 antibody.
  • the chimeric polypeptide comprises a fusion to an antibody or an antigen-binding portion thereof that targets TIM-3 and disrupts its interaction with galectin 9.
  • Suitable antibodies that target TIM-3 are disclosed in U.S. Patent Application 2013/0022623, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to TIM-3, disrupts its interaction with galectin 9, and stimulates an anti-tumor immune response, is suitable for use in the chimeric polypeptides disclosed herein.
  • the chimeric polypeptide comprises a fusion to an anti- TIM-3 antibody.
  • the chimeric polypeptide comprises a fusion to an antibody or an antigen-binding portion thereof that targets 4-1BB/CD137 and disrupts its interaction with CD137L. It will be understood by one of ordinary skill that any antibody which binds to 4- 1BB/CD137, disrupts its interaction with CD137L or another ligand, and stimulates an anti-tumor immune response or an immune stimulatory response that results in anti-tumor activity overall, is suitable for use in the chimeric polypeptides disclosed herein. In some embodiments, the chimeric polypeptide comprises a fusion to an anti-4-lBB/CD137 antibody.
  • the chimeric polypeptide comprises a fusion to an antibody or an antigen-binding portion thereof that targets GITR and disrupts its interaction with its ligand. It will be understood by one of ordinary skill that any antibody which binds to GITR, disrupts its interaction with GITRL or another ligand, and stimulates an anti -tumor immune response or an immune stimulatory response that results in anti-tumor activity overall, is suitable for use in the chimeric polypeptides disclosed herein. In some embodiments, the chimeric polypeptide comprises a fusion to an anti-GITR antibody. [00188] In some embodiments, the chimeric polypeptide comprises a fusion to an antibody or an antigen-binding portion thereof that targets 0X40 and disrupts its interaction with its ligand.
  • the chimeric polypeptide comprises a fusion to an anti-OX40 antibody.
  • the chimeric polypeptide comprises a fusion to an antibody or an antigen-binding portion thereof that targets CD40 and disrupts its interaction with its ligand.
  • the chimeric polypeptide comprises a fusion to an anti-CD40 antibody
  • the chimeric polypeptide comprises a fusion to an antibody or an antigen-binding portion thereof that targets ICOS and disrupts its interaction with its ligand. It will be understood by one of ordinary skill that any antibody which binds to ICOS, disrupts its interaction with its ligand, and stimulates an anti-tumor immune response or an immune stimulatory response that results in anti-tumor activity overall, is suitable for use in the chimeric polypeptides disclosed herein. In some embodiments, the chimeric polypeptide comprises a fusion to an anti-ICOS antibody.
  • the chimeric polypeptide comprises a fusion to an antibody or an antigen-binding portion thereof that targets CD28 and disrupts its interaction with its ligand.
  • the chimeric polypeptide comprises a fusion to an anti-CD28 antibody.
  • the chimeric polypeptide comprises a fusion to an antibody or an antigen-binding portion thereof that targets IFNa and disrupts its interaction with its ligand. It will be understood by one of ordinary skill that any antibody which binds to IFNa, disrupts its interaction with its ligand, and stimulates an anti-tumor immune response or an immune stimulatory response that results in anti-tumor activity overall, is suitable for use in the chimeric polypeptides disclosed herein. In some embodiments, the chimeric polypeptide comprises a fusion to an anti-IFNa antibody.
  • the chimeric polypeptide comprises a fusion to a tumor antigen or polypeptide targeting a tumor antigen.
  • tumor antigens allow for distinguishing the tumor cells from their normal cellular counterparts and can include, for example, tumor-specific antigens (TSA) as well as tumor-associated antigens (TAA).
  • TSA tumor-specific antigens
  • TAA tumor-associated antigens
  • a tumor antigen is a protooncogene and/or a tumor suppressor, as well as overexpressed or aberrantly expressed cellular proteins, tumor antigens produced by oncogenic viruses, oncofetal antigens, altered cell surface glycolipids and glycoproteins, and/or cell type-specific differentiation antigens.
  • Such tumor antigens can include melanoma antigens, cancer-testis antigens, epithelial tumor antigens, cell cycle regulatory proteins, prostate specific antigens (including prostate carcinoma antigens, such as for example those disclosed in U.S. Pat. No. 5,538,866) lymphoma (U.S. Pat. Nos. 4,816,249; 5,068,177; and 5,227,159).
  • Tumor antigens can include for example, but are not limited to, HMW mucins bound by 2G3 and 369F10, c-erbB-2 related tumor antigen (an approximately 42 kD or 55 kD glycoprotein), the approximately 40, 60, 100 and 200 kD antigens bound by 113F1, 9-O-acetyl GD3, p97, alphafetoprotein (AFP) (for example, for germ cell tumors and/or hepatocellular carcinoma), carcinoembryonic antigen (CEA) (for example, for bowel cancers occasional lung or breast cancer), CA-125 (for example, for ovarian cancer), MUC-1 (for example, for breast cancer), epithelial tumor antigen (ETA) (for example, for breast cancer), tyrosinase (for example, for malignant melanoma), melanoma-associated antigen (MAGE) (for example, for malignant melanoma), cancer/testis antigen 1 (CTAG1B), mel
  • fusions can include fusions with pro-apoptotic payloads.
  • pro-apoptotic payloads for example a BAD, BAX, BAK, BIK, and/or BIDsequence.
  • the pro-apoptotic payload is a Bcl-2 domain containing peptide and/or a susequence of a BAD, BAX, BAK, BIK, and/or BID sequence.
  • Exemplary pro-apoptotic fusions are provided below, in Table 3.
  • an IL-2 antagonist can be fused to a pro-apoptotic payload for the treatment of cancer.
  • An “antagonist” is a compound that opposes the actions of an agonist, e.g. by preventing, reducing, inhibiting, or neutralizing the activity of an agonist.
  • An “antagonist” can also prevent, inhibit, or reduce constitutive activity of a target, e.g., a target receptor, even where there is no identified agonist.
  • the IL-2 antagonist comprises the following amino acid substitutions L18R, Q22E, Q126T, and S130R as compared to the wild-type IL-2 of SEQ ID NO:2.
  • the IL-2 antagonist comprises the following amino acid substitutions L18R, Q22E, L80F, R81D, L85V, I86V, and Q126T as compared to the wild- type IL-2 of SEQ ID NO:2.
  • the IL-2 antagonist comprises the following amino acid substitutions L18R, Q22E, L80F, R81D, L85V, I86V, Q126T, and S130R as compared to the wild-type IL-2 of SEQ ID NO:2.
  • Exemplary antagonists that can be fuses with pro-apoptotic payloads, such as those provided above, are provided below in Table 4.
  • fusions can include fusions with anti-apoptotic payloads for use in prolonging activation of CD8 cells, NK cells and anergic NK cells as well, and such exemplary sequences are provided in the table below. Suhc prolong activation of T-cells can prove remedial in cancer therapy treatment methods.
  • the IL-2 mutein-Fc fusion comprises one of the following sequences:
  • the IL-2 mutein sequence is 90% identical to any one of SEQ ID NO: 12 through SEQ ID NO: 15 and/or SEQ ID NO:20 through SEQ ID NO:80 (for example, any of the IL-2 sequences provided herein). In some embodiments, the IL-2 mutein sequence is 95% identical to any one of SEQ ID NO: 12 through SEQ ID NO: 15 and/or SEQ ID NO:20 through SEQ ID NO: 80 (for example, any of the IL-2 sequences provided herein).
  • the IL- 2 mutein sequence is 98% identical to any one of SEQ ID NO: 12 through SEQ ID NO: 15 and/or SEQ ID NO:20 through SEQ ID NO:80 (for example, any of the IL-2 sequences provided herein).
  • the IL-2 mutein sequence is 99% identical to any one of SEQ ID NO: 12 through SEQ ID NO: 15 and/or SEQ ID NO:20 through SEQ ID NO:80 (for example, any of the IL- 2 sequences provided herein).
  • an IL-2 mutein can be fused to an IL-4 mutein as described herein. In some embodiments, an IL-2 mutein can be fused to an IL-13 mutein as decribed herein. In some embodiments, an IL-2 mutein can be fused to an IL-10. In some embodiments, an IL-2 mutein can be fused to an IL-12. In some embodiments, an IL-2 mutein can be fused to an IL-15. In some embodiments, an IL-2 mutein can be fused to an IL-18.
  • such fusions function to specifically target cancer cells and/or cancer stem cells and reduce or inhibit cancer stem cell growth, as well as targeting the immunosuppressive cells in the tumor microenvironment (TME).
  • TEE tumor microenvironment
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; Bll SEQ ID NO: 10; C5 SEQ ID NO: 11; D10 SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO:16.
  • Exemplary IL-13 polypeptide sequences are provided in SEQ ID NO:81- SEQ ID NO: 128, as well as the table below.
  • the IL-13 polypeptide sequence is as provided in any one of SEQ ID NO:81-SEQ ID NO: 128. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 81. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO:82. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO:83. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO:84. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 85. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 86. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 87.
  • the IL-13 polypeptide sequence is SEQ ID NO:88. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 89. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 90. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 91. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO:92. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO:93. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 94. In some embodiments, the polypeptide sequence is SEQ ID NO: 95. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO:96.
  • the IL-13 polypeptide sequence is SEQ ID NO:97. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO:98. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO:99. In some embodiments, the polypeptide sequence is SEQ ID NO: 100. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 101. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 102. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 103. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 104. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 105.
  • the IL-13 polypeptide sequence is SEQ ID NO: 106. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 107. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 108. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 109. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 110. In some embodiments, the polypeptide sequence is SEQ ID NO: 111. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 112. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 113.
  • the IL-13 polypeptide sequence is SEQ ID NO: 114. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 115. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 116. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 117. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO:118. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 119. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO:120. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO:121.
  • the IL-13 polypeptide sequence is SEQ ID NO: 122. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 123. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 124. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 125. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 126. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 127. In some embodiments, the IL-13 polypeptide sequence is SEQ ID NO: 128.
  • the IL-13 polypeptide seqeunce is 90% identical to any one of SEQ ID NO:81 through SEQ ID NO: 128. In some embodiments, the IL-13 polypeptide sequence is 95% identical to any one of SEQ ID NO:81 through SEQ ID NO: 128. In some embodiments, the IL-13 polypeptide seqeunce is 98% identical to any one of SEQ ID NO: 81 through SEQ ID NO: 128. In some embodiments, the IL-13 polypeptide sequence is 99% identical to any one of SEQ ID NO:81 through SEQ ID NO: 128.
  • any one of SEQ ID NO:81-SEQ ID NO: 128 are linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 81 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 82 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 83 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 84 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO:85 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 86 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 87 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 88 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 89 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO:90 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO:91 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO:92 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO:93 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO:94 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO:94 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO:96 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO:97 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO:98 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO:99 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 100 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 101 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 102 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 103 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 104 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 105 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 106 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 107 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 108 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 109 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 110 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 111 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 112 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 113 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 114 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 115 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 116 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 117 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 118 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 119 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 120 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 121 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 122 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 123 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 124 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 125 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 126 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 127 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 128 is linked to an IL-2 or IL-2 mutein as described herein.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; Bll SEQ ID NO: 10; C5 SEQ ID NO: 11; DIO SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • an IL-13 peptide of the invention comprises one or more of the amino acids substitutions: (1) L10F, LI 01, L10V, L10A, L10D, L10T, L10H; (2) R11S, R11N, R11H, R11L, Rill; (3) I14L, I14F, 114V, I14M; (4) VI 8L, V18F, VI 81; (5) E12A, (6) R65D, (7) R86K, R86T, R86M; (8) D87E, D87K, D87R, D87G, D87S; (9) T88I, T88K, T88R; (10) K89R, K89T, K89M; (11) L101 F, L101I, L101Y, L101H, L101N; (12) K104R, K104T, K104M; (13) K105T, K105A, K105R, K105E; (14) F107L, F107I, F107V, F107M
  • modified residues are at two or more, three or more, four or more, five or more, and not more than 14 amino acids within the combined set of contact residues defined above.
  • amino acid substitutions include without limitation those provided in Figure 4.
  • Sets of modifications may include the following specific changes: (1) L10H; L10A; (2) R11L; (4) V18I; (7) R86M; R86K; R86T; (8) D87K; D87G; (9) T88R, T88S; T88K; (10) K89R; (11) L101N; (12) K104R; (13) K105A; K105E; (14) R108K.
  • the modification includes any one of the recited specific changes.
  • the modification includes LI OH.
  • the modification includes L10A.
  • the modification includes R11L.
  • the modification includes VI 81.
  • the modification includes R86M.
  • the modification includes R86K. In some embodiments, the modification includes R86T. In some embodiments, the modification includes D87K. In some embodiments, the modification includes D87G. In some embodiments, the modification includes T88R. In some embodiments, the modification includes T88S. In some embodiments, the modification includes T88K. In some embodiments, the modification includes K89R. In some embodiments, the modification includes L101N. In some embodiments, the modification includes K104R. In some embodiments, the modification includes K105A. In some embodiments, the modification includes K105E. In some embodiments, the modification includes R108K. In some embodiments, the polypeptide comprising the one or more modifications is linked to an IL-2 or IL-2 mutein as described herein.
  • amino acid substitutions include without limitation those provided in Figure 4.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; Bll SEQ ID NO: 10; C5 SEQ ID NO: 11; DIO SEQ ID NO: 12; El 0 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO:16.
  • the set of modifcations comprises L10V, K89R, L101N, K105E,
  • the set of modifcations comprises R11S, I14M, T88S, L101N,
  • the set of modifcations comprises L10H, R11L, VI 81, R86K, D87E, K89R, L101N, K105T, and R108K (C9, e.g. SEQ ID NO:36 or SEQ ID NO:53). In some embodiments, the set of modifcations comprises
  • the set of modifcations comprises L10A, V18F, R86K, D87K, K89R, LI 011, K104R, and R108K (D7, e.g. SEQ ID NO:40 or SEQ ID NO:57).
  • the set of modifcations comprises L10T/D, Rill, VI 81, R86K, D87K/G, T88S, K89R, L101Y, K104R,
  • the set of modifcations comprises L10T, Rill, V18I, R86K, D87K, T88S, K89R, L101Y, K104R, K105T, and R108K. In some embodiments, the set of modifcations comprises L10T, Rill, VI 81, R86K, D87G, T88S, K89R, L101Y, K104R, K105T, and R108K. In some embodiments, the set of modifcations comprises L10D, R1 II, V18I, R86K, D87K, T88S, K89R, L101Y, K104R, K105T, and R108K.
  • the set of modifcations comprises L10D, Rill, VI 81, R86K, D87G, T88S, K89R, L101Y, K104R, K105T, R108K. In some embodiments, the set of modifcations comprises L10A/V, R86T, D87G, T88K, K89R, L101N, K104R, K105A/E, and R108K/T. In some embodiments, the set of modifcations comprises L10A, R86T, D87G, T88K, K89R, L101N, K104R, K105A, and R108K. In some embodiments, the set of modifcations comprises L10A, R86T, D87G, T88K, K89R, L101N,
  • the set of modifcations comprises L10A,
  • the set of modifcations comprises L10A, R86T, D87G, T88K, K89R, L101N, K104R, K105E, and R108T.
  • the set of modifcations comprises L10V, R86T, D87G, T88K, K89R, L101N, K104R, K105A, and R108K. In some embodiments, the set of modifcations comprises L10V, R86T, D87G, T88K, K89R, L101N, K104R, K105E, and R108K. In some embodiments, the set of modifcations comprises L10V, R86T, D87G, T88K, K89R, L101N, K104R, K105A, an dR108T.
  • the set of modifcations comprises L10V, R86T, D87G, T88K, K89R, L101N, K104R, K105E, and R108T.
  • the amino acid sequence is 90% identical.
  • the amino acid sequence is 95% identical.
  • the amino acid sequence is 98% identical.
  • the amino acid sequence is 99% identical.
  • the polypeptide comprising the one or more modifications is linked to an IL-2 or IL-2 mutein as described herein.
  • amino acid substitutions include without limitation those provided in Figure 4.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; B11 SEQ ID NO: 10; C5 SEQ ID NO: 11 ; DIO SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • the set of modifcations comprises L10V, VI 81, D87S, D88S, L101F, K104R, and K105T. In some embodiments, the set of modifcations comprises R11S, V18I, R86K, D87G, T88S, K89M, L101Y, K104R, and K105T. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, and K105T. In some embodiments, the set of modifcations comprises L10V/I, D87S, T88S, K89R, L101H/F, K104R, and K105T.
  • the set of modifcations comprises L10I, V18I, R86T, D87G, T88S, K89R, L101Y/H, K104R, and K105A. In some embodiments, the set of modifcations comprises L10V, V18I, D87S, T88S, L101F, K104R, and K105T. In some embodiments, the set of modifcations comprises V18I, R86T, D87G, T88S, L101Y, K104R, and K105A. In some embodiments, the set of modifcations comprises Rill, V18I, R86K, D87G, T88S, L101H, K104R, K105A, and F107M.
  • the set of modifcations comprises L10V, V18I, D87S, D88S, L101F, K104R, K105T, E12A/G/S, and R65D/E. In some embodiments, the set of modifcations comprises R11S, VI 81, R86K, D87G, T88S, K89M, L101Y, K104R, K105T, E12A/G/S, and R65D/E. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12A/G/S, and R65D/E.
  • the set of modifcations comprises L10V/I, D87S, T88S, K89R, L101H/F, K104R, K105T, E12A/G/S, and R65D/E. In some embodiments, the set of modifcations comprises L10I, V18I, R86T, D87G, T88S, K89R, L101Y/H, K104R, K105A, E12A/G/S, and R65D/E. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12A/G/S, and R65D/E.
  • the set of modifcations comprises VI 81, R86T, D87G, T88S, L101Y, K104R, K105A, E12A/G/S, and R65D/E. In some embodiments, the set of modifcations comprises Rill, VI 81, R86K, D87G, T88S, L101H, K104R, K105A, F107M, E12A/G/S, and R65D/E. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, D88S, L101F, K104R, K105T, E12A, and R65D/E.
  • the set of modifcations comprises R11S, VI 81, R86K, D87G, T88S, K89M, L101Y, K104R, K105T, E12A, and R65D/E. In some embodiments, the set of modifcations comprises L10V, V18I, D87S, T88S, L101F,
  • the set of modifcations comprises L10V/I, D87S, T88S, K89R, L101H/F, K104R, K105T, E12A, and R65D/E. In some embodiments, the set of modifcations comprises LI 01, V18I, R86T, D87G, T88S, K89R, L101Y/H, K104R, K105A, E12A, and R65D/E. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12A, and R65D/E.
  • the set of modifcations comprises VI 81, R86T, D87G, T88S, L101Y, K104R, K105A, E12A, and R65D/E. In some embodiments, the set of modifcations comprises Rill, V18I, R86K, D87G,
  • the set of modifcations comprises L10V, VI 81, D87S, D88S, L101F, K104R, K105T, E12G, and R65D/E. In some embodiments, the set of modifcations comprises R11S, V18I, R86K, D87G, T88S, K89M, L101Y, K104R, K105T, E12G, and R65D/E.
  • the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12A/G/S, and R65D/E. In some embodiments, the set of modifcations comprises L10V/I, D87S, T88S, K89R, L101H/F, K104R, K105T, E12G, and R65D/E. In some embodiments, the set of modifcations comprises L10I, V18I, R86T, D87G, T88S, K89R, L101Y/H, K104R, K105A, E12G, and R65D/E.
  • the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12G, and R65D/E. In some embodiments, the set of modifcations comprises VI 81, R86T, D87G, T88S, L101Y, K104R, K105A, E12G, and R65D/E. In some embodiments, the set of modifcations comprises Rill, VI 81, R86K, D87G, T88S, L101H, K104R, K105A, F107M, E12G, and R65D/E. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, D88S, L101F,
  • the set of modifcations comprises R11S, VI 81, R86K, D87G, T88S, K89M, L101Y, K104R, K105T, E12A/G/S, and R65D/E.
  • the set of modifcations comprises L10V, V18I, D87S, T88S, L101F, K104R, K105T, E12S, and R65D/E.
  • the set of modifcations comprises L10V/I, D87S, T88S, K89R, L101H/F, K104R, K105T, E12S, and R65D/E.
  • the set of modifcations comprises L10I, VI 81, R86T, D87G, T88S, K89R, L101Y/H, K104R, K105A, E12S, and R65D/E. In some embodiments, the set of modifcations comprises L10V, V18I, D87S, T88S, L101F, K104R, K105T, E12S, and R65D/E. In some embodiments, the set of modifcations comprises VI 81, R86T, D87G, T88S, L101Y, K104R, K105A, E12S, and R65D/E.
  • the set of modifcations comprises Rill, V18I, R86K, D87G, T88S, L101H, K104R, K105A, F107M, E12S, and R65D/E. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, D88S, L101F, K104R, K105T, E12A, and R65D. In some embodiments, the set of modifcations comprises R11S, VI 81, R86K, D87G, T88S, K89M, L101Y, K104R, K105T, E12A, and R65E.
  • the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12A, and R65D. In some embodiments, the set of modifcations comprises L10V/I, D87S, T88S, K89R, L101H/F, K104R, K105T, E12A, and R65D. In some embodiments, the set of modifcations comprises LI 01, V18I, R86T, D87G, T88S, K89R, L101Y/H, K104R, K105A, E12A, and R65D.
  • the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12A, and R65D. In some embodiments, the set of modifcations comprises VI 81, R86T, D87G, T88S, L101Y, K104R, K105A, E12A, and R65D. In some embodiments, the set of modifcations comprises Rill, V18I, R86K, D87G, T88S, L101H, K104R, K105A, F107M, E12A, and R65D.
  • the set of modifcations comprises L10V, VI 81, D87S, D88S, L101F, K104R, K105T, E12G, and R65D. In some embodiments, the set of modifcations comprises R11S, V18I, R86K, D87G, T88S, K89M, L101Y, K104R, K105T, E12G, and R65D. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12A/G/S, and R65D.
  • the set of modifcations comprises L10V/I, D87S, T88S, K89R, L101H/F, K104R, K105T, E12G, and R65D. In some embodiments, the set of modifcations comprises L10I, V18I, R86T, D87G, T88S, K89R, L101Y/H, K104R, K105A, E12G, and R65D. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12G, and R65D.
  • the set of modifcations comprises V18I, R86T, D87G, T88S, L101Y, K104R, K105A, E12G, and R65D. In some embodiments, the set of modifcations comprises Rill, V18I, R86K, D87G, T88S, L101H, K104R, K105A, F107M, E12G, and R65D. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, D88S, L101F, K104R, K105T, E12S, and R65D.
  • the set of modifcations comprises R11S, VI 81, R86K, D87G, T88S, K89M, L101Y, K104R, K105T, E12S, and R65D. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12S, and R65D. In some embodiments, the set of modifcations comprises L10V/I, D87S, T88S, K89R, L101H/F, K104R, K105T, E12S, and R65D.
  • the set of modifcations comprises L10I, VI 81, R86T, D87G, T88S, K89R, L101Y/H, K104R, K105A, E12S, and R65D. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12S, and R65D. In some embodiments, the set of modifcations comprises VI 81, R86T, D87G, T88S, L101Y, K104R, K105A, E12S, and R65D.
  • the set of modifcations comprises R1 II, VI 81, R86K, D87G, T88S, L101H, K104R, K105A, F107M, E12S, and R65D. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, D88S, L101F, K104R,
  • the set of modifcations comprises R11S, VI 81, R86K, D87G, T88S, K89M, L101Y, K104R, K105T, E12A, and R65E. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, T88S, L101F, K104R, K105T, E12A, and R65E. In some embodiments, the set of modifcations comprises L10V/I, D87S, T88S, K89R, L101H/F, K104R, K105T, E12A, and R65E.
  • the set of modifcations comprises L10I, VI 81, R86T, D87G, T88S, K89R, L101Y/H, K104R, K105A, E12A, and R65E. In some embodiments, the set of modifcations comprises L10V, V18I, D87S, T88S, L101F, K104R,
  • the set of modifcations comprises VI 81, R86T, D87G, T88S, L101Y, K104R, K105A, E12A, and R65E. In some embodiments, the set of modifcations comprises Rill, V18I, R86K, D87G, T88S, L101H, K104R, K105A, F107M, E12A, and R65E. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, D88S, L101F, K104R, K105T, E12G, and R65E.
  • the set of modifcations comprises R11S, VI 81, R86K, D87G, T88S, K89M, L101Y, K104R, K105T, E12G, and R65E. In some embodiments, the set of modifcations comprises L10V, V18I, D87S, T88S, L101F, K104R,
  • the set of modifcations comprises L10V/I, D87S, T88S, K89R, L101H/F, K104R, K105T, E12G, and R65E.
  • the set of modifcations comprises LI 01, VI 81, R86T, D87G, T88S, K89R, L101Y/H, K104R, K105A, E12G, and R65E.
  • the set of modifcations comprises L10V, V18I, D87S, T88S, L101F, K104R, K105T, E12G, and R65E.
  • the set of modifcations comprises VI 81, R86T, D87G, T88S, L101Y, K104R, K105A, E12G, and R65E. In some embodiments, the set of modifcations comprises Rill, VI 81, R86K, D87G, T88S, L101H, K104R, K105A, F107M, E12G, and R65E. In some embodiments, the set of modifcations comprises L10V, VI 81, D87S, D88S, L101F, K104R, K105T, E12S, and R65E.
  • the set of modifcations comprises R11S, VI 81, R86K, D87G, T88S, K89M, L101Y, K104R, K105T, E12A/G/S, and R65E. In some embodiments, the set of modifcations comprises L10V, V18I, D87S, T88S, L101F, K104R, K105T, E12S, and R65E. In some embodiments, the set of modifcations comprises L10V/I, D87S, T88S, K89R, L101H/F, K104R, K105T, E12S, and R65E.
  • the set of modifcations comprises L10I, VI 81, R86T, D87G, T88S, K89R, L101Y/H, K104R, K105A, E12S, and R65E. In some embodiments, the set of modifcations comprises L10V, V18I, D87S, T88S, L101F, K104R, K105T, E12S, and R65E. In some embodiments, the set of modifcations comprises VI 81, R86T, D87G, T88S, L101Y, K104R, K105A, E12S, and R65E.
  • the set of modifcations comprises Rill, V18I, R86K, D87G, T88S, L101H, K104R, K105A, F107M, E12S, and R65E. In some embodiments, the set of modifcations comprises L10V, E12A, VI 81, R65D, D87S, T88S, L101F, K104R, and K105T (see, for example, IL-13dn; SEQ ID NO:38).
  • the amino acid sequence is 90% identical. In some embodiments, the amino acid sequence is 95% identical. In some embodiments, the amino acid sequence is 98% identical. In some embodiments, the amino acid sequence is 99% identical.
  • the polypeptide comprising the one or more modifications is linked to an IL-2 or IL-2 mutein as described herein.
  • amino acid substitutions include without limitation those provided in Figure 4.
  • the IL-2 mutein incudes any one of 5- 1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; Bll SEQ ID NO: 10; C5 SEQ ID NO: 11 ; DIO SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • any IL-4 sequence or variant thereof can be used in a fusion with an IL-2 mutein or variant, including those as described herein.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; Bll SEQ ID NO: 10; C5 SEQ ID NO: 11; DIO SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • Exemplary polypeptide sequences are provided in SEQ ID NO:130-SEQ ID NO: 135, including any of those provided herein.
  • the IL-4 polypeptide sequence is as provided in any one of SEQ ID NO: 130 through SEQ ID NO: 135.
  • the IL-4 polypeptide sequence is SEQ ID NO: 130.
  • the IL-4 polypeptide sequence is SEQ ID NO: 131.
  • the IL-4 polypeptide sequence is SEQ ID NO: 132.
  • the IL-4 polypeptide sequence is SEQ ID NO: 133.
  • the IL-4 polypeptide sequence is SEQ ID NO: 134.
  • the IL-4 polypeptide sequence is SEQ ID NO: 135. In some embodiments, the IL-4 polypeptide sequence is 98% identical to any one of SEQ ID NO: 130 through SEQ ID NO: 135. In some embodiments, the IL-4 polypeptide sequence is 99% identical to any one of SEQ ID NO: 130 through SEQ ID NO: 135. In some embodiments, any one of SEQ ID NO:130-SEQ ID NO: 135 are linked to an IL-2 or IL-2 mutein as described herein. In some embodiments, SEQ ID NO: 130 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 131 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 132 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 133 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 134 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 135 is linked to an IL-2 or IL-2 mutein as described herein.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; B11 SEQ ID NO: 10; C5 SEQ ID NO: 11; D10 SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • an IL-2 mutein can be fused to an IL-10, IL-12, IL-15, and/or IL- 18 sequence.
  • such fusions function to specifically target the fusion construct to NK cells and/or CD8+ cells.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; Bll SEQ ID NO: 10; C5 SEQ ID NO: 11; DIO SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • SEQ ID NO: 136 is linked to an IL- 2 or IL-2 mutein as described herein.
  • SEQ ID NO: 137 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 138 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 139 is linked to an IL-2 or IL- 2 mutein as described herein.
  • SEQ ID NO: 140 is linked to an IL-2 or IL-2 mutein as described herein.
  • SEQ ID NO: 141 is linked to an IL-2 or IL-2 mutein as described herein.
  • the IL-2 mutein can be fused to an IL- IL-10, IL-12, IL-15, and/or IL-18 sequence as provided in the table below, in SEQ ID NOs: 136-141.
  • Table 10 Exemplary IL-10, IL-12, IL-15, and/or IL-18 Sequences
  • sequences of exemplary IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; Bll SEQ ID NO: 10; C5 SEQ ID NO: 11; D10 SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • the cytokine-cytokine fusion is one of those included in the table below.
  • the cytokine-cytokine fusion is one of those included in the table below (see Table 12, as well as Figure 54).
  • polypeptides used in the practice of the instant invention are synthetic or are produced by expression of a recombinant nucleic acid molecule.
  • the polypeptide is a chimera (e.g., a fusion protein containing at least a mutant IL-2 polypeptide and a heterologous polypeptide, including a bispecific IL-2 cytokine fusion)
  • it can be encoded by a hybrid nucleic acid molecule containing one sequence that encodes all or part of the IL-2 mutein, and a second sequence that encodes all or part of the heterologous polypeptide.
  • subject IL-2 muteins described herein may be fused to a hexa-histidine tag to facilitate purification of bacterially expressed protein, or to a hemagglutinin tag to facilitate purification of protein expressed in eukaryotic cells.
  • Methods for constructing a DNA sequence encoding the IL-2 muteins and expressing those sequences in a suitably transformed host include, but are not limited to, using a PCR-assisted mutagenesis technique. Mutations that consist of deletions or additions of amino acid residues to an IL-2 polypeptide can also be made with standard recombinant techniques.
  • the nucleic acid molecule encoding IL-2 is optionally digested with an appropriate restriction endonuclease.
  • the resulting fragment can either be expressed directly or manipulated further by, for example, ligating it to a second fragment.
  • the ligation may be facilitated if the two ends of the nucleic acid molecules contain complementary nucleotides that overlap one another, but blunt-ended fragments can also be ligated.
  • PCR-generated nucleic acids can also be used to generate various mutant sequences.
  • the complete amino acid sequence can be used to construct a back -translated gene.
  • a DNA oligomer containing a nucleotide sequence coding for IL-2 mutein can be synthesized.
  • several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated.
  • the individual oligonucleotides typically contain 5’ or 3’ overhangs for complementary assembly.
  • subject IL-2 muteins can be chemically synthesized. Chemically synthesized polypeptides are routinely generated by those of skill in the art.
  • the DNA sequences encoding an IL-2 mutein will be inserted into an expression vector and operatively linked to an expression control sequence appropriate for expression of the IL-2 mutein in the desired transformed host.
  • Proper assembly can be confirmed by nucleotide sequencing, restriction mapping, and expression of a biologically active polypeptide in a suitable host.
  • the gene in order to obtain high expression levels of a transfected gene in a host, the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
  • the DNA sequence encoding the IL-2 mutein can also include DNA sequences that encode a signal sequence.
  • Such signal sequence should be one recognized by the cell chosen for expression of the IL-2 mutein. It can be prokaryotic, eukaryotic or a combination of the two. It can also be the signal sequence of native IL-2. The inclusion of a signal sequence depends on whether it is desired to secrete the IL-2 mutein from the recombinant cells in which it is made. If the chosen cells are prokaryotic, it generally is preferred that the DNA sequence not encode a signal sequence. If the chosen cells are eukaryotic, it generally is preferred that a signal sequence be encoded and most preferably that the wild-type IL-2 signal sequence be used.
  • the bispecific IL-2 cytokine fusion and/or IL-2 muteins described herein can be employed to target an oncolytic virus (e.g., see Allen et al, Mol. Ther. 16:1556-64, 2008).
  • oncolytic virus can be used to target an IL-2 mutein to a tumor or TME.
  • Numerous viruses can be employed as the oncolytic virus, including adenoviruses as well as self- replicating alphavirus, as well as oncolyctic vaccinia viruses (see, for example W02013038066, incorporated herein by reference in its entirety; in particular Figure 17).
  • oncolytic viruses can include Seneca Valley Virus, Newcastle disease Virus (also referred to as Newcastle virus), Maraba virus, vesicular stomatitis virus (VSV), Herpes virus (including HSV-1), Measles virus, poliovirus, reovirus, coxsackie virus, a lentivirus, a morbillivirus, an influenza virus, Sinbis virus, myxoma virus and/or retrovirus (see, for example, Twumasi-Boateng, et al, “Oncolytic viruses as engineering platforms for combination immunotherapy”, Nature Reviews Cancer, 2018), and Kaufman et al, Cancer Immunotherapy, 14:642-662 (2015), all of which are incorporated by reference herein their entireties).
  • the oncolytic virus includes but is not limited to an adenovirus, a self-replicating alphavirus, a vaccinia virus, a Seneca Valley Virus, a Newcastle disease Virus, a Maraba virus, vesicular stomatitis virus (VSV), a Herpes virus (including HSV-1 and HSV-2), a measles virus, a poliovirus, a reovirus, a coxsackie virus, a lentivirus, a morbillivirus, an influenza virus, Sinbis virus, myxoma virus and/or a retrovirus.
  • an adenovirus a self-replicating alphavirus
  • a vaccinia virus a Seneca Valley Virus, a Newcastle disease Virus, a Maraba virus
  • VSV vesicular stomatitis virus
  • Herpes virus including HSV-1 and HSV-2
  • a measles virus a poliovirus
  • the IL-2 superkines also can be used to direct T cells/OVs to the TME.
  • An IL-2 variant (such as H9) can boost effector T cells and NK cells while IL-2 variant can suppress T reg activity.
  • Other oncolytic viruses include can include, for example, oncoVex/T- VEC, which involves the intratumoral injection of replication-conditional herpes simplex virus which preferentially infects cancer cells.
  • the virus which is also engineered to express GM-CSF, is able to replicate inside a cancer cell causing its lysis, releasing new viruses and an array of tumor antigens, and secreting GM-CSF in the process.
  • Such oncolytic virus vaccines enhance DCs function in the tumor microenvironment to stimulate anti-tumor immune responses.
  • These oncolytic viruses can be used to target or deliver the IL-2 muteins described herein to the tumor.
  • the IL-2 mutein is any IL-2 mutein or variant disclosed herein.
  • the IL-2 mutein sequence is 90% identical to any one of SEQ ID NO:2 or SEQ ID NO:6 through SEQ ID NO: 10 or SEQ ID NO: 16.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; B11 SEQ ID NO: 10; C5 SEQ ID NO: 11 ; DIO SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • the substitutions in the IL-2 mutein comprise L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO: 2.
  • the oncolytic virus comprises a transgene capable of expressing an IL-2 mutein as described herein. In some embodiments, the oncolytic virus comprises a transgene capable of expressing an IL-2 mutein comprising the following amino acid substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the oncolytic virus comprises a nucleic acid encoding an IL-2 mutein comprising the following amino acid substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO:2.
  • the oncolytic virus comprises a transgene that is expressed as a therapeutic payload.
  • the therapeutic payload is an 11-2 as described herein.
  • the therapeutic payload is IL-2 mutein comprising the following amino acid substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO:2.
  • the oncolytic virus is an oncolytic vaccinia virus.
  • the oncolytic vaccinia virus vector is characterized in that the virus particle is of the type intracellular mature virus (IMV), intracellular enveloped virus (IEV), cell- associated enveloped virus (CEV), or extracellular enveloped virus (EEV).
  • the oncolytic vaccinia virus particle is of the type EEV or IMV.
  • the oncolytic vaccinia virus particle is of the type EEV.
  • oncolytic vaccinia virus recombinants and cells and pharmaceutical compositions comprising the vectors which preferentially replicate in tumor cells and express at least one transgene (for example, and IL-2 muteina as described herein) to facilitate antitumor efficacy and apoptosis induction and to modulate host immune responses in a subject.
  • transgene for example, and IL-2 muteina as described herein
  • oncolytic adenoviruses and oncolytic vaccinia viruses can be combined with IL-2 expression or targeting moieties as described herein in order to target the oncolytic vaccinia virus or the oncolytic adenovirus and/or express the IL-2 mutein.
  • Oncolysis releases tumor antigens and provides costimulatory danger signals.
  • CD40 ligand CD40L, CD154
  • Thl T-helper type 1
  • the present invention provides for oncolytic viruses that express the IL-2 muteins of the present invention.
  • the present invention provides for oncolytic viruses that are targeted (for example, “armed”) with the IL-2 targeting moieties of the present invention.
  • the oncolytic virus is a modified vaccinia virus vector, a virus particle, a host cell, a pharmaceutical composition and a kit comprising vaccinia virus genome wherein the thymidine kinase gene is inactivated by either a substituion in the thymidine kinase (TK) gene and/or an open reading frame ablating deletion of at least one nucleotide providing a partially deleted thymidine kinase gene, the vaccinia growth factor gene is deleted, and the modified vaccinia virus vector comprises at least one nucleic acid sequence encoding a non-viral protein (e.g., an IL-2 mutein as described herein which is capable of being expressed).
  • TK thymidine kinase
  • the modified vaccinia virus vector, the virus particle, the pharmaceutical composition or the kit can be used for cancer therapy, for eliciting immune response in a subject, for use in a method of inhibiting malignant cell proliferation in a mammal, for use in a therapy or prophylaxis of cancer, for detecting the presence of the modified vaccinia virus in a subject, and as an in situ cancer vaccine, optionally in combination with adenovirus.
  • the invention provides method of producing a modified vaccinia virus comprising vaccinia virus genome wherein the thymidine kinase gene is inactivated by a substituion in the thymidine kinase (TK) gene and/or an open reading frame ablating deletion of at least one nucleotide providing a partially deleted thymidine kinase gene, the vaccinia growth factor gene is deleted, and the modified vaccinia virus vector comprises at least one nucleic acid sequence encoding a non-viral protein (e.g., an IL-2 mutein as described herein), comprising the steps of providing producer cells capable of sustaining production of vaccinia virus particles and carrying the modified vaccinia vector; culturing the producer cells in conditions suitable for virus replication and production; and harvesting the virus particles.
  • TK thymidine kinase
  • the present invention provides methods of administering an oncolytic virus “armed” with or including an nucleic acid encoding an IL-2 mutein as described herein, wherein the IL-2 mutein is expressed at the tumor location or is expressed systemically in the subject. In some embodiments, the present invention also provides methods of administering an oncolytic virus “armed” or targeted with an IL-2 mutein as dseribed herein.
  • the routes of administration vary, naturally, with the location and nature of the tumor, and include, e.g., intradermal, transdermal, parenteral, intravenous, intramuscular, intranasal, subcutaneous, regional (e.g., in the proximity of a tumor, particularly with the vasculature or adjacent vasculature of a tumor), percutaneous, intratracheal, intraperitoneal, intraarterial, intravesical, intratumoral, inhalation, perfusion, lavage, and oral administration.
  • Compositions are formulated relative to the particular administration route.
  • Vaccinia virus is a member of the Orthopoxvirus genus of the Poxviridae. It has large double-stranded DNA genome (-200 kb, -200 genes) and a complex morphogenic pathway produces distinct forms of infectious virions from each infected cell. Viral particles contain lipid membranes(s) around a core. Virus core contains viral structural proteins, tightly compacted viral DNA genome, and transcriptional enzymes. Dimensions of vaccinia virus are - 360 x 270 x 250 nm, and weight of - 5-10 fg. Genes are tightly packed with little non-coding DNA and open reading frames (ORFs) lack introns. Three classes of genes (early, intermediate, late) exists.
  • Early genes code for proteins mainly related to immune modulation and virus DNA replication.
  • Intermediate genes code for regulatory proteins which are required for the expression of late genes (e.g. transcription factors) and late genes code for proteins required to make virus particles and enzymes that are packaged within new virions to initiate the next round of infection.
  • Vaccinia virus replicates in the cell cytoplasm.
  • the genome of WR vaccinia has been sequenced (Accession number AY243312).
  • the oncolytic vaccinia virus is a Copenhagen, modified virus Ankara (MV A), Lister, Tian Tan, Wyeth, or Western Reserve (WR) vaccinia virus.
  • IMV intracellular mature virus
  • IEV intracellular enveloped virus
  • CEV cell-associated enveloped virus
  • EEV particles extracellular enveloped virus
  • EEV particles have an extra membrane derived from the trans-Golgi network. This outer membrane has two important roles: a) it protects the internal IMV from immune aggression and, b) it mediates the binding of the virus onto the cell surface.
  • CEVs and EEVs help virus to evade host antibody and complement by being wrapped in a host-derived membrane.
  • IMV and EEV particles have several differences in their biological properties and they play different roles in the virus life cycle.
  • EEV and IMV bind to different (unknown) receptors (1) and they enter cells by different mechanisms.
  • EEV particles enter the cell via endocytosis and the process is pH sensitive. After internalization, the outer membrane of EEV is ruptured within an acidified endosome and the exposed IMV is fused with the endosomal membrane and the virus core is released into the cytoplasm.
  • IMV enters the cell by fusion of cell membrane and virus membrane and this process is pH-independent. In addition to this, CEV induces the formation of actin tails from the cell surface that drive virions towards uninfected neighboring cells.
  • EEV is resistant to neutralization by antibodies (NAb) and complement toxicity, while IMV is not. Therefore, EEV mediates long range dissemination in vitro and in vivo. Comet-inhibition test has become one way of measuring EEV-specific antibodies since even if free EEV cannot be neutralized by EEV NAb, the release of EEV from infected cells is blocked by EEV NAb and comet shaped plaques cannot be seen. EEV has higher specific infectivity in comparison to IMV particles (lower particle/pfu ratio) which makes EEV an interesting candidate for therapeutic use.
  • the outer membrane of EEV is an extremely fragile structure and EEV particles need to be handled with caution which makes it difficult to obtain EEV particles in quantities required for therapeutic applications. EEV outer membrane is ruptured in low pH (pH ⁇ 6). Once EEV outer membrane is ruptured, the virus particles inside the envelope retain full infectivity as an IMV.
  • Some host-cell derived proteins co-localize with EEV preparations, but not with IMV, and the amount of cell-derived proteins is dependent on the host cell line and the virus strain. For instance, WR EEV contains more cell-derived proteins in comparison to VV IHD-J strain.
  • Host cell derived proteins can modify biological effects of EEV particles. As an example, incorporation of the host membrane protein CD55 in the surface of EEV makes it resistance to complement toxicity.
  • human A549 cell derived proteins in the surface of EEV particles may target virus towards human cancer cells. Similar phenomenon has been demonstrated in the study with human immunodeficiency virus type 1, where host- derived ICAM-1 glycoproteins increased viral infectivity.
  • IEV membrane contains at least 9 proteins, two of those not existing in CEV/EEV. F12L and A36R proteins are involved in IEV transport to the cell surface where they are left behind and are not part of CEV/EEV (9, 11). 7 proteins are common in (IEV)/CEV/EEV : F13L, A33R, A34R, A56R, B5R, E2, (K2L).
  • IEV International Health Department
  • J International Health Department
  • the IHD-W phenotype was attributed largely to a point mutation within the A34R EEV lectin-like protein. Also, deletion of A34R increases the number of EEVs released. EEV particles can be first detected on cell surface 6 hours post-infection (as CEV) and 5 hours later in the supernatant (IHD-J strain). Infection with a low multiplicity of infection (MO I) results in higher rate of EEV in comparison to high viral dose. The balance between CEV and EEV is influenced by the host cell and strain of virus.
  • Vaccinia has been used for eradication of smallpox and later, as an expression vector for foreign genes and as a live recombinant vaccine for infectious diseases and cancer.
  • Vaccinia virus is the most widely used pox virus in humans and therefore safety data for human use is extensive.
  • vaccinated safety with modified vaccinia virus strains and only very rare severe adverse events have been reported.
  • Those are generalized vaccinia (systemic spread of vaccinia in the body), erythema multiforme (toxic/allergic reaction), eczema vaccinatum (widespread infection of the skin), progressive vaccinia (tissue destruction), and postvaccinia! encephalitis.
  • Vaccinia virus is appealing for cancer gene therapy due to several characteristics. It has natural tropism towards cancer cells and the selectivity can be significantly enhanced by deleting some of the viral genes.
  • the present invention relates to the use of double deleted vaccinia virus (vvdd) in which two viral genes, viral thymidine kinase (TK) and vaccinia growth factor (VGF), are at least partially deleted. TK and VGF genes are needed for virus to replicate in normal but not in cancer cells. The partial TK deletion may be engineered in the TK region conferring activity.
  • TK deleted vaccinia viruses are dependent on cellular nucleotide pool present in dividing cells for DNA synthesis and replication.
  • the TK deletion limits virus replication significantly in resting cells allowing efficient virus replication to occur only in actively dividing cells (e.g., cancer cells).
  • VGF is secreted from infected cells and has a paracrine priming effect on surrounding cells by acting as a mitogen. Replication of VGF deleted vaccinia viruses is highly attenuated in resting (non- cancer) cells.
  • the effects of TK and VGF deletions have been shown to be synergistic.
  • adenovirus is a 36 kb, linear, double-stranded DNA virus (Grunhaus and Horwitz, 1992).
  • the term “adenovirus” or “AAV” includes AAV type 1 (AAV1), AAV type 2 (AAV2), AAV type 3 (AAV3), AAV type 4 (AAV4), AAV type 5 (AAV5), AAV type 6 (AAV 6), AAV type 7 (AAV7), AAV type 8 (AAV8), AAV type 9 (AAV9), AAV 9_hul4, avian AAV, bovine AAV, canine AAV, equine AAV, primate AAV, non-primate AAV, and ovine AAV.
  • Prime AAV refers to AAV capable of infecting primates
  • non-primate AAV refers to AAV capable of infecting non-primate mammals
  • bovine AAV refers to AAV capable of infecting bovine mammals
  • Adenoviral infection of host cells results in adenoviral DNA being maintained episomally, which reduces the potential genotoxicity associated with integrating vectors. Also, adenoviruses are structurally stable, and no genome rearrangement has been detected after extensive amplification. Adenovirus can infect virtually all epithelial cells regardless of their cell cycle stage. (See, for example, US20060147420, incroporated by reference herein in its entirety.) Moreover, the Ela and E4 regions of adenovirus are essential for an efficient and productive infection of human cells. The Ela gene is the first viral gene to be transcribed in a productive infection, and its transcription is not dependent on the action of any other viral gene products.
  • the Ela promoter in addition to regulating the expression of the Ela gene, also integrates signals for packaging of the viral genome as well as sites required for the initiation of viral DNA replication. See, Schmid, S. I., and Hearing, P. in Current Topics in Microbiology and Immunology, vol. 199: pages 67-80 (1995).
  • the oncolytic virus is an oncolytic adenovirus. It has been establisehd that naturally occurring viruses can be engineered to produce an oncolytic effect in tumor cells (Wildner, 2001; Jacotat, 1967; Kim, 2001; Geoerger et al, 2002; Yan et al, 2003; Vile et al, 2002, each of which is incorporated herein by reference).
  • adenoviruses specific deletions within their adenoviral genome can attenuate their ability to replicate within normal quiescent cells, while they retain the ability to replicate in tumor cells.
  • D24 conditionally replicating adenovirus
  • the D24 adenovirus is derived from adenovirus type 5 (Ad-5) and contains a 24-base-pair deletion within the CR2 portion of the E1A gene. See, for example W02001036650A2 (incorporated by reference herein in it’s entirety.
  • Oncolytic adenoviruses include conditionally replicating adenoviruses (CRADs), such as Delta 24, which have several properties that make them candidates for use as biotherapeutic agents.
  • CRADs conditionally replicating adenoviruses
  • Delta 24 have several properties that make them candidates for use as biotherapeutic agents.
  • One such property is the ability to replicate in a permissive cell or tissue, which amplifies the original input dose of the oncolytic virus and helps the agent spread to adjacent tumor cells providing a direct antitumor effect.
  • the oncolytic component of Delta 24 with a transgene expression approach to produce an armed Delta 24 may be used for producing or enhancing bystander effects within a tumor and/or producing or enhancing detection/imaging of an oncolytic adenovirus in a patient, or tumor associated tissue and/or cell.
  • the combination of oncolytic adenovirus with various transgene strategies e.g., expression of and IL-2 mutein will improve the therapeutic potential, includign for example, potential against a variety of refractory tumors, as well as provide for improved imaging capabilities.
  • an oncolytic adenovirus may be administered with a replication defective adenovirus, another oncolytic virus, a replication competent adenovirus, and/or a wildtype adenovirus. Each of which may be adminstered concurrently, before or after the other adenoviruses.
  • an El a adenoviral vectors involves the replacement of the basic adenovirus El a promoter, including the CAAT box, TATA box and start site for transcription initiation, with a basic promoter that exhibits tumor specificity, and preferably is E2F responsive, and more preferably is the human E2F-1 promoter.
  • this virus will be repressed in cells that lack molecules, or such molecules are non functional, that activate transcription from the E2F responsive promoter. Normal non dividing, or quiescent cells, fall in this class, as the transcription factor, E2F, is bound to pRb, or retinoblastoma protein, thus making E2F unavailable to bind to and activate the E2F responsive promoter.
  • cells that contain free E2F should support E2F based transcription.
  • An example of such cells are neoplastic cells that lack pRb function, allowing for a productive viral infection to occur.
  • an El a adenoviral vector is targeted use an IL-2 moiety as described herein.
  • an El a adenoviral vector is prepared by substituting the endogenous El a promoter with the E2F responsive promoter, the elements upstream of nucleotide 375 in the adenoviral 5 genome are kept intact.
  • the nucleotide numbering is as described by See, Schmid, S. I., and Hearing, P. Current Topics in Microbiology and Immunology, vol. 199: pages 67-80 (1995). This includes all of the seven A repeat motifs identified for packaging of the viral genome.
  • Sequences from nucleotide 375 to nucleotide 536 are deleted by a BsaAI to BsrBI restriction start site, while still retaining 23 base pairs upstream of the translational initiation codon for the El A protein.
  • An E2F responsive promoter preferably human E2F-1 is substituted for the deleted endogenous Ela promoter sequences using known materials and methods.
  • the E2F-1 promoter may be isolated as described in Example 1.
  • the E4 region has been implicated in many of the events that occur late in adenoviral infection, and is required for efficient viral DNA replication, late mRNA accumulation and protein synthesis, splicing, and the shutoff of host cell protein synthesis. Adenoviruses that are deficient for most of the E4 transcription unit are severely replication defective and, in general, must be propagated in E4 complementing cell lines to achieve high titers.
  • the E4 promoter is positioned near the right end of the viral genome and governs the transcription of multiple open reading frames (ORF). A number of regulatory elements have been characterized in this promoter that are critical for mediating maximal transcriptional activity. In addition to these sequences, the E4 promoter region contains regulatory sequences that are required for viral DNA replication. A depiction of the E4 promoter and the position of these regulatory sequences can be seen in FIGS. 2 and 3 of U.S. Patent No. 7,001,596, incorporated by reference herein in its entirety.
  • an E2F responsive promoter preferably an E2F responsive promoter
  • the tumor suppressor function of pRb correlates with its ability to repress E2F -responsive promoters such as the E2F-1 promoter (Adams, P. D., and W. G. Kaelin, Jr. 1995, Cancer Biol.
  • a virus carrying this (these) modification(s) would be expected to be attenuated in normal cells that contain an intact (wild type) pRb pathway, yet exhibit a normal infection/replication profde in cells that are deficient for pRb's repressive function.
  • ITR inverted terminal repeat
  • the E4 promoter is positioned near the right end of the viral genome and it governs the transcription of multiple open reading frames (ORFs) (Freyer, G. A., Y. Katoh, and R. J. Roberts. 1984, Nucleic Acids Res. 12:3503-19; Tigges, M. A., and H. J. Raskas. 1984. Splice junctions in adenovirus 2 early region 4 mRNAs: multiple splice sites produce 18 to 24 RNAs. J. Virol. 50:106-17; Virtanen, A. P. Gilardi, A. Naslund, J. M. LeMoullec, U. Pettersson, and M. Perricaudet.
  • ORFs open reading frames
  • E4 promoter region contains elements that are involved in viral DNA replication (Hatfield, L., and P. Hearing. 1993, J Virol. 67:3931-9; Rawlins, D. R., P. J. Rosenfeld, R. J.
  • an E4 promoter shuttle was designed by creating two novel restriction endonuclease sites: a Xhol site at nucleotide 35,576 and a Spel site at nucleotide 35,815 (see FIG. 3). Digestion with both Xhol and Spel removes nucleotides from 35,581 to 35,817. This effectively eliminates bases -208 to +29 relative to the E4 transcriptional start site, including all of the sequences that have been shown to have maximal influence on E4 transcription. In particular, this encompasses the two inverted repeats of E4F binding sites that have been demonstrated to have the most significant effect on promoter activation. However, all three Spl binding sites, two of the five ATF binding sites, and both of the NF1 and NFIII/Oct-1 binding sites that are critical for viral DNA replication are retained.
  • the E2F responsive promoter is the human E2F-1 promoter.
  • Key regulatory elements in the E2F-1 promoter that mediate the response to the pRb pathway have been mapped both in vitro and in vivo (Johnson, D. G, K. Ohtani, and J. R. Nevins. 1994, Genes Dev. 8:1514-25; Neuman, E., E. K. Flemington, W. R. Sellers, and W. G. Kaelin, Jr. 1995, Mol Cell Biol. 15:4660; Parr, M. J., Y. Manome, T. Tanaka, P. Wen, D. W. Kufe, W. G.
  • the subject IL-2 mutein either alone or as a part of a chimeric polypeptide (including a bispecific IL-2 cytokine fusion), such as those described above, can be obtained by expression of a nucleic acid molecule.
  • IL-2 muteins can be described in terms of their identity with wild-type IL-2 polypeptides, the nucleic acid molecules encoding them will necessarily have a certain identity with those that encode wild-type IL-2.
  • the nucleic acid molecule encoding a subject IL-2 mutein can be at least 50%, at least 65%, preferably at least 75%, more preferably at least 85%, and most preferably at least 95% (e.g., 99%) identical to the nucleic acid encoding wild-type IL-2 (e.g., SEQ ID NO:2).
  • the nucleic acid molecules provided can contain naturally occurring sequences, or sequences that differ from those that occur naturally, but, due to the degeneracy of the genetic code, encode the same polypeptide.
  • These nucleic acid molecules can consist of RNA or DNA (for example, genomic DNA, cDNA, or synthetic DNA, such as that produced by phosphoramidite- based synthesis), or combinations or modifications of the nucleotides within these types of nucleic acids.
  • the nucleic acid molecules can be double-stranded or single-stranded (i.e., either a sense or an antisense strand).
  • the nucleic acid molecules are not limited to sequences that encode polypeptides; some or all of the non-coding sequences that lie upstream or downstream from a coding sequence (e.g., the coding sequence of IL-2) can also be included.
  • a coding sequence e.g., the coding sequence of IL-2
  • Those of ordinary skill in the art of molecular biology are familiar with routine procedures for isolating nucleic acid molecules. They can, for example, be generated by treatment of genomic DNA with restriction endonucleases, or by performance of the polymerase chain reaction (PCR).
  • PCR polymerase chain reaction
  • the nucleic acid molecule is a ribonucleic acid (RNA) molecules can be produced, for example, by in vitro transcription.
  • Exemplary isolated nucleic acid molecules of the present disclosure can include fragments not found as such in the natural state.
  • this disclosure encompasses recombinant molecules, such as those in which a nucleic acid sequence (for example, a sequence encoding a mutant IL-2) is incorporated into a vector (e.g., a plasmid or viral vector) or into the genome of a heterologous cell (or the genome of a homologous cell, at a position other than the natural chromosomal location).
  • the subject IL-2 mutein may exist as a part of a chimeric polypeptide.
  • a subject nucleic acid molecule can contain sequences encoding a “marker” or “reporter.”
  • marker or reporter genes include b-lactamase, chloramphenicol acetyltransferase (CAT), adenosine deaminase (ADA), aminoglycoside phosphotransferase (neo r , G418 r ), dihydrofolate reductase (DHFR), hygromycin-B- hosphotransferase (HPH), thymidine kinase (TK), lacz (encoding b-galactosidase), and xanthine guanine phosphoribosyltransferase (XGPRT).
  • CAT chloramphenicol acetyltransferase
  • ADA adenosine deaminase
  • the subject nucleic acid molecules can be obtained by introducing a mutation into IL-2- encoding DNA obtained from any biological cell, such as the cell of a mammal.
  • the subject nucleic acids can be those of a mouse, rat, guinea pig, cow, sheep, horse, pig, rabbit, monkey, baboon, dog, or cat.
  • the nucleic acid molecules will be those of a human.
  • Targeted immunotherapy has emerged as promising field of research in the treatment of malignancies and has received a great deal of interest in recent years. Indeed, cures have been reported of lymphoma patients with engineered or genetically modified T cells targeting CD 19 malignant cells. This has increased the focus towards antigens present on cancer cells as targets for gene- and immunotherapy.
  • CARS can be used to target or deliver the bispecific IL-2 cytokine fusion and/or IL-2 muteins described herein to the tumor, or even allow for systemic IL-2 mutein expression.
  • the IL-2 mutein is any IL-2 mutein or variant disclosed herein.
  • the IL-2 mutein sequence is 90% identical to any one of SEQ ID NO:2 or SEQ ID NO:6 through SEQ ID NO: 10 or SEQ ID NO: 16.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; Bll SEQ ID NO: 10; C5 SEQ ID NO: 11; D10 SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • the substitutions in the IL-2 mutein comprise L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO: 2.
  • T-cells or NK cells Genetic manipulation of autologous or allogeneic T cells or NK cells to specifically target a particular tumor antigen provides a strategy to bypass the failure of cytotoxic immune response induction by most tumor cells.
  • these genetically manipulated T-cells or NK cells can be used to target the IL-2 muteins described herein to the the tumor, for example, so that the IL-2 mutein is expressed at the tumor location.
  • These technologies are based on the genetic modification of human immune cells, where the cells may be extracted from a patient or donor by leukapheresis. Specific cells, usually T-cells, are purified and engineered to express a receptor targeting a cancer antigen of interest.
  • the immune cells may be expanded to the desired dose, and introduced into a patient.
  • the engineered cells can specifically kill cancer cells through cell-mediated toxicity (cytotoxic T-cells) and/or eliciting an immune response to the cancer cell by immune recognition of tumor, cytokine release and immune cell recruitment.
  • cytotoxic T-cells cell-mediated toxicity
  • eliciting an immune response to the cancer cell by immune recognition of tumor, cytokine release and immune cell recruitment cytotoxic T-cells
  • CAR chimeric antigen receptors
  • the resulting CAR immune cells are redirected by the neospecificity to attack tumors expressing the surface antigen or receptors recognized by the gene-modified T cell receptors and provide cellular therapy that attacks the tumor through normal host immune response in a highly regulated fashion. These cells are free to circulate throughout the brain and systemic circulation, making the need for colocalization and bioavailability less of a problem.
  • CARs are created by the fusion of a tumour-specific scFv antibody or other extracellular ligand binding domain to either the TCR-associated CD3z signalling domain or another intracellular signalling domains from co-stimulatory protein receptors. This structure allows CARs to have the tumor specificity of the B cell antigen receptor, and to activate T cells through the T cell antigen receptor independently of MHC binding.
  • the first-generation CAR contained one intracellular signalling domain, typically with the CD3z signalling domain to allow for TCR signalling.
  • Second-generation CARs have two intracellular signalling domains: a co-stimulatory domain comprising either a CD28 or a 4-1BB signalling domain, coupled with a CD3z signalling domain. This arrangement enables T-cell activation and proliferation upon antigen recognition by the scFv region of the CAR.
  • the third- generation CARs have two co-stimulatory domains and a CD3z signalling domain.
  • the first co stimulatory domain is either a CD28 or a 4-1BB domain, with the second co-stimulatory domain consisting of either a CD28, a 4-1BB or a 0X40 domain.
  • Fourth-generation “armoured CAR T cells” combine a second-generation CAR with the addition of various genes, including cytokine and co-stimulatory ligands, to enhance the tumoricidal effect of the CAR T cells. See, for example, Batlevi et al. (2016) Nature Reviews Clinical Oncology 13:25-40. See also, US Patent No. 7,741,465 and International Patent Publication No. WO2014127261; all of which are incorporated by reference herein in their entireties.
  • T cell antigen couplers as described in International application WO2015/117229, entitled “Trifunctional T cell antigen Coupler and Methods and Uses thereof’, herein specifically incorporated by reference.
  • the T cell antigen coupler system comprises three linked domains: a target-specific polypeptide ligand; a ligand that binds a protein associated with the TCR complex, for example an scFv binding to CD3 (TCR, T- cell receptor) to stimulate T cell activation; and a T cell receptor signaling domain, for example a CD4 transmembrane and intracellular domain to amplify T cell activation.
  • TACs were engineered to work with the T cell’s essential molecular machinery.
  • Antibody coupled T cell receptors are another approach to T cell targeting.
  • ACTRs are a hybrid approach to CARs and the established monoclonal antibody oncology therapeutics.
  • ACTRs are composed of a typical CAR construct that can bind the heavy chain of an antibody through a high-affinity variant of the Fc receptor CD 16.
  • ACTR-T cells can target tumours by binding a ligand targeted to a specific cancer antigen. T cell activation is performed by the CAR module.
  • Bispecific T cell exchangers are bispecific antibodies that can bind the TCR of T cells and target tumour cells through two modules: a cancer targeting ligand; and a CD3 -binding scFv domain that bridges T cells to the tumor.
  • bi-specific fusion proteins comprising a superkine may also be referred to as Bi-functional SuperKines as ImmunoTherapies (BiSKITs).
  • novel interleukin super-agonists, partial agonists, and super antagonists are designed using directed evolution.
  • rational approaches are used to further design long-acting IL-2, IL-4, and IL-13 Superkines without masking functional activity.
  • a platform using directed evolution together with yeast display results in tunable superkines.
  • such platform generates an extensive library of IL-2, IL-4, and IL-13 superkines with unique properties (Figure 55).
  • MDNA109 is an engineered version of human IL-2 showing enhanced agonist activity ( Figure 56).
  • MDNA109 family of TL-2 Superkines’ have been engineered to improve PK characteristics and enhance selectivity to further improve therapeutic window ( Figure 57).
  • MDNA11 is a ‘Beta-Only’ superkine with uniquely enhanced affinity for CD122 (Figure 58). In some embodiments, MDNA11 preferentially stimulates immune effector cells (Figure 59). In some embodiments, MDNA11 shows monotherapy anti-tumor efficacy and combination effect with anti-PDl in MC38 tumor model ( Figure 60). In some embodiments, MDNA11 together with Anti-CTLA4 induces tumor clearance, protects against re challenges, and promotes antigen-specific CD8 T-cells ( Figure 61). In some embodiments,
  • MDNA1 1 induces durable and sustained proliferation and expansion of immune effector cells but not T regs in NHP ( Figure 62).
  • Superkine Targeted with Antibody enhances accumulation in tumors ( Figure 63).
  • STAb overcomes checkpoint resistance and ‘cold’ tumors ( Figure 64).
  • IL-4 and IL-13 receptors play a role in cancer ( Figure 65).
  • MDNA55 is an empowered Superkine with a potent payload targeting Type 2 IL-4R expressed on tumor cells and tumor microenvironment (MDSC and TAM).
  • MDNA413 is a super-antagonist blocking IL-4 and IL-13 signaling via type 2 IL-4R to suppress MDSC and TAM.
  • MDNA 132 is a superkine that selectively targets decoy IL-13Ra2 that is overexpressed on solid tumors.
  • MDNA132 is an engineered version of human IL-13 targeting tumor specific antigen ( Figure 66).
  • MDNA132 plays a role in localizing T-cell engager and checkpoint inhibitor to tumors ( Figure 67).
  • MDNA413 is an engineered version of human IL-13 showing antagonist activity ( Figure 68). In some embodiments, Fc-MDNA413 inhibits IL-4 and IL-13 induced signaling and function ( Figure 69).
  • a dual specific cytokine is MDNA109FEAA-Fc- MDNA413 and has a mechanism of action as shown in Figure 70.
  • Targeted therapies have been developed against IL13Ra2, including bacterial toxins conjugated to IL13, nanoparticles, oncolytic virus, as well as immunotherapies using monoclonal antibodies, IL13Ra2 -pulsed dendritic cells, and IL13Ra2 -targeted chimeric antigen receptors (see Kahlon et al. (2004) Cancer Research. 64(24): 9160-9166; Kong et al. (2012) Clinical Cancer Research. 18(21):5949-5960; Thaci et al. (2014) Neuro-Oncology; and clinical trials NCT02208362, NCT00730613 and NCT01082926). In some emnodiemtns, these targeted therapies can be used to deliver the IL-2 muteins to the tumor.
  • Biologicals that provide for selective alteration of IL-13 activity are of interest for a number of therapeutic purposes, including the treatment of certain cancers with by engineering of T cell specificities.
  • the present invention addresses this issue.
  • compositions for enhancing anti-tumor immune effector cells, e.g. T cells, NK cells, etc. with targeted compositions, including without limitation chimeric antigen receptors (CARs); T cell antigen couplers (TACs); antibody coupled T cell receptors (ACTRs); and bispecific T cell exchangers (BiTEs), where an IL-13 or IL-4 superkine provides the target-specific ligand.
  • CARs chimeric antigen receptors
  • TACs T cell antigen couplers
  • ACTRs antibody coupled T cell receptors
  • BiTEs bispecific T cell exchangers
  • the immune effector cell expresses an IL-2 mutein.
  • Immune cell targeting or expression constructs comprising IL-2 superkine sequences are provided and can include any IL-2 sequence as described herein.
  • Superkines are useful for targeting immune cells to cells, e.g. tumor cells, expressing the at least one receptor.
  • the IL-2 mutein is any IL-2 mutein or variant disclosed herein.
  • the IL-2 mutein sequence is 90% identical to any one of SEQ ID NO:2 or SEQ ID NO:6 through SEQ ID NO: 10 or SEQ ID NO: 16.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; Bll SEQ ID NO: 10; C5 SEQ ID NO: 11; D10 SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • the substitutions in the IL-2 mutein comprise L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 superkine or mutein component of the construct may be at least about 50 amino acids in length, at least about 75, at least about 100, at least about 110, at least about 115 amino acids in length, up to the full-length of the wild-type protein at the transmembrane domain, i.e. about 116 amino acids in length.
  • the superkine or mutein may be fused to the hinge, transmembrane or signaling domains of a CAR.
  • Exemplary polypeptide sequences are provided
  • amino acid and nucleic acid coding sequences that are 90%, 95%, 98% or 99% identical to these sequences, longer sequences that comprise those sequences but also include additional nucleotides at the 3' or 5' end, for example any number of additional nucleotides or codons, such as 3, 6, 9, 12 or more nucleotides, or up to about 12, 20, 50 or 100 additional nucleotides, and any sequence that encodes the same amino acid sequence as these nucleic acids due to the degeneracy of the genetic code.
  • sequences that are codon optimized (CO) for expression by the desired host are contemplated as part of the invention.
  • the amino acid seqeunce is 90% identical. In some embodiments, the amino acid sequence is 95% identical. In some embodiments, the amino acid seqeunce is 98% identical. In some embodiments, the amino acid sequence is 99% identical.
  • the polypeptide is linked to an IL-2 superkine immune cell targeting or expression construct. In some embodiments, an IL-2 superkine immune cell targeting or expression construct comprises one or more signaling domains derived from 0O3-z, CD28, DAP10, OX-40, ICOS and CD137. In some embodiments, an IL-2 superkine immune cell targeting or expression construct or expression comprises one or more signaling domains derived from 0 ⁇ 3-z.
  • an IL-2 superkine immune cell targeting or expression construct comprises one or more signaling domains derived from CD28. In some embodiments, an IL-2 superkine immune cell targeting or expression construct comprises one or more signaling domains derived from DAP 10. In some embodiments, an IL-2 superkine immune cell targeting or expression construct comprises one or more signaling domains derived from OX-40. In some embodiments, an IL-2 superkine immune cell targeting or expression construct comprises one or more signaling domains derived from CD137. In some embodiments, an IL-2 superkine immune cell targeting or expression construct comprises an IL-2 variant/IL-2 superkine including those provided herein. In some embodiments, an IL- 2superkine immune cell targeting or expression construct comprises an IL-2 variant/IL-2 superkine including those provided in SEQ ID NO:2 through SEQ ID NO: 38.
  • the immune cells are natural killer (NK) cells.
  • NK cells recognize infected or transformed cells through multiple cell surface receptors including NKG2D, CD 16, and natural cytotoxicity receptors (NCRs) such as NKp44, NKp46, andNKp30. These receptors activate signaling adapter proteins such as DAP 10, DAP 12, and € ⁇ 3z. which contain immuno- tyrosine activation motifs (IT AMs) that initiate the release of cytolytic granules containing perforin and granzymes, as well as mediate production and release of cytokines and chemokines such as IFN-g and TNF-a.
  • IT AMs immuno- tyrosine activation motifs
  • NK cell-mediated cytotoxicity does not rely on the presentation of self HLA. Therefore, NK cells hold significant clinical interest as a cell-based therapy for cancer because of their ability to be used in an allogeneic setting and potentially provide an off-the-shelf cellular product.
  • Natural killer cells provide an alternative to the use of T cells for adoptive immunotherapy since they do not require HLA matching, so can be used as allogeneic effector cells.
  • Clinical trials of adoptively transferred allogeneic NK cells demonstrate these cells can survive in patients for several weeks to months. Additionally, expression of CARs in NK cells allow these cells to more effectively kill solid tumors that are often resistant to NK cell-mediated activity compared to hematologic malignancies (especially acute myelogenous leukemia) that are typically more NK cell-sensitive.
  • CARs useful in NK cell targeting include, for example, first generation CAR constructs that contain CD3z as the sole signaling domain. Second and third generation CARs are also useful in NK cells.
  • NK cells for modification include cell lines, or peripheral blood NK cells, which can be isolated from donors through simple blood draws or by apheresis if larger numbers of cells are needed.
  • Activated PB-NK cells express a wider range of activating receptors, such as CD 16, NKp44, and NKp46 as well as KIRs, which play an important role in NK cell licensing.
  • PB-NK cells can be given without irradiating the cells so have the ability to expand in vivo.
  • NK cells suitable for CAR expression are NK cells derived from human pluripotent stem cells - both induced pluripotent stem cells (iPSCs) or human embryonic stem cells (hESCs). These NK cells display a similar phenotype to PB-NK cells, and hESC/iPSC-NK cells can be grown on a clinical scale.
  • iPSCs induced pluripotent stem cells
  • hESCs human embryonic stem cells
  • CARs contain the signaling domain for CD3z and the signaling domains of one or more costimulatory receptors that further promote the recycling, survival and/or expansion of immune cells expressing the CARs.
  • the signaling domains of the costimulatory receptors are the intracellular portions of each receptor protein that generate the activating signal in the cell. Examples are amino acids 180-220 of the native CD28 molecule and amino acids 214-255 of the native 4- IBB molecule.
  • Examples of suitable hinge and transmembrane regions to link the superkine to the signaling region may include without limitation the constant (Fc) regions of immunoglobins, human CD8a, and artificial linkers that serve to move the targeting moiety away from the cell surface for improved access to and binding on target cells.
  • suitable transmembrane domains include the transmembrane domains of the leukocyte CD markers, preferably that of CD4 or CD28.
  • intracellular receptor signaling domains include the T cell antigen receptor complex, preferably the zeta chain of CD3, however any transmembrane region sufficient to anchor the CAR in the membrane can be used.
  • T cell costimulatory signaling receptors suitable for improving the function and activity of CAR-expressing cells include, but are not limited to, CD28, CD137, and OX-40.
  • CD137 a tumor necrosis factor-receptor family member expressed following CD28 activation
  • OX-40 are involved in driving long-term survival of T cells, and accumulation of T cells.
  • the ligands for these receptors typically are expressed on professional antigen presenting cells such as dendritic cells and activated macrophages, but not on tumor cells.
  • CD28 and/or 4-1BB signaling domains in CD4 + T cells enhances the activity and anti-tumor potency of those cells compared to those expressing a CAR that contains only the CD3z signaling domain, which constructs may be referred to as second or third generation CARs.
  • CAR constructs of interest include tandem CARs, e.g. see Hegde et al. (2016) J. Clin. Invest 126(8):3036-3052, herein specifically incorporated by reference.
  • a binding moiety for a tumor specific antigen is combined in tandem with an IL-13 superkine.
  • the binding moiety may be, for example, an scFv specific for a tumor cell antigen, including without limitation HER-2, EGFR, CD20, etc. as known in the art.
  • the antigen binding domain binds to an antigen on a target cell, e.g., a cancer cell.
  • the antigen binding domain can bind an antigen, such as but not limited to a tumor target antigen.
  • the antigen binding domain binds one or more antigens.
  • Exemplary antigen binding domains can bind to an antigen including, but not limited to, D19; CD123; CD22; CD30; CD171; CS-1 (also referred to as CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24); C-type lectin-like molecule-1 (CLL-1 or CLECL1); CD33; epidermal growth factor receptor variant III (EGFRvIII); ganglioside G2 (GD2); ganglioside GD3; TNF receptor family member B cell maturation (BCMA); Tn antigen ((Tn Ag) or (GalNAca Ser/Thr)); prostate-specific membrane antigen (PSMA); Receptor tyrosine kinase-like orphan receptor 1 (ROR1); Fms-Like Tyrosine Kinase 3 (FLT3); Tumor-associated glycoprotein 72 (TAG72); CD38; CD44v6; Carcinoembryonic antigen (CEA); Epithelial cell adhesion
  • the antigen binding domain comprises a monoclonal antibody, a polyclonal antibody, a synthetic antibody, a human antibody, a humanized antibody, a non-human antibody, a nanobody, a single-chain variable fragment (scFv), F(ab')2, Fab', Fab, Fv, and the like.
  • the antigen binding domain can be linked to the transmembrane domain of the CAR.
  • a nucleic acid encoding the antigen binding domain is operably linked to a nucleic acid encoding a transmembrane domain of the CAR.
  • the transmembrane domain can be derived from a membrane- bound or transmembrane protein.
  • the transmembrane domain comprises one or more, e.g., 1, 2, 3, 4, 5, 6, 7, 8 or more amino acid modifications (e.g., substitutions, insertions, and deletions) compared to the wild-type amino acid sequence of the transmembrane domain of the membrane-bound or transmembrane protein.
  • Non-limiting examples of a transmembrane domain of a CAR include at least the transmembrane region(s) of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon ( ⁇ 3x), CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, or an erythropoietin receptor.
  • the transmembrane domain includes a human immunoglobulin (Ig) hinge region, e.g., an IgG4Fc hinge.
  • the transmembrane domain is a recombinant or synthetic domain comprising hydrophobic amino acid residues (e.g., leucine and valine).
  • the transmembrane domain includes a phenylalanine, tryptophan and valine at one or both ends of the domain.
  • the transmembrane domain links the antigen binding domain to the intracellular signaling domain of the CAR.
  • the nucleic acid encoding the antigen binding domain is operably linked to the nucleic acid encoding the transmembrane domain that is operably linked to the nucleic acid encoding the intracellular signaling domain.
  • the intracellular signaling domain of a CAR comprises a signal activation or signal transduction domain.
  • an intracellular signaling domain includes any portion of an intracellular signaling domain of a protein sufficient to transduce or transmit a signal, e.g., an activation signal or to mediate a cellular response within a cell.
  • Non-limiting examples include TCR, CD2, CD3 zeta, CD3 gamma, CD3 delta, CD3 epsilon, CD7, CD27, CD86, common FcR gamma, FcR beta, CD79a, CD79b, Fcgamma Rlla, DAP10, DAP12, T cell receptor (TCR), CD27, CD28, 4-1BB (CD137), 0X40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen- 1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, CDS, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRFl), CD 127, CD 160, CD 19, CD4, CD8alpha, CD8 beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, V
  • the intracellular signaling domain comprises an intracellular domain of a co-stimulatory molecule such as from CD3, CD27, CD28, CD127, ICOS, 4-1BB (CD137), PD-1, T cell receptor (TCR), any derivative thereof, or any variant thereof.
  • a co-stimulatory molecule such as from CD3, CD27, CD28, CD127, ICOS, 4-1BB (CD137), PD-1, T cell receptor (TCR), any derivative thereof, or any variant thereof.
  • the intracellular signaling domain of the CAR is selected from the group consisting of a MHC class I molecule, a TNF receptor protein, an Immunoglobulin-like protein, a cytokine receptor, an integrin, a signaling lymphocytic activation molecule (SLAM protein), an activating NK cell receptor, BTLA, a Toll ligand receptor, 0X40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1 (CD1 la/CD18), 4-1BB (CD137), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRFl), NKp44, NKp30, NKp46, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7
  • Bi-specific T-cell engagers are fusion proteins comprising an IL-13 superkine fused to an antibody variable region that specifically binds to CD3.
  • THe superkine may be fused to the variable region through a linker.
  • An Fc region is optionally provided.
  • a TAC construct comprises an IL-2 superkine fused to a ligand that binds a protein associated with the TCR complex; fused to a T cell receptor signaling domain polypeptide.
  • the domains may be separated by linkers.
  • the protein associated with the TCR complex may be CD3.
  • the ligand that binds a protein associated with the TCR complex may be a single chain antibody.
  • the ligand that binds a protein associated with the TCR complex may be UCHT1, or a variant thereof.
  • the T cell receptor signaling domain polypeptide may comprise a cytosolic domain and a transmembrane domain.
  • the cytosolic domain may be a CD4 cytosolic domain and the transmembrane domain is a CD4 transmembrane domain.
  • ACTRs are a hybrid approach to CARs and the established monoclonal antibody oncology therapeutics.
  • ACTRs are composed of atypical CAR construct that can bind the heavy chain of an antibody through a high-affinity variant of the Fc receptor CD16.
  • a superkine is fused to a moiety recognized by the CAR, which may include, without limitation, an Fc region of an antibody with high affinity for CD 16.
  • An immune cell targeting or expression construct coding sequence can be produced by any means known in the art, including recombinant DNA techniques. Nucleic acids encoding the several regions of the chimeric receptor can be prepared and assembled into a complete coding sequence by standard techniques of molecular cloning known in the art (genomic library screening, PCR, primer-assisted ligation, site-directed mutagenesis, etc.) as is convenient. The resulting coding region may be inserted into an expression vector and used to transform a suitable expression host cell line, e.g. a population of allogeneic or autologous T lymphocytes, allogeneic or autologous NK cells, including primary cultures, cell lines, iPSC derived cells, etc.
  • a suitable expression host cell line e.g. a population of allogeneic or autologous T lymphocytes, allogeneic or autologous NK cells, including primary cultures, cell lines, iPSC derived cells, etc.
  • the methods can be used on cells in vitro (e.g., in a cell-free system), in culture, e.g. in vitro or ex vivo.
  • IL-2 superkine CAR-expressing cells can be cultured and expanded in vitro in culture medium.
  • An non-IL-2 superkine immune cell targeting or expression construct can also be sused specifically direct immune cells to target specific tumor cells.
  • Anti -tumor effector cells e.g. CD4 + or CD8 + effector T cells
  • CD4 + or CD8 + effector T cells are generated to be re-directed to recognize such tumor cells by introducing into the T cells an superkine immune cell targeting or expression construct comprising one or more signaling domains derived from O ⁇ 3-z, CD28, DAP10, OX-40, ICOS and CD137.
  • the cells can further comrpise a transgene capable of expressing an IL-2 mutein as described herein.
  • An IL-2 superkine immune cell targeting or expression construct can specifically direct immune cells to target IL-2R expressing cell, including tumor cells.
  • Anti-tumor effector cells e.g. CD4 + or CD8 + effector T cells, are generated to be re-directed to recognize such tumor cells by introducing into the T cells an IL-2 superkine immune cell targeting or expression construct comprising one or more signaling domains derived from O ⁇ 3-z, CD28, DAP10, OX-40, ICOS and CD137.
  • the IL-2 superkine immune cell targeting or expression construct is infected or transfected into human immune cells, e.g. using a non-viral plasmid vector and electroporation methods; a viral vector and infection methods, etc. as known in the art.
  • a CAR comprising co stimulatory signaling domains may enhance the duration and/or retention of anti-tumor activity in a manner that can significantly improve the clinical efficacy of adoptive therapy protocols.
  • CD4 + and CD8 + T cell effector functions, and NK cell functions can be triggered via these receptors, therefore these cell types are contemplated for use with the invention.
  • CD8 + T cells expressing the IL13 superkine CARs of this invention may be used to lyse target cells and to produce IL-2 in the presence of target cells, among the other functions of these cells. Expression of the appropriate costimulatory CAR in either or both CD4 + and CD8 + T cells is used to provide the most effective population of cells for adoptive immunotherapy, consisting therefore of either or both professional helper and killer T cells that exhibit enhanced and/or long term viability and anti-tumor activity.
  • an IL-2 superkine immune cell targeting or expression construct comprises an IL-2 variant/IL-2 superkine including those provided in Figure 2.
  • an IL-2 superkine immune cell targeting or expression construct comprises an IL-2 variant/IL-2 superkine including any of those provided herein.
  • Polypeptides of the present invention can be further modified, e.g., joined to a wide variety of other oligopeptides or proteins for a variety of purposes.
  • post- translationally modified for example by prenylation, acetylation, amidation, carboxylation, glycosylation, pegylation, etc.
  • modifications can also include modifications of glycosylation, e.g. those made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing or in further processing steps; e.g. by exposing the polypeptide to enzymes which affect glycosylation, such as mammalian glycosylating or deglycosylating enzymes.
  • T cell targeting construct expression vectors containing coding sequences and appropriate transcriptional/translational control signals can be used to construct T cell targeting construct expression vectors containing coding sequences and appropriate transcriptional/translational control signals. These methods include, for example, in vitro recombinant DNA techniques, synthetic techniques and in vivo recombination/genetic recombination. Alternatively, RNA capable of encoding the polypeptides of interest may be chemically synthesized. One of skill in the art can readily utilize well-known codon usage tables and synthetic methods to provide a suitable coding sequence for any of the polypeptides of the invention. The nucleic acids may be isolated and obtained in substantial purity.
  • the nucleic acids will be obtained substantially free of other naturally-occurring nucleic acid sequences, generally being at least about 50%, usually at least about 90% pure and are typically “recombinant,” e.g., flanked by one or more nucleotides with which it is not normally associated on a naturally occurring chromosome.
  • the nucleic acids of the invention can be provided as a linear molecule or within a circular molecule, and can be provided within autonomously replicating molecules (vectors) or within molecules without replication sequences. Expression of the nucleic acids can be regulated by their own or by other regulatory sequences known in the art.
  • the nucleic acids of the invention can be introduced into suitable host cells using a variety of techniques available in the art.
  • immune cell targeting or expression construct vectors and immune cell targeting or expression construct modified cells can be provided in pharmaceutical compositions suitable for therapeutic use, e.g. for human treatment.
  • pharmaceutical compositions of the present invention include one or more therapeutic entities of the present invention or pharmaceutically acceptable salts, esters or solvates thereof.
  • pharmaceutical compositions of the present invention include one or more therapeutic entities of the present invention in combination with another therapeutic agent, e.g., another anti-tumor agent.
  • Therapeutic entities of the present invention are often administered as pharmaceutical compositions comprising an active therapeutic agent and another pharmaceutically acceptable excipient.
  • Such formulations can include one or more non-toxic pharmaceutically acceptable carriers, diluents, excipients and/or adjuvants. The preferred form depends on the intended mode of administration and therapeutic application.
  • the compositions can also include, depending on the formulation desired, pharmaceutically-acceptable, non-toxic carriers or diluents, which are defined as vehicles commonly used to formulate pharmaceutical compositions for animal or human administration. The diluent is selected so as not to affect the biological activity of the combination.
  • compositions or formulation may also include other carriers, adjuvants, or nontoxic, nontherapeutic, nonimmunogenic stabilizers and the like.
  • compositions of the present invention can also include large, slowly metabolized macromolecules such as proteins, polysaccharides such as chitosan, polylactic acids, polyglycolic acids and copolymers (such as latex functionalized SepharoseTM, agarose, cellulose, and the like), polymeric amino acids, amino acid copolymers, and lipid aggregates (such as oil droplets or liposomes).
  • macromolecules such as proteins, polysaccharides such as chitosan, polylactic acids, polyglycolic acids and copolymers (such as latex functionalized SepharoseTM, agarose, cellulose, and the like), polymeric amino acids, amino acid copolymers, and lipid aggregates (such as oil droplets or liposomes).
  • the maximum tolerated dose (MTD) of CAR immune cells may be determined during clinical trial development, for example at up to about 10 4 T cells/kg of body weight, up to about 10 5 cells/kg of body weight, up to about 10 6 cells/kg of body weight, up to about 5 x 10 6 cells/kg of body weight, up to about 10 7 cells/kg of body weight, up to about 5 x 10 7 cells/kg of body weight, or more, as empirically determined. In some embodiments, the maximum tolerated dose (MTD) of CAR immune cells is up to about 10 4 T cells/kg of body weight. In some embodiments, the maximum tolerated dose (MTD) of CAR immune cells is up to about 10 5 T cells/kg of body weight.
  • the maximum tolerated dose (MTD) of CAR immune cells is up to about 10 6 T cells/kg of body weight. In some embodiments, the maximum tolerated dose (MTD) of CAR immune cells is up to about 10 7 T cells/kg of body weight. In some embodiments, the maximum tolerated dose (MTD) of CAR immune cells is up to about 5 x 10 6 T cells/kg of body weight. In some embodiments, the maximum tolerated dose (MTD) of CAR immune cells is up to about 5 x 10 7 T cells/kg of body weight.
  • Toxicity of the cells described herein can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., by determining the LD 50 (the dose lethal to 50% of the population) or the LD 100 (the dose lethal to 100% of the population). The dose ratio between toxic and therapeutic effect is the therapeutic index.
  • the data obtained from these cell culture assays and animal studies can be used in formulating a dosage range that is not toxic for use in human.
  • the dosage of the described herein lies preferably within a range of circulating concentrations that include the effective dose with little or no toxicity. The dosage can vary within this range depending upon the dosage form employed and the route of administration utilized. The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition.
  • patients in the expansion cohort are treated with immune cells at the MTD.
  • An exemplary treatment regime entails administration once every two weeks or once a month or once every 3 to 6 months.
  • Therapeutic entities of the present invention are usually administered on multiple occasions. Intervals between single dosages can be weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of the therapeutic entity in the patient.
  • a relatively low dosage may be administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In other therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patent can be administered a prophylactic regime.
  • Examples of additional therapeutic agents that can be coadministered and/or coformulated with an immune cell targeting or expression construct include: anti-proliferative, or cytoreductive therapy, which is used therapeutically to eliminate tumor cells and other undesirable cells in a host, and includes the use of therapies such as delivery of ionizing radiation, and administration of chemotherapeutic agents.
  • Chemotherapeutic agents are well-known in the art and are used at conventional doses and regimens, or at reduced dosages or regimens, including for example, topoisomerase inhibitors such as anthracyclines, including the compounds daunorubicin, adriamycin (doxorubicin), epirubicin, idarubicin, anamycin, MEN 10755, and the like.
  • topoisomerase inhibitors include the podophyllotoxin analogues etoposide and teniposide, and the anthracenediones, mitoxantrone and amsacrine.
  • Other anti-proliferative agent interferes with microtubule assembly, e.g. the family of vinca alkaloids.
  • vinca alkaloids examples include vinblastine, vincristine; vinorelbine (NAVELBINE); vindesine; vindoline; vincamine; etc.
  • DNA- damaging agent include nucleotide analogs, alkylating agents, etc.
  • Alkylating agents include nitrogen mustards, e.g. mechlorethamine, cyclophosphamide, melphalan (L-sarcolysin), etc.; and nitrosoureas, e.g. carmustine (BCNU), lomustine (CCNU), semustine (methyl-CCNU), streptozocin, chlorozotocin, etc.
  • Nucleotide analogs include pyrimidines, e.g.
  • cytarabine CYTOSAR-U
  • cytosine arabinoside fluorouracil (5-FU), floxuridine (FUdR), etc.
  • purines e.g. thioguanine (6-thioguanine), mercaptopurine (6-MP), pentostatin, fluorouracil (5-FU) etc:
  • folic acid analogs e.g. methotrexate, 10-propargyl-5,8-dideazafolate (PDDF, CB3717), 5,8- dideazatetrahydrofolic acid (DDATHF), leucovorin, etc.
  • Other chemotherapeutic agents of interest include metal complexes, e.g. cisplatin (cis-DDP), carboplatin, oxaliplatin, etc.; ureas, e.g. hydroxyurea; and hydrazines, e.g. N-methylhydrazine.
  • ionizing radiation is used to treat about 60% of cancer patients, by depositing energy that injures or destroys cells in the area being treated, and for the purposes of the present invention may be delivered at conventional doses and regimens, or at reduced doses.
  • Radiation injury to cells is nonspecific, with complex effects on DNA. The efficacy of therapy depends on cellular injury to cancer cells being greater than to normal cells. Radiotherapy may be used to treat every type of cancer. Some types of radiation therapy involve photons, such as X-rays or gamma rays.
  • Another technique for delivering radiation to cancer cells is internal radiotherapy, which places radioactive implants directly in a tumor or body cavity so that the radiation dose is concentrated in a small area.
  • a suitable dose of ionizing radiation may range from at least about 2 Gy to not more than about 10 Gy, usually about 5 Gy.
  • a suitable dose of ultraviolet radiation may range from at least about 5 J/m 2 to not more than about 50 J/m 2 , usually about 10 J/m 2
  • the sample may be collected from at least about 4 and not more than about 72 hours following ultraviolet radiation, usually around about 4 hours.
  • Treatment may also be combined with immunoregulatory modulating agents, including an agent that agonizes an immune costimulatory molecule, e.g. CD40, 0X40, etc.; and/or (iii) an agent that antagonizes an immune inhibitory molecule, e.g. CTLA-4, PD-1, PD-L1, etc.
  • the active agents are administered within a period of time to produce an additive or synergistic effect on depletion of cancer cells in the host. Methods of administration include, without limitation, systemic administration, intra-tumoral administration, etc.
  • an individual cancer is selected for treatment with a combination therapy because the cancer is a cancer type that is responsive to a checkpoint inhibitor, e.g. a PD-1 antagonist, a PD-L1 antagonist, a CTLA4 antagonist, a TIM-3 antagonist, a BTLA antagonist, a VISTA antagonist, a LAG3 antagonist; etc.
  • a checkpoint inhibitor e.g. a PD-1 antagonist, a PD-L1 antagonist, a CTLA4 antagonist, a TIM-3 antagonist, a BTLA antagonist, a VISTA antagonist, a LAG3 antagonist; etc.
  • such an immunoregulatory agent is a CTLA-4, PD1 or PDL1 antagonist, e.g. avelumab, nivolumab, pembrolizumab, ipilimumab, and the like.
  • the cancer is, without limitation, melanoma or small cell lung cancer.
  • the cancer is a type that has a high ne
  • an individual cancer is selected for treatment with a combination therapy of the present invention because the cancer is a cancer type that is responsive to an immune response agonist, e.g. a CD28 agonist, an 0X40 agonist; a GITR agonist, a CD137 agonist, a CD27 agonist, an HVEM agonist, etc.
  • an immunoregulatory agent is an 0X40, CD137, or GITR agonist e.g. tremelimumab, and the like.
  • the cancer is, without limitation, melanoma or small cell lung cancer.
  • the cancer is a type that has a high neoantigen, or mutagenesis, burden.
  • the combination therapy includes an antibody known in the art which binds to PD-1 and disrupt the interaction between the PD-1 and its ligand, PD-L1, and stimulate an anti-tumor immune response.
  • the antibody or antigen-binding portion thereof binds specifically to PD-1.
  • antibodies that target PD-1 and which can find used in the present invention include, e.g., but are not limited to nivolumab (BMS-936558, Bristol-Myers Squibb), pembrolizumab (lambrolizumab, MK03475 or MK-3475, Merck), humanized anti-PD-1 antibody JS001 (ShangHai JunShi), monoclonal anti-PD-1 antibody TSR-042 (Tesaro, Inc.), Pidilizumab (anti-PD-1 mAh CT-011, Medivation), anti-PD-1 monoclonal Antibody BGB-A317 (BeiGene), and/or anti-PD-1 antibody SHR-1210 (ShangHai HengRui), human monoclonal antibody REGN2810 (Regeneron), human monoclonal antibody MDX-1106 (Bristol- Myers Squibb), and/or humanized anti-PD-1 IgG4 antibody PDR001 (Novartis).
  • the PD-1 antibody is from clone: RMP1-14 (rat IgG) - BioXcell cat# BP0146.
  • Other suitable antibodies include anti-PD-1 antibodies disclosed in U.S. Patent No. 8,008,449, herein incorporated by reference.
  • the antibody or antigen-binding portion thereof binds specifically to PD-L1 and inhibits its interaction with PD-1, thereby increasing immune activity. Any antibodies known in the art which bind to PD-L1 and disrupt the interaction between the PD-1 and PD-L1, and stimulates an anti-tumor immune response, are suitable for use in the combination treatment methods disclosed herein.
  • antibodies that target PD-L1 and are in clinical trials include BMS-936559 (Bristol-Myers Squibb) and MPDL3280A (Genetech).
  • BMS-936559 Bristol-Myers Squibb
  • MPDL3280A Genetech
  • Other suitable antibodies that target PD-L1 are disclosed in U.S. Patent No. 7,943,743, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to PD-1 or PD-L1, disrupts the PD-1/PD-L1 interaction, and stimulates an anti -tumor immune response, is suitable for use in the combination treatment methods.
  • the combination therapy includes an antibody known in the art which binds CTLA-4 and disrupts its interaction with CD80 and CD86.
  • Exemplary antibodies that target CTLA-4 include ipilimumab (MDX-010, MDX-101, Bristol-Myers Squibb), which is FDA approved, and tremelimumab (ticilimumab, CP-675, 206, Pfizer), currently undergoing human trials.
  • Other suitable antibodies that target CTLA-4 are disclosed in WO 2012/120125, U.S. Patents No. 6,984720, No. 6,682,7368, and U.S. Patent Applications 2002/0039581, 2002/0086014, and 2005/0201994, herein incorporated by reference.
  • the combination therapy includes an antibody known in the art which binds LAG-3 and disrupts its interaction with MHC class II molecules.
  • An exemplary antibody that targets LAG- 3 is IMP321 (Immutep), currently undergoing human trials.
  • Other suitable antibodies that target LAG-3 are disclosed in U.S. Patent Application 2011/0150892, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to LAG-3, disrupts its interaction with MHC class II molecules, and stimulates an anti-tumor immune response, is suitable for use in the combination treatment methods.
  • the combination therapy includes an antibody known in the art which binds TIM-3 and disrupts its interaction with galectin 9.
  • Suitable antibodies that target TIM- 3 are disclosed in U.S. Patent Application 2013/0022623, herein incorporated by reference. It will be understood by one of ordinary skill that any antibody which binds to TIM-3, disrupts its interaction with galectin 9, and stimulates an anti-tumor immune response, is suitable for use in the combination treatment methods.
  • the combination therapy includes an antibody known in the art which binds 4-1BB/CD137 and disrupts its interaction with CD137L. It will be understood by one of ordinary skill that any antibody which binds to 4-1BB/CD137, disrupts its interaction with CD137L or another ligand, and stimulates an anti -tumor immune response or an immune stimulatory response that results in anti-tumor activity overall, is suitable for use in the combination treatment methods.
  • the combination therapy includes an antibody known in the art which binds GITR and disrupts its interaction with its ligand. It will be understood by one of ordinary skill that any antibody which binds to GITR, disrupts its interaction with GITRL or another ligand, and stimulates an anti-tumor immune response or an immune stimulatory response that results in anti-tumor activity overall, is suitable for use in the combination treatment methods.
  • the combination therapy includes an antibody known in the art which binds 0X40 and disrupts its interaction with its ligand. It will be understood by one of ordinary skill that any antibody which binds to 0X40, disrupts its interaction with OX40L or another ligand, and stimulates an anti-tumor immune response or an immune stimulatory response that results in anti-tumor activity overall, is suitable for use in the combination treatment methods.
  • the combination therapy includes an antibody known in the art which binds CD40 and disrupts its interaction with its ligand. It will be understood by one of ordinary skill that any antibody which binds to CD40, disrupts its interaction with its ligand, and stimulates an anti-tumor immune response or an immune stimulatory response that results in anti tumor activity overall, is suitable for use in the combination treatment methods.
  • the combination therapy includes an antibody known in the art which binds ICOS and disrupts its interaction with its ligand. It will be understood by one of ordinary skill that any antibody which binds to ICOS, disrupts its interaction with its ligand, and stimulates an anti-tumor immune response or an immune stimulatory response that results in anti tumor activity overall, is suitable for use in the combination treatment methods.
  • the combination therapy includes an antibody known in the art which binds CD28 and disrupts its interaction with its ligand. It will be understood by one of ordinary skill that any antibody which binds to CD28, disrupts its interaction with its ligand, and stimulates an anti-tumor immune response or an immune stimulatory response that results in anti tumor activity overall, is suitable for use in the combination treatment methods.
  • the combination therapy includes an antibody known in the art which binds IFNa and disrupts its interaction with its ligand. It will be understood by one of ordinary skill that any antibody which binds to IFNa, disrupts its interaction with its ligand, and stimulates an anti-tumor immune response or an immune stimulatory response that results in anti tumor activity overall, is suitable for use in the combination treatment methods.
  • an “anti-cancer therapeutic” is a compound, composition, or treatment (e.g., surgery) that prevents or delays the growth and/or metastasis of cancer cells.
  • anti-cancer therapeutics include, but are not limited to, surgery (e.g., removal of all or part of a tumor), chemotherapeutic drug treatment, radiation, gene therapy, hormonal manipulation, immunotherapy (e.g., therapeutic antibodies and cancer vaccines) and antisense or RNAi oligonucleotide therapy.
  • chemotherapeutic drugs include, but are not limited to, hydroxyurea, busulphan, cisplatin, carboplatin, chlorambucil, melphalan, cyclophosphamide, Ifosphamide, danorubicin, doxorubicin, epirubicin, mitoxantrone, vincristine, vinblastine, Navelbine.RTM.
  • anti-cancer therapeutics includes novel compounds or treatments developed in the future.
  • compositions and/or formulations described above include one or more therapeutic entities in an amount effective to achieve the intended purpose.
  • therapeutically effective dose refers to the amount of the therapeutic entities that ameliorates the symptoms of cancer. Determination of a therapeutically effective dose of a compound is well within the capability of those skilled in the art.
  • the therapeutically effective dose can be estimated initially either in cell culture assays, or in animal models, such as those described herein. Animal models can also be used to determine the appropriate concentration range and route of administration. Such information can then be used to determine useful doses and routes for administration in other animals, including humans, using standard methods known in those of ordinary skill in the art.
  • kits comprising the compositions of the invention and instructions for use.
  • the kit may further contain a least one additional reagent, e.g. a chemotherapeutic drug, anti-tumor antibody, etc.
  • Kits typically include a label indicating the intended use of the contents of the kit.
  • the term label includes any writing, or recorded material supplied on or with the kit, or which otherwise accompanies the kit.
  • the kit comprises an IL-2 superkine immune cell targeting or expression construct comprising an IL-2 variant/IL-2 superkine as described herein. In some embodiments, the kit comprises an IL-2 superkine immune cell targeting or expression construct comprising an IL-2 variant/IL-2 superkine including those provided herein. In some embodiments, an IL-2 superkine immune cell targeting or expression construct comprises an IL-2 variant/IL-2 superkine including those provided herein. 6. Exemplary Immune Cell Targeting or Expressopn Construct Embodiments
  • An immune cell targeting or expression construct comprising: an interleukin-2 receptor b (IL-2RP) binding protein, wherein the equilibrium dissociation constant for the IL-2R ⁇ 5 of the binding protein is less than that of wild-type human IL-2 (hIL-2); linked to an immune cell targeting or expression construct.
  • IL-2RP interleukin-2 receptor b
  • a bispecific IL-2 cytokine fusion is also an interleukin-2 receptor b (IL-2R ⁇ 5) binding protein.
  • the immune cell targeting or expression construct exhibits a cyotoxic effect on a T-cell, for example a CD8+ T-cell or a CD4+ T-cell.
  • the construct is a chimeric antigen receptor (CAR) and wherein the IL-2 superkine is fused to a transmembrane domain; linked to an intracellular signaling region.
  • CAR chimeric antigen receptor
  • the intracellular signaling region comprises a CD3 signaling domain.
  • the intracellular signaling region comprises one or more of a CD28 signaling domain, a CD137 signaling domain, an OX-40 signaling domain, an ICOS signaling domain, a DAP 10 signaling domain.
  • the construct is a T cell antigen coupler (TAC), wherein the IL-2 superkine is fused to a ligand that binds a protein associated with the TCR complex; fused to a T cell receptor signaling domain polypeptide.
  • TAC T cell antigen coupler
  • the protein associated with the TCR complex is CD3.
  • the T cell receptor signaling domain polypeptide comprises CD4 cytosolic domain and CD4 transmembrane domain.
  • the construct is an antibody coupled T cell receptors (ACTR), comprising a chimeric antigen receptor component that binds to the IL-2 superkine at a high affinity.
  • ACTR antibody coupled T cell receptors
  • the CAR component comprises CD 16, and the IL-2 superkine is fused to an Fc sequence.
  • the construct is a bispecific T cell exchanger (BiTE) comprising an IL-2 superkine fused to a variable region of an antibody that binds to a component of a T cell receptor.
  • BiTE bispecific T cell exchanger
  • the BiTE component of a T cell receptor is CD3.
  • the IL-2R 3 binding protein comprises the following amino acid substitutions: L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type hIL-2.
  • nucleic acid encoding and IL-2 described herein is provided.
  • vector comprising the nucleic acid is provided.
  • a T cell comprising a construct according to any of the above is provided.
  • an NK cell comprising a construct according to any of the above is provided.
  • the T cell is a CD4 + T cell.
  • the T cell is a CD8 + T cell.
  • nucleic acid molecules described above can be contained within a vector that is capable of directing their expression in, for example, a cell that has been transduced with the vector. Accordingly, in addition to the subject IL-2 muteins and/or bispecific IL-2 cytokine fusions, expression vectors containing a nucleic acid molecule encoding a subject IL-2 mutein and cells transfected with these vectors are among the preferred embodiments.
  • vectors and expression control sequences will function equally well to express the DNA sequences described herein. Neither will all hosts function equally well with the same expression system. However, one of skill in the art may make a selection among these vectors, expression control sequences and hosts without undue experimentation. For example, in selecting a vector, the host must be considered because the vector must replicate in it. The vector’s copy number, the ability to control that copy number, and the expression of any other proteins encoded by the vector, such as antibiotic markers, should also be considered.
  • vectors that can be used include those that allow the DNA encoding the IL-2 muteins to be amplified in copy number. Such amplifiable vectors are well known in the art. They include, for example, vectors able to be amplified by DHFR amplification (see, e.g...
  • the human IL-2 muteins of the present disclosure will be expressed from vectors, preferably expression vectors.
  • the vectors are useful for autonomous replication in a host cell or may be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome (e.g., nonepisomal mammalian vectors).
  • Expression vectors are capable of directing the expression of coding sequences to which they are operably linked.
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids (vectors).
  • other forms of expression vectors such as viral vectors (e.g., replication defective retroviruses, adenoviruses, and adeno-associated viruses) are included also.
  • Exemplary recombinant expression vectors can include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, operably linked to the nucleic acid sequence to be expressed.
  • the expression constructs or vectors can be designed for expression of an IL-2 mutein or variant thereof in prokaryotic or eukaryotic host cells.
  • Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. Suitable methods for transforming or transfecting host cells can be found in Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual (2d ed.,
  • the recombinant IL-2 muteins or biologically active variants thereof can also be made in eukaryotes, such as yeast or human cells.
  • Suitable eukaryotic host cells include insect cells (examples of Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., S19 cells) include the pAc series (Smith et al. (1983) Mol. Cell Biol. 3:2156-2165) and the pVL series (Lucklow and Summers (1989) Virology 170:31-39)); yeast cells (examples of vectors for expression in yeast S. cerenvisiae include pYepSecl (Baldari et al.
  • mammalian expression vectors include pCDM8 (Seed (1987) Nature 329:840) and pMT2PC (Kaufman et al. (1987) EMBO J. 6:187:195)).
  • Suitable mammalian cells include Chinese hamster ovary cells (CHO) or COS cells.
  • the expression vector's control functions are often provided by viral regulatory elements.
  • promoters are derived from polyoma, Adenovirus 2, cytomegalovirus, and Simian Virus 40.
  • suitable expression systems for both prokaryotic and eukaryotic cells see Chapters 16 and 17 of Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual (2 nd ed., Cold Spring Harbor Laboratory Press, Plainview, N.Y.). See, Goeddel (1990) in Gene Expression Technology: Methods in Enzymology 185 (Academic Press, San Diego, Calif.).
  • the sequences encoding the human IL-2 muteins of the present disclosure can be optimized for expression in the host cell of interest.
  • the G-C content of the sequence can be adjusted to levels average for a given cellular host, as calculated by reference to known genes expressed in the host cell. Methods for codon optimization are well known in the art. Codons within the IL-2 mutein coding sequence can be optimized to enhance expression in the host cell, such that about 1%, about 5%, about 10%, about 25%, about 50%, about 75%, or up to 100% of the codons within the coding sequence have been optimized for expression in a particular host cell.
  • Vectors suitable for use include T7-based vectors for use in bacteria (see. for example, Rosenberg et al, Gene 56:125, 1987), the pMSXND expression vector for use in mammalian cells (Lee and Nathans, J. Biol. Chem. 263:3521, 1988), and baculovirus-derived vectors (for example, the expression vector pBacPAK9 from Clontech, Palo Alto, Calif.) for use in insect cells.
  • T7-based vectors for use in bacteria see. for example, Rosenberg et al, Gene 56:125, 1987
  • the pMSXND expression vector for use in mammalian cells
  • baculovirus-derived vectors for example, the expression vector pBacPAK9 from Clontech, Palo Alto, Calif.
  • nucleic acid inserts which encode the subject IL-2 muteins in such vectors, can be operably linked to a promoter, which is selected based on, for example, the cell type in which expression is sought.
  • an expression control sequence a variety of factors should also be considered. These include, for example, the relative strength of the sequence, its controllability, and its compatibility with the actual DNA sequence encoding the subject IL-2 mutein, particularly as regards potential secondary structures. Hosts should be selected by consideration of their compatibility with the chosen vector, the toxicity of the product coded for by the DNA sequences of this invention, their secretion characteristics, their ability to fold the polypeptides correctly, their fermentation or culture requirements, and the ease of purification of the products coded for by the DNA sequences.
  • expression control sequence and expression vector in some embodiments, will depend upon the choice of host.
  • a wide variety of expression host/vector combinations can be employed.
  • Useful expression vectors for eukaryotic hosts include, for example, vectors with expression control sequences from SV40, bovine papillomavirus, adenovirus and cytomegalovirus.
  • Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from E.
  • coli including col El, pCRI, pER32z, pMB9 and their derivatives, wider host range plasmids, such as RP4, phage DNAs, e.g., the numerous derivatives of phage lambda, e.g., NM989, and other DNA phages, such as Ml 3 and fdamentous single stranded DNA phages.
  • Useful expression vectors for yeast cells include the 2 m plasmid and derivatives thereof.
  • Useful vectors for insect cells include pVL 941 and pFastBacTM 1 (GibcoBRL, Gaithersburg, Md.). Cate et al, “Isolation Of The Bovine And Human Genes For Mullerian Inhibiting Substance And Expression Of The Human Gene In Animal Cells”, Cell, 45, pp. 685-98 (1986).
  • any of a wide variety of expression control sequences can be used in these vectors.
  • useful expression control sequences include the expression control sequences associated with structural genes of the foregoing expression vectors.
  • useful expression control sequences include, for example, the early and late promoters of SV40 or adenovirus, the lac system, the trp system, the TAC or TRC system, the major operator and promoter regions of phage lambda, for example PL, the control regions of fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., PhoA, the promoters of the yeast a-mating system, the polyhedron promoter of Baculovirus, and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
  • a T7 promoter can be used in bacteria, a polyhedrin promoter can be used in insect cells, and a cytomegalovirus or metallothionein promoter can be used in mammalian cells. Also, in the case of higher eukaryotes, tissue-specific and cell type-specific promoters are widely available.
  • promoters are so named for their ability to direct expression of a nucleic acid molecule in a given tissue or cell type within the body. Skilled artisans are well aware of numerous promoters and other regulatory elements which can be used to direct expression of nucleic acids.
  • vectors can contain origins of replication, and other genes that encode a selectable marker.
  • neomycin-resistance (neo r ) gene imparts G418 resistance to cells in which it is expressed, and thus permits phenotypic selection of the transfected cells.
  • Viral vectors that can be used in the invention include, for example, retroviral, adenoviral, and adeno-associated vectors, herpes virus, simian virus 40 (SV40), and bovine papilloma virus vectors (see, for example, Gluzman (Ed.), Eukaryotic Viral Vectors, CSH Laboratory Press, Cold Spring Harbor, N.Y.).
  • a cell of the invention is a transfected cell, i.e., a cell into which a nucleic acid molecule, for example a nucleic acid molecule encoding a mutant IL-2 polypeptide, has been introduced by means of recombinant DNA techniques.
  • the progeny of such a cell are also considered within the scope of the invention.
  • an IL-2 mutein can be produced in a prokaryotic host, such as the bacterium E. coli, or in a eukaryotic host, such as an insect cell (e.g., an Sf21 cell), or mammalian cells (e.g, CHO, HEK293, COS cells, NIH 3T3 cells, or HeLa cells). These cells are available from many sources, including the American Type Culture Collection (Manassas, Va.). In selecting an expression system, it matters only that the components are compatible with one another. Artisans or ordinary skill are able to make such a determination.
  • a prokaryotic host such as the bacterium E. coli
  • a eukaryotic host such as an insect cell (e.g., an Sf21 cell), or mammalian cells (e.g, CHO, HEK293, COS cells, NIH 3T3 cells, or HeLa cells). These cells are available from many sources, including the American Type Culture Collection (Manass
  • the expressed polypeptides can be purified from the expression system using routine biochemical procedures, and can be used, e.g., as therapeutic agents, as described herein.
  • IL-2 muteins obtained will be glycosylated or unglycosylated depending on the host organism used to produce the mutein. If bacteria are chosen as the host then the IL-2 mutein produced will be unglycosylated. Eukaryotic cells, on the other hand, will glycosylate the IL-2 muteins, although perhaps not in the same way as native-IL-2 is glycosylated.
  • the IL-2 mutein produced by the transformed host can be purified according to any suitable method. Various methods are known for purifying IL-2. See, e.g. Current Protocols in Protein Science, Vol 2. Eds: John E. Coligan, Ben M. Dunn, Hidde L.
  • IL-2 muteins can be isolated from inclusion bodies generated in E. coli, or from conditioned medium from either mammalian or yeast cultures producing a given mutein using cation exchange, gel filtration, and/or reverse phase liquid chromatography.
  • Another exemplary method of constructing a DNA sequence encoding the IL-2 muteins is by chemical synthesis. This includes direct synthesis of a peptide by chemical means of the protein sequence encoding for an IL-2 mutein exhibiting the properties described. This method can incorporate both natural and unnatural amino acids at positions that affect the interactions of IL-2 with the IL-2Ra, the IL-2R ⁇ 5 and/or the IL-2Ry. Alternatively a gene which encodes the desired IL- 2 mutein can be synthesized by chemical means using an oligonucleotide synthesizer.
  • Such oligonucleotides are designed based on the amino acid sequence of the desired IL-2 mutein, and preferably selecting those codons that are favored in the host cell in which the recombinant mutein will be produced.
  • the genetic code is degenerate — that an amino acid may be coded for by more than one codon.
  • Phe (F) is coded for by two codons, TIC or TTT, Tyr (Y) is coded for by TAC or TAT and his (H) is coded for by CAC or CAT.
  • Trp (W) is coded for by a single codon, TGG.
  • degenerate variants thereof in the context of this invention means all DNA sequences that code for and thereby enable expression of a particular mutein.
  • the biological activity of the IL-2 muteins can be assayed by any suitable method known in the art. Such assays include PHA-blast proliferation and NK cell proliferation.
  • Anti-PD-1 antibodies for use according to the invention and methods described herein include but are not limited to nivolumab, BMS-936558, MDX-1106, ONO-4538, AMP224, CT- Oil, and MK-3475 (pembrolizumab), cemiplimab (REGN2810), SHR-1210 (CTR20160175 and CTR20170090), SHR-1210 (CTR20170299 and CTR20170322), JS-001 (CTR20160274), IBI308 (CTR20160735), BGB-A317 (CTR20160872) and/or a PD-1 antibody as recited in U.S.
  • Patent Publication No. 2017/0081409 see, e.g., Table 38.
  • pembrolizumab Keytruda®; MK-3475-033
  • nivolumab Opdivo®; CheckMate078
  • Exemplary anti-PD-1 anitbody sequences are shown in Figure 10 and any of these can be used with the combination methods with the IL-2 muteins as described herein.
  • the IL-2 mutein portion of the bispecific IL-2 cytokine fusion comprises substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination with an anti-PD-1 antibody or inhibitor.
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination with nivolumab.
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination with pembrolizumab. In some embodiments, the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination with cemiplimab.
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination BMS-936558. In some embodiments, the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination MDX-1106.
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination ONO-4538. In some embodiments, the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination AMP224.
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination CT- 011.
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination MK-3475.
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises Y45A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein of the bispecific IL-2 cytokine fusion comprises substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO: 2) is used in combination with any of the referenced antibodies.
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises Y45A substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. . In some embodiments, the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein is any IL-2 mutein or variant disclosed herein. In some embodiments, the IL-2 mutein sequence is 90% identical to any one of SEQ ID NO:2 or SEQ ID NO:6 through SEQ ID NO: 10 or SEQ ID NO: 16.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; Bll SEQ ID NO: 10; C5 SEQ ID NO: 11; D10 SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • the IL-2 mutein used in combination with an anti- PD-1 antibody is a fusion mutein as described herein.
  • the IL-2 mutein used in combination with an anti-PD-1 antibody is a fusion mutein as described herein.
  • any of the IL-2 muteins or the bispecific IL-2 cytokine fusions described herein can be used in combination with an anti-PD-1 antibody.
  • anti-PD-1 antibody There are three approved anti-PD-Ll antibodies, atezolizumab (TECENTRIQ®; MPDL3280A), avelumab (BAVENCIO®; MSB001071 8C), and Durvalumab (MED 14736), as well as other anti-PD-Ll antibodies in development.
  • Numerous anti-PD-Ll antibodies are available and many more in development which can be used in combination with the IL-2 muteins as described herein.
  • the PD-L1 antibody is one described in U.S. Patent Publication No. 2017/0281764 as well as International Patent Publication No. WO 2013/079174 (avelumab) and WO 2010/077634 (or U.S. Patent Application No. 20160222117 or U.S. Patent No. 8,217,149; atezolizumab).
  • the PD-L1 antibody comprises a heavy chain sequence of SEQ ID NO:34 and a light chain sequence of SEQ ID NO:36 (from US 2017/281764).
  • the PD-L1 antibody is atezolizumab (TECENTRIQ®; MPDL3280A; IMpowerllO).
  • the PD-L1 antibody is avelumab (BAVENCIO®; MSB001071 8C). In some embodiments, the PD- L1 antibody is durvalumab (MEDI4736). In some embodiments, the PD-L1 antibody includes, for example, Atezolizumab (IMpowerl33), BMS-936559/MDX-1105, and/or RG-7446/MPDL3280A, and/or YW243.55.S70, as well as any of the exemplary anit-PD-Ll antibodies provided herein in Figure 17.
  • IMpowerl33 Atezolizumab
  • BMS-936559/MDX-1105 and/or RG-7446/MPDL3280A
  • YW243.55.S70 YW243.55.S70
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination with any of the referenced antibodies.
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises Y45A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. . In some embodiments, the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein is any IL-2 mutein or variant disclosed herein. In some embodiments, the IL-2 mutein sequence is 90% identical to any one of SEQ ID NO:2 or SEQ ID NO:6 through SEQ ID NO: 10 or SEQ ID NO: 16.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; B11 SEQ ID NO: 10; C5 SEQ ID NO: 11; D10 SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • the IL-2 mutein used in combination with an anti-PD-Ll antibody is a fusion mutein as described herein. In some embodiments, the IL-2 mutein used in combination with an anti-PD-Ll antibody is a fusion mutein as described herein. K.
  • antibodies and/or immunotherapies for use according to the methods of the present invention include but are not limited to, anti-CTLA4 mAbs, such as ipilimumab, tremelimumab; anti-PD-Ll antagonistic antibodies such as BMS-936559/MDX-1105, MEDI4736, RG- 7446/MPDL3280A; anti-LAG-3 such as IMP-321; agonistic antibodies targeting immunostimulatory proteins, including anti-CD40 mAbs such as CP-870,893, lucatumumab, dacetuzumab; anti-CD137 mAbs (anti-4-l-BB antibodies) such as BMS-663513 urelumab (anti-4- 1BB antibody; see, for example, US Patent Nos.
  • anti-CTLA4 mAbs such as ipilimumab, tremelimumab
  • anti-PD-Ll antagonistic antibodies such as BMS-936559/MDX-1105, MEDI
  • lirilumab anti-KIR mAB; IPH2102/BMS-986015; blocks NK cell inhibitory receptors
  • PF-05082566 utomilumab; see, for example, US Patent Nos. 8,821,867; 8,337,850; and 9,468,678, as well as International Patent Application Publication No.
  • anti-OX40 mAbs see, for example, WO 2006/029879 or WO 2010/096418, incorporated by reference herein in their entireties
  • anti-GITR mAbs such as TRX518
  • anti-CD27 mAbs such as varlilumab CDX-1127
  • varlilumab CDX-1127 see, for example, WO 2016/145085 and U.S. Patent Publication Nos.
  • anti-ICOS mAbs for example, MEDI-570, JTX-2011, and anti-TIM-3 antibodies (see, for example, WO 2013/006490 or U.S. Patent Publication No US 2016/0257758, incorporated by reference herein in their entireties).
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination with any of the referenced antibodies.
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein further comprises Y45A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO:2. . In some embodiments, the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein is any IL-2 mutein or variant disclosed herein. In some embodiments, the IL-2 mutein sequence is 90% identical to any one of SEQ ID NO:2 or SEQ ID NO:6 through SEQ ID NO: 10 or SEQ ID NO: 16.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; B11 SEQ ID NO: 10; C5 SEQ ID NO: 11 ; DIO SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • Other antibodies can also include monoclonal antibodies to prostate cancer, ovarian cancer, breast cancer, endometrial cancer, multiple myeloma, melanoma, lymphomas, lung cancers including small cell lung cancer, kidney cancer, colorectal cancer, pancreatic cancer, gastric cancer, brain cancer (see, generally www.cbnicaltrials.gov).
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination with any of the referenced antibodies.
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein further comprises Y45A substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein is any IL-2 mutein or variant disclosed herein.
  • the IL-2 mutein sequence is 90% identical to any one of SEQ ID NO:2 or SEQ ID NO:6 through SEQ ID NO: 10 or SEQ ID NO: 16.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; B11 SEQ ID NO: 10; C5 SEQ ID NO: 11 ; D10 SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • Antibodies can also include antibodies for antibody-dependent cell-mediated cytotoxicity (ADCC).
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination with an antibody for antibody-dependent cell-mediated cytotoxicity (ADCC).
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises Y45A substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. L. METHODS OF TREATMENT
  • subject IL-2 muteins and/or bispecific IL-2 cytokine fusions, and/or nucleic acids expressing them can be administered to a subject to treat a disorder associated with abnormal apoptosis or a differentiative process (e.g., cellular proliferative disorders or cellular differentiative disorders, such as cancer, by, for example, producing an active or passive immunity).
  • a disorder associated with abnormal apoptosis or a differentiative process e.g., cellular proliferative disorders or cellular differentiative disorders, such as cancer, by, for example, producing an active or passive immunity.
  • the disclosed IL-2 muteins may possess advantageous properties, such as reduced vascular leak syndrome.
  • the IL-2 mutein is any IL-2 mutein or variant disclosed herein.
  • the IL-2 mutein sequence is 90% identical to any one of SEQ ID NO:2 or SEQ ID NO:6 through SEQ ID NO: 10 or SEQ ID NO: 16.
  • the IL-2 mutein incudes any one of 5-1 SEQ ID NO:5; 5-2 SEQ ID NO:6; 6-6 SEQ ID NO:7; A2 SEQ ID NO:8; B1 SEQ ID NO:9; Bll SEQ ID NO: 10; C5 SEQ ID NO: 11; D10 SEQ ID NO: 12; E10 SEQ ID NO: 13; G8 SEQ ID NO: 14; H4 SEQ ID NO: 15; and H9 SEQ ID NO: 16.
  • the substitutions in the IL-2 mutein comprise L80F, R81D, L85V, I86V, and I92F, numbered in accordance with wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein is a fusion protein.
  • the IL-2 mutein is associated with and/or expressed by a CAR-T contstruct.
  • the IL-2 mutein is expressed by and/or associated with an oncolytic virus.
  • Examples of cellular proliferative and/or differentiative disorders include cancer (e.g., carcinoma, sarcoma, metastatic disorders or hematopoietic neoplastic disorders, e.g., leukemias).
  • a metastatic tumor can arise from a multitude of primary tumor types, including but not limited to those of prostate cancer, ovarian cancer, breast cancer, endometrial cancer, multiple myeloma, melanoma, lymphomas, lung cancers including small cell lung cancer, kidney cancer, liver cancer, colon cancer, colorectal cancer, pancreatic cancer, gastric cancer, and brain cancer.
  • the mutant IL-2 polypeptides can be used to treat patients who have, who are suspected of having, or who may be at high risk for developing any type of cancer, including renal carcinoma or melanoma, or any viral disease.
  • Exemplary carcinomas include those forming from tissue of the cervix, lung, prostate, breast, head and neck, colon and ovary.
  • the term also includes carcinosarcomas, which include malignant tumors composed of carcinomatous and sarcomatous tissues.
  • proliferative disorders include hematopoietic neoplastic disorders.
  • mutant IL-2 polypeptides can be used in ex vivo methods.
  • cells e.g., peripheral blood lymphocytes or purified populations of lymphocytes isolated from a patient and placed or maintained in culture
  • the contacting step can be affected by adding the IL-2 mutant to the culture medium.
  • the culture step can include further steps in which the cells are stimulated or treated with other agents, e.g., to stimulate proliferation, or to expand a population of cells that is reactive to an antigen of interest (e.g., a cancer antigen or a viral antigen).
  • an antigen of interest e.g., a cancer antigen or a viral antigen
  • Anti-PD-1 antibodies for use in combination with the IL-2 muteins disclosed herein for the treatment methods include but are not limited to nivolumab, BMS-936558, MDX-1106, ONO- 4538, AMP224, CT-011, and MK-3475.
  • the IL-2 mutein of the bispecific IL-2 cytokine fusion comprises substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination with an anti-PD-1 antibody or inhibitor for the treatment of cancer.
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination with nivolumab for the treatment of cancer.
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination BMS-936558 for the treatment of cancer. In some embodiments, the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination MDX- 1106 for the treatment of cancer.
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination ONO-4538 for the treatment of cancer.
  • the IL- 2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination AMP224 for the treatment of cancer.
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination CT-011 for the treatment of cancer.
  • the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination MK-3475 for the treatment of cancer.
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises K43N substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises Y45A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO: 2.
  • the IL-2 mutein of the bispecific IL-2 cytokine fusion comprises substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2) is used in combination with an antibody and/or immunotherapy including but not limited to, anti-CTLA4 mAbs, such as ipilimumab, tremelimumab; anti-PD-Ll antagonistic antibodies such as BMS-936559/MDX-1105, MEDI4736, RG-7446/MPDL3280A; anti-LAG-3 such as IMP-321; agonistic antibodies targeting immunostimulatory proteins, including anti-CD40 mAbs such as CP-870,893, lucatumumab, dacetuzumab; anti-CD137 mAbs (anti-4-l-BB antibodies) such as BMS-663513 urelumab (anti-4-lBB antibody;
  • lirilumab anti-KIR mAB; IPH2102/BMS-986015; blocks NK cell inhibitory receptors
  • PF-05082566 utomilumab; see, for example, US Patent Nos. 8,821,867; 8,337,850; and 9,468,678, as well as International Patent Application Publication No.
  • anti-OX40 mAbs see, for example, WO 2006/029879 or WO 2010/096418, incorporated by reference herein in their entireties
  • anti-GITR mAbs such as TRX518
  • anti-CD27 mAbs such as varlilumab CDX-1127
  • varlilumab CDX-1127 see, for example, WO 2016/145085 and U.S. Patent Publication Nos.
  • anti-ICOS mAbs for example, MEDI-570, JTX-2011, and anti-TIM-3 antibodies (see, for example, WO 2013/006490 or U.S. Patent Publication No US 2016/0257758, incorporated by reference herein in their entireties) for the treatment of cancer.
  • the IL-2 mutein of the bispecific IL-2 cytokine fusion comprises substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO: 2) is used in combination with another antibody which can include monoclonal antibodies to prostate cancer, ovarian cancer, breast cancer, endometrial cancer, multiple myeloma, melanoma, lymphomas, lung cancers including small cell lung cancer, kidney cancer, colorectal cancer, pancreatic cancer, gastric cancer, brain cancer (see, generally www.clinicaltrials.gov), for the treatment of cancer.
  • the IL-2 mutein of the bispecific IL-2 cytokine fusion comprises substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO: 2) is used in combination with antibodies for antibody-dependent cell-mediated cytotoxicity (ADCC) for the treatment of cancer.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • subject IL-2 muteins and/or the bispecific IL-2 cytokine fusions and nucleic acids can be incorporated into compositions, including pharmaceutical compositions.
  • Such compositions typically include the polypeptide or nucleic acid molecule and a pharmaceutically acceptable carrier.
  • Such compositions can also comprise anti-PD-1 antibodies.
  • the composition comprises an IL-2 mutein that is a fusion protein and/or is associated with a CAR-T contstruct and/or expressed by or associated with an oncolytic virus.
  • the anti-PD-1 antibodies and IL-2 muteins and/or the bispecific IL-2 cytokine fusions can be administered as a co-composition, simultaneously as two separate compositions, and/or sequentially as two separate compositions.
  • the anti-PD-1 antibody or inhibitor and IL-2 mutein are administered together as a single co-composition (i.e., co formulated).
  • the anti-PD-1 antibody or inhibitor and IL-2 mutein are administered simultaneously as two separate compositions (i.e., separate formulations).
  • the anti-PD-1 antibody or inhibitor and IL-2 mutein are administered sequentially as separate compositions (i.e., separate formulations).
  • the anti-PD-1 antibody or inhibitor and IL-2 mutein when administered sequentially as separate compositions, the anti-PD-1 antibody or inhibitor is administered before the IL-2 mutein. In some embodiments, when the anti-PD-1 antibody or inhibitor and IL-2 mutein are administered sequentially as separate compositions, the IL-2 mutein is administered before the anti-PD-1 antibody or inhibitor.
  • the anti-PD-1 antibodies include but are not limited to nivolumab, BMS-936558, MDX-1106, ONO-4538, AMP224, CT-011, and MK-3475.
  • the IL-2 mutein is the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2).
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises K43N substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein further comprises Y45A substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2.
  • the other immunotherapy agents as described and IL-2 muteins and/or the bispecific IL-2 cytokine fusions can be administered as a co-composition, simultaneously as two separate compositions, and/or sequentially as two separate compositions.
  • the other immunotherapy agents and IL-2 mutein are administered together as a single co-composition (i.e.. co-formulated).
  • the other immunotherapy agents and IL-2 mutein are administered simultaneously as two separate compositions (i.e., separate formulations).
  • the other immunotherapy agents and IL-2 mutein are administered sequentially as separate compositions (i.e., separate formulations).
  • the anti -PD- 1 antibody or inhibitor is administered before the IL-2 mutein.
  • the IL-2 mutein is administered before other immunotherapy agents.
  • the IL-2 mutein is the IL-2 mutein comprising substitutions L80F, R81D, L85V, I86V, and I92F, numbered in accordance with human wild-type IL-2 (SEQ ID NO:2).
  • the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein further comprises K43N substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein further comprises F42A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein further comprises Y45A substitution, wherein numbering is in accordance with the wild-type human IL-2 of SEQ ID NO:2. In some embodiments, the IL-2 mutein further comprises E62A substitution, wherein numbering is in accordance with the wild- type human IL-2 of SEQ ID NO:2.
  • a pharmaceutical composition is formulated to be compatible with its intended route of administration.
  • the anti-PD-1 antibodies and/or mutant IL-2 polypeptides (including bispecific IL- 2 cytokine fusions) of the invention may be given orally, but it is more likely that they will be administered through a parenteral route, including for example intravenous administration.
  • parenteral routes of administration include, for example, intravenous, intradermal, subcutaneous, transdermal (topical), transmucosal, and rectal administration.
  • Solutions or suspensions used for parenteral application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose.
  • a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents
  • antibacterial agents such as benzyl alcohol or methyl parabens
  • antioxidants such as ascorbic acid or sodium bisulfite
  • chelating agents such as ethylenediaminetetraacetic
  • pH can be adjusted with acids or bases, such as mono- and/or di-basic sodium phosphate, hydrochloric acid or sodium hydroxide (e.g., to a pH of about 7.2-7.8, e.g., 7.5).
  • acids or bases such as mono- and/or di-basic sodium phosphate, hydrochloric acid or sodium hydroxide (e.g., to a pH of about 7.2-7.8, e.g., 7.5).
  • the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM. (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
  • the composition should be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants, e.g., sodium dodecyl sulfate.
  • surfactants e.g., sodium dodecyl sulfate.
  • Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by fdtered sterilization.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle, which contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • Oral compositions if used, generally include an inert diluent or an edible carrier.
  • the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules, e.g., gelatin capsules.
  • Oral compositions can also be prepared using a fluid carrier for use as a mouthwash.
  • Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition.
  • the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, PrimogelTM, or com starch; a lubricant such as magnesium stearate or SterotesTM; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
  • a binder such as microcrystalline cellulose, gum tragacanth or gelatin
  • an excipient such as starch or lactose, a disintegrating agent such as alginic acid, PrimogelTM, or com starch
  • a lubricant such as magnesium stearate or SterotesTM
  • a glidant such as colloidal silicon dioxide
  • anti-PD-1 antibodies and/or IL-2 muteins are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
  • a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
  • Systemic administration of the anti-PD-1 antibodies and/or IL-2 muteins or nucleic acids can also be by transmucosal or transdermal means.
  • penetrants appropriate to the barrier to be permeated are used in the formulation.
  • penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
  • Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
  • the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
  • compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
  • compounds subject IL-2 muteins or nucleic acids
  • the anti-PD-1 antibodies and/or IL-2 muteins and/or bispecific IL-2 cytokine fusions or nucleic acids are prepared with carriers that will protect the anti-PD-1 antibodies and/or mutant IL-2 polypeptides against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
  • a controlled release formulation including implants and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid.
  • Such formulations can be prepared using standard techniques. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc.
  • Liposomal suspensions can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Pat. No. 4,522,811.
  • Dosage, toxicity and therapeutic efficacy of such anti-PD-1 antibodies, IL-2 muteins, or nucleic acids compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50.
  • Compounds that exhibit high therapeutic indices are preferred. While compounds that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
  • the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
  • the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
  • the therapeutically effective dose can be estimated initially from cell culture assays.
  • a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture.
  • IC50 i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms
  • levels in plasma may be measured, for example, by high performance liquid chromatography.
  • a therapeutically effective amount of a subject IL-2 mutein and/or of the bispecific IL-2 cytokine fusions (i.e., an effective dosage) and/or the anti-PD-1 antibody or inhibitor depends on the polypeptide or antibody selected.
  • single dose amounts of the IL-2 mutein can be in the range of approximately 0.001 mg/kg to 0.1 mg/kg of patient body weight can be administered.
  • single dose amounts of the anti- PD-1 antibody or inhibitor can be in the range of approximately 1 mg/kg to 20 mg/kg, or about 5 mg/kg to about 15 mg/kg, or about 10 mg/kg of patient body weight can be administered.
  • doses of the anti-PD-1 antibody or inhibitor and/or the IL-2 mutein of about 0.005 mg/kg, 0.01 mg/kg, 0.025 mg/kg, 0.05 mg/kg, 0.1 mg/kg, 0.25 mg/kg, 0.5 mg/kg, 1.0 mg/kg, 5.0 mg/kg, 10.0 mg/kg may be administered.
  • 600,000 IU/kg is administered (IU can be determined by a lymphocyte proliferation bioassay and is expressed in International Units (IU) as established by the World Health Organization 1 st International Standard for Interleukin-2 (human)).
  • the dosage may be similar to, but is expected to be less than, that prescribed for PROLEUKIN®.
  • compositions can be administered one from one or more times per day to one or more times per week; including once every other day.
  • treatment of a subject with a therapeutically effective amount of the subject IL-2 muteins can include a single treatment or, can include a series of treatments.
  • the compositions are administered every 8 hours for five days, followed by a rest period of 2 to 14 days, e.g., 9 days, followed by an additional five days of administration every 8 hours.
  • administration is 3 doses administered every 4 days.
  • compositions can be included in a container, pack, or dispenser together with instructions for administration.
  • Example 1 Emergence of Novel Long-acting Mono- and Bi-specific IL-2/IL-13 Superkines as Potent Immune Modulators
  • IL-2 Proleukin ®
  • MDNA109 an IL-2 superkine, to generate MDNA11 by (1) addition of mutations to abrogate IL2Ra binding and (2) fusion with albumin to extend half-life.
  • MDNA11 and bispecific constructs displayed enhanced STAT5 signaling in human NK and resting CD8 T cells with diminished Treg activity compared to IL-2.
  • MDNA11 monotherapy or in combination with ICI demonstrated potent efficacy in a CT26 tumor model, resulting in long-term tumor regression and strong memory response.
  • MDNA1 1 also inhibited growth of B16F10 melanomas with durable increase in tumor infiltrating CD8 T and NK cells. Preliminary studies with bispecific constructs demonstrated therapeutic responses in both CT26 and B16F10 tumor models. In NHP, MDNA11 induced durable proliferation and expansion of NK and CD8 T cells with limited effects on Tregs. Repeat dose of MDNA1 1 did not trigger cytokine storm, anti-drug antibody response nor eosinophilia (associated with vascular leak syndrome; VLS). Histopathological evaluation confirmed an absence of pulmonary edema, a major IL-2 induced toxicity.
  • MDNA11 is a long-acting IL-2 superkine with superior potency at activation of naive CD8 T cells andNK cells, and diminished activity on Tregs. MDNA11 potently inhibited growth of tumors and induced durable regression and strong memory response. Novel bispecific constructs also demonstrated efficacy in these in vivo tumor models. In NHP, MDNA11 induced durable proliferation and expansion of immune effector cells without adverse side effects. These data demonstrate the potency of MDNA11 and underscore the versatility of our superkine platforms to the design of multi-functional therapeutics for immuno-oncological indications.
  • MDNA109 is an IL-2 superkine with high selectivity towards the intermediate affinity IL2 receptor (IL2R) consisting of IL-2Rb (CD 122) and IL-2 Rye (CD 132) that are expressed on naive CD8 T-cells and NK cells.
  • IL2R intermediate affinity IL2 receptor
  • CD 122 IL-2Rb
  • IL-2 Rye CD 132
  • MDNA109 is therefore a potent activator of NK and CD8 T cells and can induce a superior anti-cancer response compared to IL-2.
  • MDNA109 can still bind to IL-2Ra (CD25) resulting in strong activation of the high affinity IL-2R (IL-2Ro yc) expressed on immune-suppressive Tregs, therefore impairing the anti-cancer effects of effector T cells.
  • Addition of the FEAA mutations to MDNA109 abolishes binding to CD25 without affecting the binding capacity of MDNA109 to CD122, thereby shifting the balance towards effector immune
  • MDNA109 and MDNA109FEAA are versatile molecules that can be coupled to protein scaffolds, such as hlgGl Fc (with aN297A mutation to suppress effector function), to extend in vivo half-life. These Fc fusion constructs can be further fused with additional cytokines or superkines to generate bi-specific molecules with unique properties and potentially novel functions. Medicenna has to date engineered and manufactured 3 unique bi-specific superkines (with 6 more in development) and will evaluate their therapeutic potential in immuno-oncology. Description and rationale for the development of these bi-specifics are provided in Table 14, and in following sections. The sequences of these bi-specific superkines are listed in Table 15, as well as Figure 54. MDNA1 32-Fc-MDNAl 09 (KIH) Bi-specific Superkine:
  • IL13Ra2 is a decoy receptor for the IL-13 cytokine, and while not being bound by theory, is believed to act by dampening IL13-mediated responses in inflamed tissues. It is minimally expressed in normal tissues, but is overexpressed in certain tumors, including glioblastoma, colorectal, pancreatic and basal-like breast tumors. Therefore, IL13Ra2 can be considered as a potential immunotherapeutic target for these cancer types and can be exploited as a means to increase localization of cytokines, such as MDNA109, to tumors sites in order to enhance their therapeutic activities.
  • cytokines such as MDNA109
  • MDNA132 is an IL-13 superkine engineered to selectively bind IL13Ra2 with a 10-fold increase in affinity compared to IL-13.
  • the bi-specific superkine MDNA132-Fc-MDNA109 (see Table 12) was designed with the objective of exploiting MDNA132 for localizing to tumors overexpressing IL13Ra2 in order to enhance the therapeutic effect of MDNA109 by increasing bioavailability at the target sites.
  • Variant constructs containing MDNA109 engineered with the FEAA mutations (e.g., MDNA132-Fc-MDNA109FEAA) were manufactured for testing.
  • Interleukin 4 receptor is an important component of the immune system. It is heavily involved in T-cell differentiation, antibody isotype switching and other immune reactions. Interestingly, the IL4R can be either classified as Type I or Type II receptor. In the context of type I receptor, the IL4Ra-chain binds to the yc chain (normally expressed on immune cells). In contrast, the type II receptor consists of the IL4Ra chain binding to IL13Ral. Type II IL4R is particularly relevant to cancer immunotherapy as it is highly prevalent on various tumor types. For instance, it is overexpressed in more than 50% of pancreatic and ovarian tumors, more than 70% of colorectal, breast, head and neck, and lung cancer (i.e.
  • MDNA413 is a dual IL4/IL-13 super-antagonist designed to efficiently inhibit IL-4 and IL-13 induced activities by selectively blocking their binding to IL4R Type-II.
  • MDNA413 could therefore inhibit MDSC function and minimize the skewing of TAM toward the immune- suppressive M2 phenotype, thereby shifting the balance in favor of anti-cancer responses.
  • the fusion of MDNA413 to MDNA109-Fc or MDNA109FEAA-Fc have the combined benefits of diminishing the tumor-promoting functions of MDSC and M2/TAMs while stimulating the anti-cancer activity of effector immune cells (i.e. CD8 T- and NK cells).
  • MDNA132-Fc-MDNA109 (KIH) was purified by affinity chromatography (Protein A followed by cation exchange), and was analyzed by sodium dodecyl sulfate (SDS)-polyacrylamide gel electrophoresis (PAGE) and high- performance liquid chromatography HPLC ( Figure 4).
  • MDNA413-Fc-MDNA109 (KIH) and MDNA413FEAA-Fc-MDNA109 (2:1:2) were purified by affinity chromatography and size exclusion chromatography (SEC), and were analyzed by SDS-PAGE and HPLC ( Figures 5 and 6 respectively). Endotoxin levels were measured by the LAL chromogenic endotoxin assay, and are reported in Table 16 with information on purity and buffer.
  • Table 16 Information on available bi-specific superkines.
  • PBMCs were isolated over a density gradient, allowed to rest in complete media, and then stimulated for 15 minutes with 10-point 5-fold dilutions of IL-2, different MDNA109 variants, or bi-specific superkines. Controls included non-stimulated PBMC cells (i.e. no addition of MDNA109 variants or IL-2). Cells were fixed immediately following stimulation, and samples were analyzed by flow cytometry after intracellular staining for phosphorylated STAT5 (pSTAT5) in the immune subsets as listed in Table 17. The gating strategy employed to enable pSTAT5 analysis in different immune subsets is depicted in Figure 7 fluorescence minus one (FMO) controls are shown in Figure 8.
  • FMO fluorescence minus one
  • MDNA109-Fc 152.2 ⁇ 35.8 pM
  • MDNA 109FE AA-F c 370.6 ⁇ 131.1 pM
  • IL2-Fc 2189.2 ⁇ 435.3 pM
  • IL2-Fc both more potent than IL2
  • both IL2-Fc and MDNA109FEAA-Fc showed similar potency toward the Treg population with EC50 of 0.85 ⁇ 0.4 and 0.9 ⁇ 0.42 pM respectively.
  • MDNA109FEAA-Fc demonstrated a dramatic decrease in Treg activation, with an EC50 of 135.5 ⁇ 53.9 pM or an ⁇ 150-fold reduction in comparison to IL2-Fc and MDNA109-Fc.
  • MDNA109FEAA-Fc-MDNA413 is less potent than the other bi-specific superkines at activation of CD8 T-cells, it remains more effective than IL2-Fc and has the unique property of exhibiting a reduced capacity to stimulate Tregs compared to all other variants.
  • IL2-Fc 0.85 ⁇ 0.4 pM
  • MDNA109FEAA-F C-MDNA413 210.3 ⁇ 58, which is almost 250-fold weaker at stimulating Tregs.
  • a useful metric to predict the potential therapeutic activity of these constructs is the ratio of pSTAT5 EC50 of naive CD8 T-cells and NK cells to Tregs.
  • the CD8 T- cells/Tregs EC50 ratio for IL-2 and IL-2-Fc are higher (694 and 3008 respectively), consistent with the fact that these constructs are better activators of Tregs than they are of naive CD8 T-cells.
  • This ratio is significantly reduced for MDNA109-Fc as well as MDNA132-Fc-MDNA109 and MDNA413-Fc-MDNA109, consistent with their increased potencies towards naive CD8 T-cells.
  • Ratios of EC50 of NK cells to Tregs show a similar trend, with MDNA109-Fc, MDNA132-Fc- MDNA109 and MDNA413-Fc-MDNA109 displaying lower ratios than IL-2 and IL2-Fc.
  • MDNA109FEAA-Fc and MDNA109FEAA-Fc-MDNA413 again have the lowest NK cells/Treg EC50 ratios.
  • MTD is defined as the highest dose of a drug that does not cause significant side effects or overt toxicity.
  • MTD studies were performed in two mouse strains, B ALB/c and C57BL/6, which were subsequently used to evaluate anti-cancer efficacy of bi-specific superkines.
  • the use of these two strains enabled efficacy studies using various syngeneic cancer models that are either compatible with BALB/c or C57BL/6 mice. These data were also important for the design of combination studies where the administration of bi-specific superkines were aligned with that of the companion drug for optimal efficacy as well as practicality.
  • the dosing schedule for immune checkpoint inhibitors (ICIs), as an example, in mice and in the clinic is well documented.
  • ICIs immune checkpoint inhibitors
  • IP intraperitoneal
  • MTD MDNA132-Fc-MDNA109
  • KH MDNA413-Fc-MDNA109
  • mice treated with either 1 mg/kg or 2.5 mg/kg of MDNA132-Fc-MDNA109 or MDNA413-Fc-MDNA109 twice weekly for two weeks were all viable at the end of the study. Mice in both groups appeared clinically normal and maintained their weights during the study period. In summary, MTD was not reached at the highest dose tested (2.5 mg/kg) on a twice weekly dosing schedule for two weeks for both MDNA132-Fc-MDNA109 and MDNA4 13 -F c-MDN A 109 in BALB/c mice.
  • Table 19 provides an outline of the design of MTD study performed in C57B1/6 mice. A lower range of dose was used because C57B1/6 has been found to be more sensitive to IL-2 than BALB/c mice (Chen et ak, 2005).
  • FIG. 12 Survival C57B1/6 mice receiving different doses of MDNA132-Fc-MDNA109 (left) and MDNA413-Fc-MDNA109 (right).
  • MDNA132-Fc-MDNA109 and MDNA413-Fc-MDNA109 were well tolerated by BALB/c mice when administered twice weekly for two weeks at 1.0 mg/kg and 2.5 mg/kg, indicating that MTD was not reached at the highest dose (2.5 mg/kg) tested.
  • MDNA132-Fc-MDNA109 and MDNA413-Fc-MDNA109 were well tolerated by C57B/6 mice when administered twice weekly for two weeks at 0.2 mg/kg, 0.5 mg/kg and 1.0 mg/kg, indicating that MTD was not reached at the highest dose (1.0 mg/kg) tested.
  • CT26 syngeneic colon cancer model was selected to evaluate the therapeutic potential of bi-specific superkines for a number of reasons:
  • the CT26 cancer model is less aggressive compared to many other cancer models (e.g. B16F10 melanoma model, 4T1 metastatic breast cancer model or the Panc2 pancreatic cancer model), therefore providing a larger window to follow the therapeutic effects of MDNA109 variants.
  • cancer models e.g. B16F10 melanoma model, 4T1 metastatic breast cancer model or the Panc2 pancreatic cancer model
  • CT26 cancer model is responsive to ICIs in contrast to several other models, therefore providing an opportunity to evaluate combinatory treatments to determine potential synergy.
  • CT26 tumors • The relatively slow growth characteristic of CT26 tumors provides an opportunity to evaluate the anti -tumor activity of MDNA109 variants in the context of early stage (i.e. small) versus late stage (i.e. large) tumors.
  • mice Female (8-10 weeks old) BALB/c mice were implanted with 2 x 10 6 CT26 cells subcutaneously in the right flank, and tumors were allowed to grow until average tumor size reached 60 mm3.
  • mice were randomized into groups of either 6 (vehicle control) or 8 (MDNA132-Fc- MDNA109) mice each based on tumor size. • Mice were dosed by IP with either vehicle (PBS) or MDNA132-Fc-MDNA109 at 5 mg/kg once weekly for 2 weeks
  • mice that were cured of their primary CT26 tumors following 2 doses of MDNA132-Fc-MDNAl 09 are protected against subsequent re-challenges the three mice were implanted with CT26 on their opposite flank on Day 49 of the study and were not given any further treatment. As controls, naive untreated mice were also implanted with CT26 tumor cells. As shown in Figure 14(a), naive BALB/c mice showed robust CT26 tumor growth. In contrast, the mice treated with MDNA132-Fc-MDNA109 and cured of their primary tumors did not show any sign of tumor growth at the re-challenge site, suggesting that they have developed a strong memory response against CT26 tumor cells. These mice have undergone a second re-challenge and are continued to be monitored. MDNA132-Fc-MDNA109 therefore provides these mice with overall survival benefits in spite of multiple re-challenges ( Figure 14(b)).
  • the B16F10 syngeneic melanoma model in C57B1/6 mice is an aggressive in vivo tumor model that has withstood many therapeutic efforts due in part to the speed at which these tumors grow and metastasize in mice. In comparison to the CT26 tumor model, this is a significantly more difficult model to treat and therefore provides an important challenge to evaluate the potential therapeutic activity of bi-specific superkines.
  • Two efficacy studies were separately conducted to evaluate the efficacy of MDNA413-Fc-MDNA109 (KIH) and MDN A 109FE AA-F c-MDNA 109. Both studies followed a similar protocol as outlined below:
  • mice Female (8-10 weeks old) C57B1/6 mice were implanted with 3 x 105 C57B1/6 cells subcutaneously in the right flank, and tumors were allowed until tumor growth has been established before initiation of dosing.
  • mice were randomized into treatment groups based on tumor size such that average tumor size of each group are similar.
  • the 4T1 breast cancer model is also an aggressive model with a high incidence of tumor metastasis.
  • This model has been used to test the therapeutic activity of drugs aim at modulating myeloid-derived suppressor cells (MDSC) and Ml to M2 skewing of tumor associated fibroblasts, both of which work to support tumor growth.
  • MDSC myeloid-derived suppressor cells
  • mice • 8-weeks old female BALB/c mice were implanted with 2 x 1064T1 cells subcutaneously, and tumors were allowed to grow for 14 days prior to initiation of dosing.
  • mice in the MDNA132-Fc-MDNA109 and MDNA413-Fc- MDNA109 monotherapy and combination groups were found dead following the second dose, indicating adverse toxicity at the 5 mg/kg once weekly doing regimen in this model.
  • treatment with MDNA132-Fc- MDNA109 on the same regimen did not result in toxicity, suggesting that this may be related to the 4T1 tumor model itself.
  • tumors injected with MDNA109FEAA-Fc-MDNA413 continued to grow steadily during the study. However, it is not clear whether treatment did have an effect on the rate of growth because PBS controls were not available.
  • This report provides a summary of information available to date on bi-specific superkines (i.e. MDNA132-Fc-MDNAl 09 (KIH), MDNA413-Fc-MDNA109 (KIH), and MDNA109FEAA- Fc-MDNA109 (2: 1 :2)), including their manufacturing and in vitro and in vivo studies that have been performed to evaluate their biological activities.
  • bi-specific superkines i.e. MDNA132-Fc-MDNAl 09 (KIH), MDNA413-Fc-MDNA109 (KIH), and MDNA109FEAA- Fc-MDNA109 (2: 1 :2)
  • MDNA132-Fc-MDNA109, MDNA413-Fc- MDNA109 and MDNA109FEAA-Fc-MDNA413 are more potent than IL-2 and IL2-Fc at activation of naive CD8 T-cells, indicating that the activity of the core MDNA109 or MDNA109FEAA component of these bi-specific superkines are preserved.
  • MDNA132- Fc-MDNA109 and MDNA413-Fc-MDNA109 displayed similar activity on the Treg population as IL-2 and IL2-Fc
  • MDNA109FEAA-Fc-MDNA413 showed a dramatic reduction in ability to stimulate these immune-suppressive cells, as anticipated due to the FEAA mutations.
  • MTD studies in B ALB/c and C57B1/6 mice showed that MDNA132-Fc-MDNA109 and MDNA413-Fc-MDNA109 were well tolerated at the highest dose tested (2.5 mg/kg in BALB/c and 1.0 mg/kg in C57B1/6) when administered on a twice weekly schedule for 2 weeks. In both cases, MTD were not reached indicating that these bi-specific superkines can be safely administered at even higher doses.
  • MDNA132-Fc-MDNA109 (KIH) was tested in a CT26 colon tumor model, in which the treatment schedule was reduced to once weekly for 2 weeks, while the dose was increased to 5 mg/kg. This doing regimen was well tolerated. Data showed that MDNA132-Fc-MDNA109 (KIH) monotherapy potently inhibited the growth and CT26 tumors, and in fact induced complete and durable tumor regression in 3 of 8 mice. These mice are still viable and remaining tumor free for more than 3 months since treatment was stopped. Importantly, these mice have undergone a re challenge with CT26 tumor cells and were found to be resistance against tumor growth, suggesting that they have developed a strong memory response against CT26. An additional re-challenge has been initiated with these mice.
  • MDNA413-Fc-MDNA109 inhibited the growth the B16F10 melanomas when administered twice weekly for two weeks.
  • the inhibitory effect was dose-dependent with mice receiving a dose of 2.5 mg/kg displaying slower tumor growth than mice receiving a dose of 1 mg/kg.
  • MDNA109FEAA-Fc-MDNA109 had little to no effect on the growth of B 16F 10 melanomas when administered at 5 mg/kg once weekly for 3 weeks. It is possible that a higher dose or more frequent dosing schedule is needed to achieve a therapeutic effect.
  • MDNA132-Fc-MDNA109 was well tolerated in the CT26 tumor model in BALB/c mice (see above), it was not well tolerated well in the 4T1 model, also in BALB/c mice, under the exact dosing regimen of 5 mg/kg once weekly for two weeks. Mice died soon after receiving the second dose of MDNA132-Fc-MDNA109 irrespective of whether treatment was monotherapy or in combination with anti-PDl. Similarly, 4T1 tumor bearing mice treated once weekly with MDNA413-Fc-MDNA109 at 5 mg/kg also died soon after receiving the second dose. These data suggest the lethality associated with these bi-specific superkines may be related to the 4T1 model itself rather than the strain of mice used in the experiment.
  • HEK-BlueTMIL-4/IL-13 cells The capacity of MDNA413-Fc-MDNA109 (KIH) and MDNA109-Fc-MDNA413 to inhibit IL-4 and IL-13 induced STAT6 activation was assayed by using HEK-BlueTMIL-4/IL-13 cells. These cells were generated by stably introducing the human STAT6 gene into HEK293 cells to obtain a fully active STAT6 signaling pathway. The other genes of the pathway are naturally expressed in sufficient amounts. Furthermore, HEK-BlueTM IL-4/IL-13 Cells stably express the reporter gene secreted embryonic alkaline phosphatase (SEAP) under the control of the IFNb minimal promoter fused to four STAT6 binding sites.
  • SEAP embryonic alkaline phosphatase
  • HEK BlueTM IL-4/IL-13 cells were treated with human IL-4 (hIL4), human IL-13 (hIL13) or mouse IL-13 (mIL13) with or without an indicated fusion protein for 24 hours. 20 pi of the cell culture supernatant was then taken and mixed with 180 m ⁇ of QUANTI-BlueTM solution and incubated for 2 hours at 37 ° C. Absorbance was measured at 650 nm.
  • human IL-4 hIL4
  • human IL-13 hIL13
  • mouse IL-13 mIL13
  • MDNA109FEAA-F c-MDN A413 and MDNA132-Fc- MDNA109 (KIH) maintain IL-2 mutein activity
  • the IL-2 activity was assessed in the bispecific fusion proteins comprising an IL-2 mutein.
  • the murine T cell line CTLL2 was used. This line is IL-2 dependent and constitutively expresses the abg form of IL-2R.
  • the cells were cultured in RPMI 1640 supplemented with 10% heat-inactivated FBS, 2 mM L-glutamine, 50 U/ml penicillin, and 50 mg/ml streptomycin.
  • Recombinant human IL-2 (rhI12) or various fusion proteins were supplemented to the cell culture and the proliferation of the cells were assayed.
  • PBMCs were isolated over a density gradient, allowed to rest in complete media, and then stimulated for 15 minutes with 10-point 5-fold dilutions (from 25,000 pM to 0.013 pM) of each test construct to generate dose-response curves in order to determine EC50.
  • Cells were fixed immediately following stimulation, and samples analyzed by flow cytometry after intracellular staining for phosphorylated STAT5 (pSTAT5) in the immune cell subsets listed in Table 21.
  • the gating strategy employed to enable pSTAT5 analysis in these subsets is depicted in Figure 7 and representative fluorescence minus one (FMO) controls are shown in Figure 8.
  • PBMCs were stimulated with IL-2 (25 nM) for 15 minutes prior to staining and analysis by flow-cytometry.
  • Single lymphocytes were identified from which NK cells (CD3-CD56+), CD8+ T-cells (CD3+CD8+), Tregs (CD3+CD4+CD25+FOXP3+) and non-Treg CD4+ T-cells (CD3+CD25-CD4+FOXP3-) were gated. Frequency of pSTAT5 positive cells was determined for each immune cell subset.
  • FMO fluorescence minus one
  • mice of 6-8 weeks of age were acclimatized for at least 7 days prior to start of experiment. Mice were administered with constructs by intraperitoneal (IP) inject following the dose and schedule indicated below. During the 2-week study, mice were monitored daily by cage-side observation and body weight measurements twice weekly. In these studies, MTD was strictly defined as any incidence of spontaneous mortality or mandatory termination due to weight loss (> 20% of the pre dose weight) or moribund during the study period. At end of the study, mice were euthanized and necropsy was performed.
  • IP intraperitoneal
  • mice treated with either 1 mg/kg or 2.5 mg/kg of MDNA132-Fc-MDNA109 or MDNA413-Fc-MDNA109 twice weekly for two weeks were all viable at the end of the study. Mice in both groups appeared clinically normal and maintained their weights during the study period. In summary, MTD was not reached at the highest dose tested (2.5 mg/kg) on a twice weekly dosing schedule for two weeks for both MDNA132-Fc-MDNA109 and MDNA413-Fc- MDNA109 in BALB/c mice.
  • C57B1/6 has been found to be more sensitive to IL-2 than BALB/c mice (Chen et al, 2005).
  • MTD was not reached at the highest dose tested (1.0 mg/kg) on a twice weekly dosing schedule for two weeks for both MDNA132-Fc- MDNA109 and MDNA413-Fc-MDNA109 in C57B1/6 mice.
  • mice MTD Study in C57B1/6 strain of mice. [00459] Note: Chen X, Oppenheim JJ, Howard OM. BALB/c mice have more CD4+CD25+ T regulatory cells and show greater susceptibility to suppression of their CD4+CD25- responder T cells than C57BL/6 mice. J Leukoc Biol. (2005) 78(1): 114-21.
  • CT26 syngeneic colon cancer model was selected to evaluate the therapeutic potential of bi-specific superkines for a number of reasons:
  • the CT26 cancer model is less aggressive compared to many other cancer models (e.g. B16F10 melanoma model, 4T1 metastatic breast cancer model or the Panc2 pancreatic cancer model), therefore providing a larger window to follow the therapeutic effects of MDNA109 variants.
  • cancer models e.g. B16F10 melanoma model, 4T1 metastatic breast cancer model or the Panc2 pancreatic cancer model
  • CT26 cancer model is responsive to ICIs in contrast to several other models, therefore providing an opportunity to evaluate combinatory treatments to determine potential synergy.
  • CT26 tumors provide an opportunity to evaluate the anti -tumor activity of MDNA109 variants in the context of early stage (i.e. small) versus late stage (i.e. large) tumors.
  • mice Female (8-10 weeks old) BALB/c mice were implanted with 2 x 106 CT26 cells subcutaneously in the right flank, and tumors were allowed to grow until average tumor size reached 60 mm3.
  • mice were randomized into groups of either 6 (vehicle control) or 8 (MDNA132-Fc- MDNA109) mice each based on tumor size.
  • mice were dosed by IP with either vehicle (PBS) or MDNA132-Fc-MDNA109 at 5 mg/kg once weekly for 2 weeks. This was based on dose and schedule of other MDNA109 constructs under investigation at that time.
  • mice As provided in Figure 14, to validate whether mice that were cured of their primary CT26 tumors following 2 doses of MDNA132-Fc-MDNA109 are protected against subsequent re challenges, the three mice were implanted with CT26 on their opposite flank on Day 49 of the study and were not given any further treatment. As controls, naive untreated mice were also implanted with CT26 tumor cells. Naive BALB/c mice showed robust CT26 tumor growth. In contrast, the mice treated with MDNA132-Fc-MDNA109 and cured of their primary tumors did not show any sign of tumor growth at the re-challenge site, suggesting that they have developed a strong memory response against CT26 tumor cells. These mice have undergone a second re challenge and are continued to be monitored. MDNA132-Fc-MDNA109 therefore provides these mice with overall survival benefits in spite of multiple re-challenges.
  • the B16F10 syngeneic melanoma model in C57B1/6 mice is an aggressive in vivo tumor model that has withstood many therapeutic efforts due in part to the speed at which these tumors grow and metastasize in mice. In comparison to the CT26 tumor model, this is a significantly more difficult model to treat and therefore provides an important challenge to evaluate the potential therapeutic activity of bi-specific superkines. To date, two efficacy studies have been separately conducted to evaluate the efficacy of MDNA413-Fc-MDNA109 (KIH) and MDNA109FEAA-Fc- MDNA109.
  • mice were randomized into treatment groups based on tumor size such that average tumor size of each group are similar.
  • Treatment with MDNA413-Fc-MDNA109 resulted in inhibition of B16F10 tumor growth in a dose-dependent manner.
  • MDNA413-Fc-MDNA109 given at 2.5 mg/kg was more potent at growth inhibition than the 1 mg/kg dose.
  • HEK-Blue IL-4/IL-13 reporter cells were purchased from InvivoGen (Catalog bkb0il413). The kit contained all necessary contents for execution. Detailed description of methodology is provided by the InvivoGen. This cell line provides readout of activation of IL-4/IL-13 signaling in response to these cytokines.
  • cells were plated at 50,000 cells per well in the test medium per the manufacturer’s instructions and treated with serially diluted hIL13, mIL13, and hIL4 for 24 hours. After incubation, the cell supernatant (20 pL) was removed to anew plate and then 180 of QUANTI-Blue solution was added and incubated for 2 hours at 37C. Plates were scanned on a conventional plate reader for absorbance at 650 nm.
  • Variants tested are presented in Table 24.
  • Cells were plated at 50,000 cells per well in the test medium per the manufacturer’s instructions and treated with increasing concentrations of hIL13, mIL13 and hIL4 for 24 hours.
  • wells containing hIL13 (at 10 and 30 ng/mL), mIL13 (at 10 ng/mL) and hIL4 (at 0.1 ng/mL) were treated with increasing concentrations of the test constructs listed in Table 25. Two concentrations were selected for hIL13 to examine the difference between running the assay at saturating or just sub-saturating levels of hIL13.
  • the cell supernatant (20 pL) was removed to a new plate and then 180 of QUANTI- Blue solution was added and incubated for 2 hours at 37C. Plates were scanned on a conventional plate reader for absorbance at 650 nm.
  • Table 24 Test Constructs [00483] As provided in Figure 21, for hIL13 the addition of up to 10,000 ng/mL of the various test proteins had a clear inhibitory effect on the hIL13 response with Fc4-MDNA413 and MDNA1 09FEAA -Fc-413 when hIL13 was tested at 10 ng/mL (--ECHO). MDNA413-Fc- MDNA109 KIH had a weak effect, and no obvious effect was observed with Fc-MDNA109. When hIL13 was included at 30 ng/mL (ECIOO), the responses were similar although the overall level of inhibition observed was much lower due to the higher level hIL13 included in the reactions.
  • CTLL-2 is a mouse cytotoxic T lymphocyte cell line that is dependent on IL-2 for growth, and used as an in vitro functional model to measure potency of IL-2 as they express high affinity IL-2 receptor (IL-2R) consisting of CD 122, CD 132 and CD25, shown to be highly sensitive to IL-2 treatment (Carmenate et al, 2013).
  • IL-2R high affinity IL-2 receptor
  • CTTL2 cells were plated into 96 well plates at 30,000 cells per well in media lacking the TSTIM proliferation supplement. Following plating, cells were treated increasing concentrations of the various samples listed in Table 25 for 48 hours. After treatment, Cell Titer Blue viability reagent (Promega G8080) was added to each well and the plates were scanned after 3 hours at 560Ex/590Em for development of the fluorescent viability signal. Triplicate wells were tested at each concentration of the test samples.
  • rhIL-2 shows dose-response of CTLL-2 cell proliferation to increasing concentration of rhIL-2 (as expected). rhIL-2 was used as a control.
  • IL-2 Proleukin
  • Use of IL-2 (Proleukin) to treat renal carcinoma and metastatic melanoma achieved durable response in -15% of cases, but its application is limited due to its short half-life, toxicity and undesirable activation of Tregs, the latter due to binding to IL-2RaPy.
  • MDNA11 is a long-acting IL-2 Superkine with enhanced affinity to IL-2RPy (expressed by CD8+ T & NK cells) and diminished binding to IL-2Ra y (expressed by Tregs).
  • MDNA11 demonstrated potent therapeutic efficacy in mouse tumor models as monotherapy and in combination with immune checkpoint inhibitor.
  • MDNA11 exhibited prolonged half-life and induced durable proliferation and expansion of CD8 T cells, CD4 T helper cells, NK cells but not Tregs.
  • MDNA11 did not cause vascular leak syndrome (i.e pulmonary edema), hypertension, cytokine storm and anti-drug antibody response.
  • IL-2 and IL-13 superkine platforms enable engineering of long- acting bi-specific constructs to simultaneously activate IL-2 signaling (i.e. pro-inflammatory) and suppress IL-4/IL-13 function (i.e. anti-inflammatory) to target immunologically ‘cold’ tumors.
  • TME tumor microenvironment
  • IL-2/IL-13 Bi-specific Superkines Targeting immunologic “cold tumors” by modulation of TME (tumor microenvironment) with IL-2/IL-13 Bi-specific Superkines.
  • “Cold” tumors are not responsive to check-point inhibitors because of a pro-tumoral TME, including low CD8 + & NK cell counts; high Treg counts and high number of immune- suppressive myeloid cells (i.e. TAM & MDSC).
  • MDNA132-Fc-MDNA109 (1:1:1) molecule does in fact bind to the human and mouse IL13Ra2 receptors with similar affinity as Fc-IL13.
  • Receptor binding affinity of MDNA132 and MDNA413 was assessed by surface plasmon resonance using Biacore T200 instrument. Briefly, Protein A (or anti -human Fc) was pre- immobilised on the sensor chip and captured each construct via its Fc portion. A receptor was flown over the surface to measure association, followed by a dissociation. Multiple concentrations of the receptors were tested in separate cycle, multi cycle kinetics (MCK). [00508] As shown in Figure 38, Fc-MDNA132 (1:1 KIH) bound to IL13Ra2 and not IL13Ral. The K D FC-MDNA132 for IL13Ra2 is estimated to be 1.30E-09 M.
  • the IL-2 pathway plays a vital role in stimulating a pro-inflammatory (Thl) response against cancer through expansion and activation of effector CD8 T and NK cells.
  • the IL-4/IL-13 pathway stimulates myeloid derived suppressor cells (MDSCs) and M2 skewing of tumor associated macrophage (TAM) to foster an anti-inflammatory (Th2) response that is often exploited by cancers as a means to dampen the effects of the Thl pathway. Therefore, suppression of MDSC and M2 TAM through inhibition of the IL-4/IL-13 pathway together with stimulation of effector immune cells through activation of the IL-2 pathway have the potential to invigorate a pro- inflammatory response in an otherwise immune suppressive tumor microenvironment (TME).
  • TAE immune suppressive tumor microenvironment
  • the binding affinity to IL13Ral and IL13Ra2 by SPR was measured using the human IgG (Fc) Capture Chip principle, which utilizes the following steps: (1) Immobilization: Immobilized Anti -Human IgG (Fc) antibody on CM5 chip; (2) Capture: capture the IL-13 Protein, Fc Tag or sample; (3) Analyte: the analyte is Human IL-13 R alpha 1 Protein or Human IL-13 R alpha 2 Protein; and (4) Regeneration: 3 M magnesium chloride.
  • a pSTAT5 signaling assay in human PBMC was implemented as follows. PBMCs were isolated over a density gradient, allowed to rest in complete media, and then stimulated for 15 minutes with IL2, MDNA109FEAA-Fc or MDNA109FEAA-Fc-MDNA413. Controls included non-stimulated PBMC cells. Cells were fixed immediately following stimulation, and samples analyzed by flow cytometry after intracellular staining for phosphorylated STAT5 (P-STAT5) in the immune subsets, Naive CD8 T cells (CD8+ CD25-), NK cells and Tregs.
  • P-STAT5 phosphorylated STAT5
  • HEK Blue IL-4/IL-13 reporter cells from InvivoGen
  • HEK-Blue IL-4/IL-13 reporter cells (Invivogen) were plated at 50,000 cells per well in the test medium per the manufacturer’s instructions and treated with increasing concentrations of either hIL4 or hIL13 for 24 hours (standard curve.
  • wells containing hIL13 or hIL4 were treated with increasing concentrations of the test samples.
  • Each standard or test sample serial dilution was assayed in duplicate wells.
  • the cell supernatants (20 pL) were removed to a new plate and then 180 of QUANTI-Blue solution was added and incubated for 2 hours at 37°C. Plates were scanned on a conventional plate reader for absorbance at 650 nm.
  • a macrophage polarization assay was performed as follows. Monocytes were first isolated from fresh or thawed frozen vial of human peripheral blood mononuclear cells (PBMCs) from 2 donors using EasySepTM Human Monocyte Enrichment Kit without CD 16 Depletion on RoboSep. Cells were then seeded onto low-bind 6-well plates at 2 x 10 6 cells /well. Maturation of monocytes were then induced for 72hrs using 50ng/mL M-CSF exposure in media containing RPMI with L- glutamine (Gibco 21875-034), 10% FBS, 2% Pen-Strep, and incubated at 37 °C and 5 % CO 2 . Polarization was subsequently done using the IL-13 agonist or control for another 72hrs, following which they were dissociated, fixed using BD CellFIX, stained and examined using flow cytometry.
  • PBMCs peripheral blood mononuclear cells
  • a CT26 colon cancer syngeneic mouse model was developed and used as follows. Female BALB/c mice were implanted with 2 x 10 6 CT26 cells subcutaneously in the right flank (study day 0) and allowed to grow for 11 days prior to the initiation of dosing. The average tumor size in the treatment group at time of dosing was about 60 mm 3 . MDNA132-Fc-MDNA109 was used at 5mg/kg and the IP was QWx2.
  • Figure 41A-41C along with the KD values in Figure 41D, shows that Fc-MDNA413 binds to the functional receptor IL13Ral with a higher affinity than Fc-IL13. Also, the affinity to the decoy receptor, IL13Rct2 is reduced for Fc-MDNA413 in comparison to Fc-IL13. The higher binding affinity of Fc-MDNA413 for IL13Ral is also observed in the bispecific construct MDNA109FEAA-Fc-MDNA413 indicating that it can bind more strongly to IL13Ral receptor than Fc-IL-13.
  • FIG. 42A-42B shows that MDNA109FEAA-Fc-MDNA413 is able to activate signaling in naive CD8 T cells and NK cells with a higher potency than rhIL-2. However, the potency is greatly reduced for pSTAT5 signaling in Tregs with MDNA109FEAA-Fc-MDNA413 in comparison to rhIL-2. These data show that MDNA109FEAA-Fc-MDNA413 is superior to rhIL-2 at activating immune effectors cell response required for achieve anti-cancer efficacy.
  • Figure 43A-43C shows that both Fc-MDNA413 (monospecific) and MDNA109FEAA- Fc-MDNA413 (bispecific) are able to inhibit the IL4 (top panel) and IL13 (bottom panel) induced pSTAT6 signaling in the HEK Blue reporter cells with EC50 as shown in the table above. These data showed that Fc-MDNA413 and MDNA109FFEAA-Fc-MDNA413 can suppress IL-4 and IL- 13 induced signaling.
  • Figure 44A-44B shows that CD209 is a marker for M2 macrophages and is induced upon IL13 stimulation.
  • both Fc-MDNA413 (monospecific) and MDNA109FEAA-Fc-MDNA413 (bispecific) are able to inhibit the IL13 induced M2 polarization of macrophages in a dose dependent manner.
  • Figure 45A-45D along with the KD values in Figure 45E, shows that Fc-MDNA132 has preferential binding affinity for the decoy receptor, IL13Ra2 wherein no binding is observed to the functional receptor, IL13Rocl.
  • Fc-IL13 binds to both the functional receptor, IL13Ral and the decoy receptor, IL13Roc2.
  • FIG. 46A-46C shows that the bispecific construct MDNA132-Fc-MDNA109 is able to inhibit the tumor growth in the CT26 colon cancer model and also, extend overall survival in comparison to the vehicle control.
  • SIL2 M -FC-SIL13 M is a bi-specific superkine composed of an IL-2 super-agonist (sIL2 M ) and IL-13 super-antagonist (sIL13 M ) linked together by human IgGl Fc. sIL2 M binds CD122 with superior affinity over IL-2 but does not engage CD25, which is expressed on immune-suppressive Tregs.
  • SIL13 M has higher affinity than IL-13 for IL13Ral, which together with IL-4Ra forms a functional receptor complex.
  • sIL2 M -Fc-sIL13 M showed enhanced potency over IL-2 in the activation of CD8 T-cells and NK cells while exhibiting limited activity on Treg.
  • sIL2 M -Fc-sIL13 M demonstrated dose-dependent antagonism against stimulatory activity of both IL-4 and IL-13. This antagonistic effect was further validated with inhibition of IL-13 induced M2 polarization of macrophages in vitro.
  • SIL2 M -FC-SIL13 M is a bi-specific superkine capable of concomitantly stimulating a Thl response through activation of the IL-2 pathway and suppressing a Th2 response through inhibition of the IL-4/IL-13 pathway. Additional bi-specific superkine constructs will be tested, including those designed to enable accumulation in TME by engaging the decoy IL-13Ra2 that is overexpressed on a number of different tumor types.
  • HEK-Blue IL2 reporter cells were purchased from InvivoGen and the studies were done at MDS, San Diego, USA. The kit contained all necessary contents for execution. Cells were expanded as per the manufacturer’s instructions. An assay was performed with control compounds to show proof of principle and establish dose response ranges previously. Subsequently, assays were run to test the potency of the Bispecific constructs harboring IL-2 agonists in the HEK Blue IL-2 pSTAT5 reporter system. [00526] HEK-Blue IL2 reporter cells were plated at 50,000 cells per well in the test medium per the manufacturer’s instructions and treated with the constructs noted in Table 29 and at the concentrations noted for 24 hours.
  • the cell supernatant (20 pL) was removed to a new plate and then 180 pL of QUANTI-Blue solution was added and incubated for 2 hours at 37°C. Plates were scanned on a conventional plate reader for absorbance at 650 nm.
  • CTLL2 cells were plated into 96 well plates at 30,000 cells per well in media lacking the TSTIM proliferation supplement. Following plating, cells were treated increasing concentrations of the constructs listed in Table 30 below for 48 hours. As a comparator of activity, each plate also contained MDNA11 (TP28767F). After treatment, Cell Titer Blue viability reagent (Promega G8080) was added to each well and the plates were scanned after 3-6 hours at 560Ex/590Em for development of the fluorescent viability signal. Six plates were run for the assay, which each plate containing serial dilutions of the MDNA11 comparator and 2 test constructs run in duplicate wells.
  • MDNA19 MDNA019FEAA- Fc
  • MDNA109FEAA C125 -Fc-MDNA413 R39/Qin 2:1:2
  • the lowest potency observed was with H4FEAA-Fc-MDNA413 L39/Qin (2:1:2) which was - 2% of the MDNA1 1 potency and -1600 times less active than rhIL2 ( Figure 48).
  • HEK-Blue IL4/IL13 reporter cells were purchased from InvivoGen and the studies were done at MDS, San Diego, USA. The kit contained all necessary contents for execution. Cells were expanded as per the manufacturer’s instructions. An assay was performed with control compounds to show proof of principle and establish dose response ranges previously. Subsequently, assays were run to test the potency of the MDNA413 variants in the HEK Blue IL-4/IL-13 pSTAT6 reporter system.
  • HEK-Blue IL-4/IL-13 reporter cells (Invivogen) were plated at 50,000 cells per well in the test medium per the manufacturer’s instructions and treated with increasing concentrations of hIL4 (R&D Systems 204-IL-010/CF) for 24 hours (standard curve from 0.2 nM down to 0.0002 nM hIL4 serially diluted -0.5 log intervals).
  • wells containing hIL4 (at 0.1 nM), were treated with increasing concentrations of the test samples listed in Table 30 (150 nM down to 0.15 nM by 0.5 log intervals). Each standard or test sample serial dilution was assayed in duplicate wells.
  • HEK-Blue IL-4/IL-13 reporter cells (Invivogen) were plated at 50,000 cells per well in the test medium per the manufacturer’s instructions and treated with increasing concentrations of hIL13 (R&D Systems 213-ILB-005/CF) for 24 hours (standard curve from 8 nM down to 0.033 nM hIL13 serially diluted by a factor of 2.5x).
  • wells containing hIL13 (at 0.8 nM, 10 ng/mL), were treated with increasing concentrations of the test samples listed in Table 30 (150 nM down to 0.11 nM by a factor of 3.33x). Each standard or test sample serial dilution was assayed in duplicate wells. A total of 4 plates were run in the assay.
  • TF-1 cells were cultured in RPMI media (ATCC) supplemented with 10% FBS (Gibco) and 2 ng/mL GM-CSF (ThermoFisher). TF-1 cells were harvest and washed twice with PBS before being placed into media lacking GM-CSF. Cells were added at 30,000 cells per well on the day of the experiment in a volume of 100 pL. To perform the antagonist assay, the TF-1 proliferation assay, as outlined above, was setup using rhIL13 EC50 or EC80 in the proliferation assay.
  • Reactions were also supplemented with increasing concentrations of the anti-IL13Ral antibody or constructs.
  • Controls included in the plate consisted of 1) cells grown in complete media, 2) cells grown in un-supplemented media (no IL13 or GM-CSF), 3) cells supplemented with EC50 or EC80 rhIL13, and cells treated with an IL13 standard curve. Triplicate wells were treated under each condition. Cells were incubated for 96 hours and developed with CyQUANT. For development a 3x solution of the CyQUANT assay reagent was prepared according the manufacturer’s instructions and 100 pL of this solution was added to each well. Plates were incubated for 1 hour at 37°C, mixed and then centrifuged to settle the cells. Plates were read at 485Ex/535Em.
  • TF-1 cells were harvest and washed twice with PBS before being placed into media lacking GM-CSF. Cells were added at 30,000 cells per well on the day of the experiment in a volume of 100 pL. To perform the antagonist assay, the TF-1 proliferation assay was setup using rhIL13 EC80 in the proliferation assay.
  • MDNA109FEAA C125 -Fc-MDNA413 R39/Qm showed dose dependent inhibition of TF-1 proliferation with an IC50 of 37 nM ( Figure 71).
  • PBMCs were isolated over a density gradient, allowed to rest in complete media, and then stimulated for 15 minutes with IL2, MDNA109FEAA-Fc or MDNA109FEAA C125 -Fc- MDNAdlS 1 * 39 ⁇ 111 .
  • Controls included non-stimulated PBMC cells.
  • Cells were fixed immediately following stimulation, and samples analyzed by flow cytometry after intracellular staining for phosphorylated STAT5 (P-STAT5) in the immune subsets, Naive CD8 T cells (CD8+ CD25-), NK cells and Tregs (Figure 52).
  • MDNA109FEAA C125 -FC-MDNA413 R39/Q111 , human anti -PD 1 -MDN A 109FEAA S 125 , mouse anti-PDl-MDNA109FEAA S125 are able to activate signaling in naive CD8 T cells and NK cells with a higher potency than rhIL-2. However, the potency is greatly reduced for pSTAT5 signaling in Tregs in comparison to rhIL-2.
  • MDNA109FEAA C125 -Fc- MDNA4 13 109/(2111 , human anti-PDl-MDNA109FEAA S125 , mouse anti-PDl-MDNA109FEAA S125 are superior to rhIL-2 at activating immune effectors cell response required for achieve anti-cancer efficacy.
  • the construct H4FEAA-Fc-MDNA413 09/(2111 (2:1:2) is not potent though in inducing pSTAT5 induction in human PBMCs.
  • Human IgG (Fc) Capture Chip principle (1) Immobilization: Immobilized Anti-Human IgG (Fc) antibody on CM5 chip; (2) Capture: capture the IL-13 Protein, Fc Tag or sample; (3) Analyte: the analyte is Human IL-13 R alpha 1 Protein or Human IL-13 R alpha 2 Protein; and (4) Regeneration: 3 M magnesium chloride (Figure 53).
  • CD14+ monocytes were separated using magnetic selection and differentiated into MO macrophage in the presence of AB serum over 6 days using M-CSF.
  • Figure 76A shows phenotyping of IL-4 treated macrophages in the presence of Fc- MDNA413 R39/Q111 (1:2);
  • Figure 76B shows phenotyping of IL-4 treated macrophages in the presence of Fc4-MDNA413 R39/Q111 (l:2);
  • Figure 76C shows phenotyping of IL-4 treated macrophages in the presence of MDNA109FEAA C125 -Fc-MDNA413 R39/Q111 (2:l:2);
  • Figure 76D shows phenotyping of IL-4 treated macrophages in the presence of hu anti-PDl-MDNA413 R39/Q1 H (T2);
  • Figure 76E shows phenotyping of IL-4 treated macrophages in the presence of mouse anti-PDl-MDNA413 R39/Qm (l:2).
  • dotted lines represent: IL-4 only control
  • dashed lines represent: M0 control.
  • Figure 77A shows phenotyping of IL-13 treated macrophages in the presence ofFc- MDNA413 R39/qu1 (1:2);
  • Figure 77B shows phenotyping of IL-13 treated macrophages in the presence of Fc4-MDNA413 R39/Q111 (l:2);
  • Figure 77C shows phenotyping of IL-13 treated macrophages in the presence of MDNA109FEAA C125 -Fc-MDNA413 R39/Q111 (2: 1 :2);
  • Figure 77D shows phenotyping of IL-13 treated macrophages in the presence ofhu anti-PDl-MDNA413 R39/Q1 H (L2);
  • Figure 77E shows phenotyping of IL-13 treated macrophages in the presence of mouse anti-PDl-MDNA413
  • dotted lines represent: IL-13 only control
  • dashed lines represent: M0 control.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/CA2021/050872 2020-06-24 2021-06-24 Bifunctional superkines and uses thereof Ceased WO2021258213A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
US18/002,824 US20230365642A1 (en) 2020-06-24 2021-06-24 Bifunctional superkines and uses thereof
CN202180050945.2A CN116390744A (zh) 2020-06-24 2021-06-24 双功能性超级因子及其用途
EP21828793.6A EP4172216A4 (en) 2020-06-24 2021-06-24 BIFUNCTIONAL SUPERKINE AND USES THEREOF
CA3183825A CA3183825A1 (en) 2020-06-24 2021-06-24 Bifunctional superkines and uses thereof
JP2022579927A JP2023532273A (ja) 2020-06-24 2021-06-24 二重特異性スーパーカイン及びその使用

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US202063043227P 2020-06-24 2020-06-24
US63/043,227 2020-06-24
US202063093724P 2020-10-19 2020-10-19
US63/093,724 2020-10-19
US202063094322P 2020-10-20 2020-10-20
US63/094,322 2020-10-20
US202163165738P 2021-03-24 2021-03-24
US202163165600P 2021-03-24 2021-03-24
US63/165,600 2021-03-24
US63/165,738 2021-03-24

Publications (1)

Publication Number Publication Date
WO2021258213A1 true WO2021258213A1 (en) 2021-12-30

Family

ID=79282489

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/CA2021/050872 Ceased WO2021258213A1 (en) 2020-06-24 2021-06-24 Bifunctional superkines and uses thereof

Country Status (6)

Country Link
US (1) US20230365642A1 (cg-RX-API-DMAC7.html)
EP (1) EP4172216A4 (cg-RX-API-DMAC7.html)
JP (1) JP2023532273A (cg-RX-API-DMAC7.html)
CN (1) CN116390744A (cg-RX-API-DMAC7.html)
CA (1) CA3183825A1 (cg-RX-API-DMAC7.html)
WO (1) WO2021258213A1 (cg-RX-API-DMAC7.html)

Cited By (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022266598A1 (en) * 2021-06-14 2022-12-22 Regeneron Pharmaceuticals, Inc. Bispecific il-2- and anti-pd-1-based therapeutics and methods of use thereof
WO2023133595A2 (en) 2022-01-10 2023-07-13 Sana Biotechnology, Inc. Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses
WO2023193015A1 (en) 2022-04-01 2023-10-05 Sana Biotechnology, Inc. Cytokine receptor agonist and viral vector combination therapies
WO2023170475A3 (en) * 2022-03-08 2023-11-16 Medicenna Therapeutics, Inc. Uses and methods for il-2, il-13, and il-4 cytokine bifunctional molecules
WO2023248009A1 (en) * 2022-06-21 2023-12-28 Medicenna Therapeutics, Inc. Dosing methods for use with il-2 superagonists, agonists, and fusions thereof
WO2024073435A3 (en) * 2022-09-27 2024-05-30 Anwita Biosciences, Inc. Anti-lag-3/il-2 fusion proteins, encoding polynucleotides, pharmaceutical compositions, and therapeutic applications
EP4185605A4 (en) * 2020-07-09 2024-07-17 Eutilex Co., Ltd. IL-2 VARIANTS
US12091440B2 (en) 2019-12-20 2024-09-17 Regeneron Pharmaceuticals, Inc. IL2 and peptide-MHC complex fusion proteins and methods of use thereof
WO2024215989A1 (en) 2023-04-14 2024-10-17 Sotio Biotech Inc. ENGINEERED IMMUNE CELLS FOR TREATING CANCER IN COMBINATION WITH IL-2/IL-15 RECEPTOR βγ AGONISTS
US12187771B2 (en) 2012-08-09 2025-01-07 The Board Of Trustees Of The Leland Stanford Junior University Method of producing Th9 T-cells
WO2025003770A3 (en) * 2023-06-27 2025-02-20 Medicenna Therapeutics Inc. Il-2 fusion proteins
US12274735B2 (en) 2017-10-10 2025-04-15 Medicenna Therapeutics Inc. IL-4-fusion formulations for treatment of central nervous system (CNS) tumors
US12404497B2 (en) 2018-06-01 2025-09-02 Medicenna Therapeutics Inc. Uses and methods for oncolytic virus targeting of IL-4/IL-13 and fusions thereof
US12503496B2 (en) 2013-09-24 2025-12-23 Medicenna Therapeutics Inc. Interleukin-4 receptor-binding fusion proteins and uses thereof
US12590133B2 (en) 2018-06-01 2026-03-31 The Board Of Trustees Of The Leland Stanford Junior University IL-13/IL-4 superkines: immune cell targeting constructs and methods of use thereof

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2024330564A1 (en) 2023-08-30 2026-04-02 Xilio Development, Inc. Vhh masked cytokines and methods of use thereof

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018234862A1 (en) * 2017-06-19 2018-12-27 Medicenna Therapeutics Inc. Uses and methods for il-2 superagonists, agonists, and fusions thereof
WO2019239213A2 (en) * 2018-06-01 2019-12-19 Medicenna Therapeutics Inc. Uses and methods for oncolytic virus targeting of il-4/il-13 and fusions thereof

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2850093B1 (en) * 2012-01-27 2019-01-09 The Board of Trustees of the Leland Stanford Junior University Therapeutic il-13 polypeptides
US12590133B2 (en) * 2018-06-01 2026-03-31 The Board Of Trustees Of The Leland Stanford Junior University IL-13/IL-4 superkines: immune cell targeting constructs and methods of use thereof
CA3098930A1 (en) * 2018-09-21 2020-03-26 Innovent Biologics (Suzhou) Co., Ltd. Novel interleukin-2 and use thereof

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018234862A1 (en) * 2017-06-19 2018-12-27 Medicenna Therapeutics Inc. Uses and methods for il-2 superagonists, agonists, and fusions thereof
WO2019239213A2 (en) * 2018-06-01 2019-12-19 Medicenna Therapeutics Inc. Uses and methods for oncolytic virus targeting of il-4/il-13 and fusions thereof

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
ARON M. LEVIN, DARREN L. BATES, AARON M. RING, CARSTEN KRIEG, JACK T. LIN, LEON SU, IGNACIO MORAGA, MIRO E. RAEBER, GREGORY R. BOW: "Exploiting a natural conformational switch to engineer an interleukin-2 ‘superkine’", NATURE, ¬MACMILLAN JOURNALS LTD., ETC.|, vol. 484, no. 7395, pages 529 - 533, XP055214333, ISSN: 00280836, DOI: 10.1038/nature10975 *
MOUTIH RAFEI, SHAFIQUE FIDAI, ROSEMINA MERCHANT, FAHAR MERCHANT: "MDNA109: Effect of an interleukin-2 superkine on CD 8 T- cell properties in the tumor microenvironment.", JOURNAL OF CLINICAL ONCOLOGY, vol. 37, no. S15, 1 January 2019 (2019-01-01), US , pages 1 - 2, XP009541791, ISSN: 0732-183X, DOI: 10.1200/JCO.2019.37.15_suppl.e14220 *
SUN ZHICHEN, REN ZHENHUA, YANG KAITING, LIU ZHIDA, CAO SHUAISHUAI, DENG SISI, XU LILY, LIANG YONG, GUO JINGYA, BIAN YINGJIE, XU HA: "A next-generation tumor-targeting IL-2 preferentially promotes tumor-infiltrating CD8+ T-cell response and effective tumor control", NATURE COMMUNICATIONS, vol. 10, no. 1, 1 December 2019 (2019-12-01), XP055851865, DOI: 10.1038/s41467-019-11782-w *

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12187771B2 (en) 2012-08-09 2025-01-07 The Board Of Trustees Of The Leland Stanford Junior University Method of producing Th9 T-cells
US12503496B2 (en) 2013-09-24 2025-12-23 Medicenna Therapeutics Inc. Interleukin-4 receptor-binding fusion proteins and uses thereof
US12274735B2 (en) 2017-10-10 2025-04-15 Medicenna Therapeutics Inc. IL-4-fusion formulations for treatment of central nervous system (CNS) tumors
US12590133B2 (en) 2018-06-01 2026-03-31 The Board Of Trustees Of The Leland Stanford Junior University IL-13/IL-4 superkines: immune cell targeting constructs and methods of use thereof
US12404497B2 (en) 2018-06-01 2025-09-02 Medicenna Therapeutics Inc. Uses and methods for oncolytic virus targeting of IL-4/IL-13 and fusions thereof
US12319724B2 (en) 2019-12-20 2025-06-03 Regeneron Pharmaceuticals, Inc. IL2 agonists and methods of use thereof
US12215131B2 (en) 2019-12-20 2025-02-04 Regeneron Pharmaceuticals, Inc. IgG Fc-IL2-Rα-IL2 fusions and methods of use thereof
US12091440B2 (en) 2019-12-20 2024-09-17 Regeneron Pharmaceuticals, Inc. IL2 and peptide-MHC complex fusion proteins and methods of use thereof
EP4185605A4 (en) * 2020-07-09 2024-07-17 Eutilex Co., Ltd. IL-2 VARIANTS
US12528851B2 (en) 2021-06-14 2026-01-20 Regeneron Pharmaceuticals, Inc. IL2-based therapeutics and methods of use thereof
WO2022266598A1 (en) * 2021-06-14 2022-12-22 Regeneron Pharmaceuticals, Inc. Bispecific il-2- and anti-pd-1-based therapeutics and methods of use thereof
WO2023133595A2 (en) 2022-01-10 2023-07-13 Sana Biotechnology, Inc. Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses
WO2023170475A3 (en) * 2022-03-08 2023-11-16 Medicenna Therapeutics, Inc. Uses and methods for il-2, il-13, and il-4 cytokine bifunctional molecules
WO2023193015A1 (en) 2022-04-01 2023-10-05 Sana Biotechnology, Inc. Cytokine receptor agonist and viral vector combination therapies
WO2023248009A1 (en) * 2022-06-21 2023-12-28 Medicenna Therapeutics, Inc. Dosing methods for use with il-2 superagonists, agonists, and fusions thereof
WO2024073435A3 (en) * 2022-09-27 2024-05-30 Anwita Biosciences, Inc. Anti-lag-3/il-2 fusion proteins, encoding polynucleotides, pharmaceutical compositions, and therapeutic applications
WO2024215989A1 (en) 2023-04-14 2024-10-17 Sotio Biotech Inc. ENGINEERED IMMUNE CELLS FOR TREATING CANCER IN COMBINATION WITH IL-2/IL-15 RECEPTOR βγ AGONISTS
WO2025003770A3 (en) * 2023-06-27 2025-02-20 Medicenna Therapeutics Inc. Il-2 fusion proteins

Also Published As

Publication number Publication date
EP4172216A1 (en) 2023-05-03
CA3183825A1 (en) 2021-12-30
US20230365642A1 (en) 2023-11-16
EP4172216A4 (en) 2024-12-04
CN116390744A (zh) 2023-07-04
JP2023532273A (ja) 2023-07-27

Similar Documents

Publication Publication Date Title
US12338269B2 (en) IL-2 superagonists in combination with anti-PD-1 antibodies
US20230365642A1 (en) Bifunctional superkines and uses thereof
US20220347268A1 (en) Il-4r as a biomarker in cancer
US12404497B2 (en) Uses and methods for oncolytic virus targeting of IL-4/IL-13 and fusions thereof
CN109476749A (zh) 改良的过继性t细胞疗法
WO2023248009A1 (en) Dosing methods for use with il-2 superagonists, agonists, and fusions thereof
US20250387474A1 (en) Uses and methods for il-2, il-13, and il-4 cytokine bifunctional molecules
EP4735483A2 (en) Il-2 fusion proteins
KR20260057409A (ko) Il-2 융합 단백질
WO2024148369A1 (en) Targeted il-12 affinity variants
KR20260030127A (ko) Il-12 안정성 변이체
HK40106146A (zh) 使用溶瘤病毒递送正交il-2选择性刺激实体瘤中的t细胞
HK40030405B (en) Chimeric antigen receptor (car) binding to bcma, and uses thereof
HK40030405A (en) Chimeric antigen receptor (car) binding to bcma, and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21828793

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3183825

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022579927

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202317004546

Country of ref document: IN

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021828793

Country of ref document: EP

Effective date: 20230124