WO2021211683A2 - Compositions and methods for targeted therapeutic delivery to bone - Google Patents
Compositions and methods for targeted therapeutic delivery to bone Download PDFInfo
- Publication number
- WO2021211683A2 WO2021211683A2 PCT/US2021/027230 US2021027230W WO2021211683A2 WO 2021211683 A2 WO2021211683 A2 WO 2021211683A2 US 2021027230 W US2021027230 W US 2021027230W WO 2021211683 A2 WO2021211683 A2 WO 2021211683A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- sequence
- chimeric polypeptide
- polypeptide comprises
- tricalcium phosphate
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/51—Bone morphogenetic factor; Osteogenins; Osteogenic factor; Bone-inducing factor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1875—Bone morphogenic factor; Osteogenins; Osteogenic factor; Bone-inducing factor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/52—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an inorganic compound, e.g. an inorganic ion that is complexed with the active ingredient
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Definitions
- the present disclosure is based on the discovery that the use of a composition comprising a mammalian growth factor (e.g., bone morphogenetic protein 2 (BMP -2)) or a functional portion thereof, and a targeting polypeptide (e.g., a polypeptide that binds to bone or a carrier material) can vastly improve bone healing and accelerate tissue regrowth.
- a mammalian growth factor e.g., bone morphogenetic protein 2 (BMP -2)
- a targeting polypeptide e.g., a polypeptide that binds to bone or a carrier material
- a carrier material such as calcium phosphate (e.g., b-tricalcium phosphate or b-TCP), hydroxyapatite, or other materials suitable for use in an implantable device.
- compositions comprising any of these chimeric polypeptides (and optionally, a carrier material), and methods of promoting bone or cartilage formulation, methods of replacing and/or repairing bone or cartilage, and methods of treating a bone fracture or bone loss that include administration of any of these compositions.
- the compositions and methods provided herein can increase and sustain the number of progenitor cells at sites of bone and/or cartilage injury through stem cell capture.
- the compositions and methods provided herein can also be applied to soft tissue repair or localized delivery of a therapeutic.
- a polypeptide composition comprising: a targeting polypeptide comprising a sequence at least 80% identical to SEQ ID NO: 22 (LLADTTHHRPWT VIGESTHHRPWS IIGESSHHKPFT GLGDTTHHRPW G ILAESTHHKPWT), and a therapeutic polypeptide comprising a sequence at least 80% identical to a sequence selected from SEQ ID NOS: 32, 46-71, 73-77, 79-101, 152, 168, 176, 268.
- the therapeutic polypeptide comprises a sequence at least 90% identical to a sequence selected from SEQ ID NOS: 32, 46-71, 73-77, 79-101, 152, 168, 176,
- the therapeutic polypeptide comprises a sequence selected from SEQ ID NOS: 32, 46-71, 73-77, 79-101, 152, 168, 176, 268. In some embodiments, the therapeutic polypeptide comprises a sequence at least 80%, 85%, 90%, or 95% identical to SEQ ID NO: 32. In some embodiments, the therapeutic polypeptide comprises SEQ ID NO: 32. In some embodiments, the targeting polypeptide comprises a sequence at least 90% or 95% identical to SEQ ID NO: 22. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 22. In some embodiments, the targeting polypeptide comprises a sequence at least 90% or 95% identical to SEQ ID NO: 22.
- the targeting polypeptide comprises SEQ ID NO: 22. In some embodiments, the targeting polypeptide comprises a sequence at least 90% or 95% identical to SEQ ID NO: 22. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 22. In some embodiments, the targeting polypeptide comprises a sequence at least 90% or 95% identical to SEQ ID NO: 22. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 22. In some embodiments, the targeting polypeptide comprises a sequence at least 90% or 95% identical to SEQ ID NO: 22. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 22.
- polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 551
- the polypeptide composition comprises X, and X comprises SEQ ID NO: 22 (LLADTTHHRPWTVIGESTHHRPWSIIGESSHHKPFTGLGDTTHHRPWGILAESTHHKPWT).
- the composition comprises a sequence at least about 90% or 95% identical to SEQ ID NO: 551.
- polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 639
- polypeptide composition comprises X, and X comprises SEQ ID NO: 2 (VIGESTHHRPWS).
- X comprises SEQ ID NO: 2 (VIGESTHHRPWS).
- the composition comprises a sequence at least about 90% or 95% identical to SEQ ID NO: 639.
- polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 519
- polypeptide composition comprises X, and X comprises SEQ ID NO: 6 (IIGESSHHKPFT).
- the composition comprises a sequence at least about 90% or 95% identical to SEQ ID NO: 519.
- polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 521
- composition comprises X, and X comprises SEQ ID NO: 7 (GLGDTTHHRPWG).
- composition comprises a sequence at least about 90% or 95% identical to SEQ ID NO: 521.
- polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 515
- polypeptide composition comprises X, and X comprises SEQ ID NO: 4 (ILAESTHHKPWT).
- the composition comprises a sequence at least about 90% or 95% identical to SEQ ID NO: 515.
- polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 501. In some embodiments, the sequence is at least about 90% or 95% identical to SEQ ID NO: 501. In some embodiments, the sequence comprises SEQ ID NO: 501.
- polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 507. In some embodiments, the sequence is at least about 90% or 95% identical to SEQ ID NO: 507. In some embodiments, the sequence comprises SEQ ID NO: 507. Also provided herein is a polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 506. In some embodiments, the sequence is at least about 90% or 95% identical to SEQ ID NO: 506. In some embodiments, the sequence comprises SEQ ID NO: 506.
- polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 505. In some embodiments, the sequence is at least about 90% or 95% identical to SEQ ID NO: 505. In some embodiments, the sequence comprises SEQ ID NO: 505.
- polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 504. In some embodiments, the sequence is at least about 90% or 95% identical to SEQ ID NO: 504. In some embodiments, the sequence comprises SEQ ID NO: 504.
- polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 503. In some embodiments, the sequence is at least about 90% or 95% identical to SEQ ID NO: 503. In some embodiments, the sequence comprises SEQ ID NO: 503.
- polypeptide composition comprising a sequence at least about 80% identical to SEQ ID NO: 502. In some embodiments, the sequence is at least about 90% or 95% identical to SEQ ID NO: 502. In some embodiments, the sequence comprises SEQ ID NO: 502.
- polypeptide composition comprising: a targeting polypeptide comprising a sequence at least 80%, identical to SEQ ID NO: 22
- BMP bone morphogenetic protein
- nucleic acid encoding a polypeptide composition described herein.
- vector comprising the nucleic acid.
- a device comprises a polypeptide composition described herein, and a carrier material.
- the polypeptide composition is bound to the carrier material.
- the carrier material comprises calcium phosphate.
- the carrier material comprises hydroxyapatite.
- the carrier material comprises alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, or chelated divalent metal ions, or any combination thereof.
- the polypeptide composition or the device is delivered to treat a bone defect in the subject.
- at least about 0.5 mg of polypeptide composition per cc of defect volume is delivered to the subject.
- about 0.5 mg to about 10 mg of polypeptide composition per cc of defect volume is delivered to the subject.
- Also provided herein is a method of delivering a therapeutic agent to an organ or tissue of a subject comprising delivering to the organ or tissue a carrier material and the therapeutic agent, wherein the therapeutic agent is bound to the carrier material via a targeting polypeptide comprising: (a) a sequence at least 80% identical to SEQ ID NO: 22, (b) a sequence at least 80% identical to SEQ ID NO: 402, (c) a sequence at least 80% identical to SEQ ID NO: 401, (d) a sequence at least 80% identical to SEQ ID NO: 413 ((X1)(X2)), wherein XI comprises SEQ ID NO:
- X2 comprises SEQ ID NO: 2 and SEQ ID NO: 6, (e) a sequence at least 80% identical to SEQ ID NO: 21, (f) a sequence at least 80% identical to SEQ ID NO: 414 ((X1)(X2)), wherein XI comprises SEQ ID NO: 2, and X2 comprises SEQ ID NO: 6 and SEQ ID NO: 7, (g) a sequence at least 80% identical to SEQ ID NO: 416 ((X1)(X2)), wherein XI comprises SEQ ID NO: 6, and X2 comprises SEQ ID NO: 7 and SEQ ID NO: 4, (h) a sequence at least 80% identical to SEQ ID NO:
- X2 comprises SEQ ID NO: 7, (1) a sequence at least 80% identical to SEQ ID NO: 412 ((X1)(X2)), wherein XI comprises SEQ ID NO: 7, and X2 comprises SEQ ID NO: 4, (m) a sequence at least 80% identical to SEQ ID NO: 2 (VIGESTHHRPWS), (n) a sequence at least 80% identical to SEQ ID NO: 4 (ILAESTHHKPWT), (o) a sequence at least 80% identical to SEQ ID NO: 6 (IIGESSHHKPFT), (p) a sequence at least 80% identical to SEQ ID NO: 7 (GLGDTTHHRPWG), or (q) any combination of two or more of (a) to (p).
- the carrier material comprises calcium phosphate.
- the targeting polypeptide is connected to the therapeutic agent.
- the therapeutic agent comprises a growth factor.
- the therapeutic agent comprises BMP.
- the BMP comprises BMP -2.
- the therapeutic agent comprises a sequence at least about 80% identical to SEQ ID NO: 32.
- the therapeutic agent comprises a sequence at least about 80% identical to any one of SEQ ID NOS: 46-71, 73-77, 79-101, 152, 168, 176, 268.
- the therapeutic agent is delivered to treat a bone defect in the subject.
- at least about 0.5 mg of the therapeutic agent is delivered per cc of defect volume.
- about 0.5 mg to about 10 mg of the therapeutic agent is delivered per cc of defect volume.
- chimeric polypeptides comprising: (i) a targeting polypeptide comprising one or more of the following: an amino acid sequence at least about 70%, 75%, 80%,
- VIGESTHHRPWS (SEQ ID NO: 2), an amino acid sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to LIADSTHHSPWT (SEQ ID NO: 3), ILAESTHHKPWT (SEQ ID NO: 4), an amino acid sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to ILAETTHHRPWS (SEQ ID NO: 5), an amino acid sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to IIGESSHHKPFT (SEQ ID NO: 6), an amino acid sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to GLGDTTHHRPWG (SEQ ID NO: 7), an amino acid sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to VLGDTTHHKPWT (SEQ ID NO: 8), an amino acid sequence at least about 70%, 75%, 80%
- the targeting polypeptide comprises the sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 2. In some embodiments, the targeting polypeptide comprises the sequence at least about 90% identical to SEQ ID NO: 2. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 2.
- the targeting polypeptide comprises the sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 4. In some embodiments, the targeting polypeptide comprises the sequence at least about 90% identical to SEQ ID NO: 4. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 4.
- the targeting polypeptide comprises the sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 6. In some embodiments, the targeting polypeptide comprises the sequence at least about 90% identical to SEQ ID NO: 6. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 6.
- the targeting polypeptide comprises the sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 7. In some embodiments, the targeting polypeptide comprises the sequence at least about 90% identical to SEQ ID NO: 7. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 7.
- the targeting polypeptide comprises two or more targeting polypeptides. In some embodiments, two or more targeting polypeptides is no more than about 50, 45, 40, 35, 30, 25, 20, 15, or 10 targeting polypeptides. In some embodiments, two or more targeting polypeptides is about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, or 30 targeting polypeptides. In some embodiments, two or more targeting polypeptides is about 2 to about 10 targeting polypeptides. In some embodiments, two or more targeting polypeptides is about 5 targeting polypeptides.
- each neighboring pair of the two or more targeting polypeptides directly abut each other. In some embodiments, at least two of the two or more targeting polypeptides directly abut each other.
- each neighboring pair of the two or more targeting polypeptides are separated by a linker sequence. In some embodiments, at least two of the two or more targeting polypeptides are separated by a linker sequence.
- the targeting polypeptide comprises at least two different polypeptides.
- the targeting polypeptide includes two or more copies of the same polypeptide.
- the targeting polypeptide further comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 1. In some embodiments, the targeting polypeptide comprises the sequence at least about 90% identical to SEQ ID NO: 1. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 1.
- the targeting polypeptide comprises: (i) a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 1, (ii) a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 2, (iii) a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 4, (iv) a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 6, (v) a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 7, or (vi) any combination of (i) to (v).
- the targeting polypeptide comprises (i), (ii), (iii), (iv), and (v). In some embodiments, the targeting polypeptide comprises SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 7. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 7.
- the targeting polypeptide comprises LLADTTHHRPWT (SEQ ID NO: 1) and/or GQVLPTTTPSSP (SEQ ID NO: 44).
- the targeting polypeptide comprises LLADTTHHRPWT (SEQ ID NO: 1) and/or VIGESTHHRPWS (SEQ ID NO: 2).
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to LLADTTHHRPWTVIGESTHHRPW S (SEQ ID NO: 20). In some embodiments, the targeting polypeptide comprises a sequence at least about 90% identical to SEQ ID NO: 20. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 20
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to LLADTTHHRPWT (SEQ ID NO: 1), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to VIGESTHHRPWS (SEQ ID NO: 2), and a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to IIGESSHHKPFT (SEQ ID NO: 6).
- the targeting polypeptide comprises a sequence at least 90% identical to SEQ ID NO: 1, a sequence at least 90% identical to SEQ ID NO: 2, and a sequence at least 90% identical to SEQ ID NO: 6.
- the targeting polypeptide comprises SEQ ID NOS: 1, 2, and 6.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to VIGESTHHRPWS (SEQ ID NO: 2), and a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to IIGESSHHKPFT (SEQ ID NO: 6).
- the targeting polypeptide comprises a sequence at least 90% identical to SEQ ID NO: 2, and a sequence at least 90% identical to SEQ ID NO: 6.
- the targeting polypeptide comprises SEQ ID NOS: 2, and 6.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the targeting polypeptide comprises a sequence at least about 90% identical to SEQ ID NO: 21. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 21.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the targeting polypeptide comprises a sequence at least about 90% identical to SEQ ID NO: 401. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 401.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the targeting polypeptide comprises a sequence at least about 90% identical to SEQ ID NO: 402. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 402.
- the targeting polypeptide comprises LLADTTHHRPWT (SEQ ID NO: 1), VIGESTHHRPWS (SEQ ID NO: 2), IIGESSHHKPFT (SEQ ID NO: 6), GLGDTTHHRPWG (SEQ ID NO: 7), and ILAESTHHKPWT (SEQ ID NO: 4).
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the targeting polypeptide comprises a sequence at least about 80% identical to SEQ ID NO: 22. In some embodiments, the targeting polypeptide comprises a sequence at least about 90% identical to SEQ ID NO: 22. In some embodiments, the targeting polypeptide comprises SEQ ID NO: 22.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to LLADTTHHRPWT (SEQ ID NO: 1) and a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to ILAESTHHKPWT (SEQ ID NO: 4).
- the targeting polypeptide comprises a sequence at least 90% identical to SEQ ID NO: 1 and a sequence at least 90% identical to SEQ ID NO: 4.
- the targeting polypeptide comprises SEQ ID NO: 1 and SEQ ID NO: 4.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to LLADTTHHRPWTILAESTHHKPWT (SEQ ID NO: 23).
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to LLADTTHHRPWT (SEQ ID NO: 1) and a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to GLGDTTHHRPW G (SEQ ID NO: 7).
- the targeting polypeptide comprises a sequence at least about 90% identical to SEQ ID NO: 1 and a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 7.
- the targeting polypeptide comprises SEQ ID NO: 1 and SEQ ID NO: 7.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to LLADTTHHRPWTGLGDTTHHRPWG (SEQ ID NO: 25).
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical toLLADTTHHRPWTGLGDTTHHRPWGLLADTTHHRPWTGLGDTTHHRPWGLLADTTHHRP WTG LG DTTHHRPWG LLADTTHHRPWT (SEQ ID NO: 28).
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to STADTSHHRPS (SEQ ID NO: 10), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to TSGGESTHHRPS (SEQ ID NO: 11), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to TSGGESSHHKPS (SEQ ID NO: 12), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to TGSGDSSHHRPS (SEQ ID NO: 13), and a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to GSSGESTHHKPST (SEQ ID NO: 14).
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to VGADSTHHRPVT (SEQ ID NO: 15), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to GAADTTHHRPVT (SEQ ID NO: 16), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to AGADTTHHRPVT (SEQ ID NO: 17), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to GGAD 11 HHRPAT (SEQ ID NO: 18) and a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to GGADTTHHRPGT (SEQ ID NO: 19).
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to STADTSHHRPS (SEQ ID NO: 10), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to LLADTTHHRPWT (SEQ ID NO: 1), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to TSGGESTHHRPS (SEQ ID NO: 11), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to VGADSTHHRPVT (SEQ ID NO: 15), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to TSGGESSHHKPS (SEQ ID NO: 12), a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to GAADTTHHRPVT (SEQ ID NO: 16),
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the targeting polypeptide comprises an amino acid sequence of Formula I: AoBoCoDoEoFoGoHoIoJoKoLo (Formula I) (SEQ ID NO: 35), wherein: Ao is V, L, I, G, S, T or A; Bo is I, L, V, Q, T, S, G or A; Co is G, A, V or S; Do is E, D, L or G; Eo is S, T, P T, E or D; Fo is T or S; Go is H, T or S; Ho is H or T; Io is R, S, K, P or H; Jo is P, S, R or K; Ko is W, F, S, P, V, A or G; and Lo is absent or is S, T G, (or A).
- Formula I does not comprise LLADTTHHRPWT (SEQ ID NO: 1).
- the targeting polypeptide comprises two or more amino acid sequences having Formula I. In some embodiments, at least two of the two or more amino acid sequences are different. In some embodiments, at least two or the two or more amino acid sequences are the same.
- two or more is about 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- At least two of the two or more amino acid sequences having Formula I directly abut each other. In some embodiments, each of the two or more amino acid sequences having Formula I directly abut each other.
- At least two of the two or more amino acid sequences of Formula I are separated by a linker sequence. In some embodiments, each of the two or more amino acid sequences having Formula I are separated by a linker sequence.
- the mammalian growth factor comprises one or more of the following: epidermal growth factor (EGF), platelet derived growth factor (PDGF), insulin like growth factor (IGF-1), fibroblast growth factor (FGF), fibroblast growth factor 2 (FGF2), fibroblast growth factor 18 (FGF 18), transforming growth factor alpha (TGF-a), transforming growth factor beta (TGF-b), transforming growth factor beta 1 (TGF- b 1), transforming growth factor beta 3 (TGF ⁇ 3), osteogenic protein 1 (OP-1), osteogenic protein 2 (OP-2), osteogenic protein 3 (OP-3), bone morphogenetic protein 2 (BMP -2), bone morphogenetic protein 3 (BMP-3), bone morphogenetic protein 4 (BMP -4), bone morphogenetic protein 5 (BMP-5), bone morphogenetic protein 6 (BMP-6), bone morphogenetic protein 7 (BMP-7), bone morphogenetic protein (BMP-9), bone morphogenetic protein
- the mammalian growth factor comprises a functional portion of one or more of the following: epidermal growth factor (EGF), platelet derived growth factor (PDGF), insulin like growth factor (IGF-1), fibroblast growth factor (FGF), fibroblast growth factor 2 (FGF2), fibroblast growth factor 18 (FGF18), transforming growth factor alpha (TGF-a), transforming growth factor beta (TGF-b), transforming growth factor beta 1 (TGF-bI), transforming growth factor beta 3 (TGF ⁇ 3), osteogenic protein 1 (OP-1), osteogenic protein 2 (OP-2), osteogenic protein 3 (OP-3), bone morphogenetic protein 2 (BMP -2), bone morphogenetic protein 3 (BMP-3), bone morphogenetic protein 4 (BMP -4), bone morphogenetic protein 5 (BMP-5), bone morphogenetic protein 6 (BMP-6), bone morphogenetic protein 7 (BMP-7), bone morphogenetic protein (BMP-9),
- EGF epidermal growth factor
- PDGF platelet derived
- the mammalian growth factor comprises BMP -2. In some embodiments, the mammalian growth factor comprises a functional portion of BMP -2. In some embodiments, the mammalian growth factor comprises the mature BMP -2 peptide without signal sequence. In some embodiments, the functional portion of BMP -2 comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the mammalian growth factor comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a sequence of Table B. In some embodiments, the mammalian growth factor comprises a sequence at least about 90% identical to SEQ ID NO: 32.
- the mammalian growth factor comprises SEQ ID NO: 32.
- the chimeric polypeptide comprises (a) the targeting polypeptide comprising: (i) a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 1, (ii) a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 2, (iii) a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 4, (iv) a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 6, (v) a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 7, or (vi) any combination of (i) to (v); and (b) the mammalian growth factor comprising a functional portion of BMP -2.
- the functional portion of BMP -2 comprises SEQ ID NO: 32.
- the chimeric polypeptide comprises the targeting polypeptide comprising SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 7; and the mammalian growth factor comprising SEQ ID NO: 32.
- the targeting polypeptide and mammalian growth factor are connected via a linker polypeptide.
- the chimeric polypeptide comprises the targeting polypeptide comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 402; and the mammalian growth factor comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- the chimeric polypeptide comprises the targeting polypeptide comprising a sequence at least about 90% identical to SEQ ID NO: 402, and the mammalian growth factor comprising a sequence at least about 90% identical to SEQ ID NO: 32.
- the targeting polypeptide and mammalian growth factor are connected via a linker polypeptide.
- the chimeric polypeptide comprises the targeting polypeptide comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 22; and the mammalian growth factor comprising a sequence at least about 70%, 75%, 80%,
- the chimeric polypeptide comprises the targeting polypeptide comprising a sequence at least about 90% identical to SEQ ID NO: 22, and the mammalian growth factor comprising a sequence at least about 90% identical to SEQ ID NO: 32.
- the targeting polypeptide and mammalian growth factor are connected via a linker polypeptide.
- the chimeric polypeptide further comprises a linker sequence.
- the linker sequence connects the targeting polypeptide and the mammalian growth factor.
- the linker sequence comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the linker sequence comprises at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to GAGTG (SEQ ID NO: 34).
- the chimeric polypeptide comprises a flexible linker comprising a sequence of about 5 to about 50 amino acids, where at least about five of the amino acids have no regular secondary structure.
- regular secondary structure comprises any helical structure like an alpha helix or 3 io helix or p helix, a beta turn, omega loop, and/or a beta sheet.
- the flexible linker comprises at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85% or 90% glycine, alanine, serine, glycine and alanine, glycine and serine, alanine and serine, or glycine, alanine, and serine.
- the linker comprises 1, 2, 3, 4, or 5 GSEG (SEQ ID NO: 702).
- the linker comprises 1, 2, 3, 4, or 5 SEGG (SEQ ID NO: 703).
- the chimeric polypeptide comprises a linker sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the linker comprises a sequence at least about 90% identical to SEQ ID NO: 701. In some embodiments, the linker comprises SEQ ID NO: 701.
- the chimeric polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the chimeric polypeptide comprises a sequence at least about 90% identical to SEQ ID NO: 502. In some embodiments, the chimeric polypeptide comprises a sequence at least about 91% identical to SEQ ID NO: 502.
- the chimeric polypeptide comprises a sequence at least about 92% identical to SEQ ID NO: 502. In some embodiments, the chimeric polypeptide comprises a sequence at least about 93% identical to SEQ ID NO: 502. In some embodiments, the chimeric polypeptide comprises a sequence at least about 94% identical to SEQ ID NO: 502. In some embodiments, the chimeric polypeptide comprises a sequence at least about 95% identical to SEQ ID NO: 502. In some embodiments, the chimeric polypeptide comprises a sequence at least about 96% identical to SEQ ID NO: 502. In some embodiments, the chimeric polypeptide comprises a sequence at least about 97% identical to SEQ ID NO: 502.
- the chimeric polypeptide comprises a sequence at least about 98% identical to SEQ ID NO: 502. In some embodiments, the chimeric polypeptide comprises a sequence at least about 99% identical to SEQ ID NO: 502. In some embodiments, the chimeric polypeptide comprises SEQ ID NO: 502.
- the chimeric polypeptide binds to a carrier material.
- the targeting polypeptide binds to the carrier material.
- the carrier material comprises calcium phosphate.
- the carrier material comprises b-TCP.
- the carrier material comprises hydroxyapatite.
- the targeting polypeptide binds to the carrier material with a K D of about 1 picomolar to about 100 micromolar.
- the targeting polypeptide binds to b-TCP with a K D of about 1 picomolar to about 100 micromolar.
- the K D is measured using any method known in the art and/or described herein.
- compositions comprising any of one of the chimeric polypeptides described herein.
- the composition comprises a carrier material.
- the carrier material comprises calcium phosphate.
- the carrier material comprises b-TCP.
- the carrier material comprises hydroxyapatite.
- the carrier material is formulated as a powder, a putty, or a paste.
- the carrier material comprises a scaffold, a fiber, a mesh, or a sponge.
- the composition is a pharmaceutical composition.
- kits comprising any of the polypeptides, carrier materials and/or compositions described herein.
- targeting polypeptides of any of the chimeric polypeptides described herein are also provided herein.
- the subject has a bone fracture. In some embodiments of any of the methods described herein, the subject has a bone defect. In some embodiments of any of the methods described herein, the subject has a cartilage tear or cartilage defect. In some embodiments of any of the methods described herein, the subject has cartilage loss.
- subject refers to any mammal.
- a subject therefore refers to, for example, mice, rats, dogs, cats, horses, cows, pigs, guinea pigs, rats, humans, monkeys, and the like.
- the subject When the subject is a human, the subject may be referred to herein as a patient.
- the subject or “subject in need of treatment” may be a canine (e.g., a dog), feline (e.g., a cat), equine (e.g., ahorse), ovine, bovine, porcine, caprine, primate, e.g., a simian (e.g., a monkey (e.g., marmoset, baboon), or an ape (e.g., a gorilla, chimpanzee, orangutan, or gibbon), a human, or a rodent (e.g., a mouse, a guinea pig, a hamster, or a rat).
- a canine e.g., a dog
- feline e.g., a cat
- equine e.g., ahorse
- ovine bovine
- porcine caprine
- primate e.g., a simi
- the subject or “subject in need of treatment” may be a non-human mammal, especially mammals that are conventionally used as models for demonstrating therapeutic efficacy in humans (e.g., murine, lapine, porcine, canine, or primate animals) may be employed.
- mammals that are conventionally used as models for demonstrating therapeutic efficacy in humans (e.g., murine, lapine, porcine, canine, or primate animals) may be employed.
- the term “therapeutically effective amount” refers to an amount of a polypeptide or composition effective to “treat” a disease, condition or disorder in a subject. In some cases, therapeutically effective amount of the polypeptide or composition reduces the severity of symptoms of the disease, condition or disorder. In some instances, the disease, condition or disorder comprises a defect in an organ or tissue.
- Affinity refers to the strength of the sum total of non-covalent interactions between a b- TCP binding sequence (or a chimeric polypeptide or polypeptide comprising a b-TCP binding sequence) and its binding partner (e.g., b-TCP). Affinity can be measured by common methods known in the art, including those described herein. Affinity can be determined, for example, using surface plasmon resonance (SPR) technology (e.g., BIACORE®) or biolayer interferometry (e.g., FORTEBIO®). Additional methods for determining affinity are known in the art.
- SPR surface plasmon resonance
- BIACORE® BIACORE®
- biolayer interferometry e.g., FORTEBIO®
- Percent (%) sequence identity with respect to a reference polypeptide sequence is the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are known for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Appropriate parameters for aligning sequences are able to be determined, including algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
- the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No.
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif., or may be compiled from the source code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows: 100 times the fraction X/Y, where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B.
- FIG. 1A are representative in vivo radiographs (lateromedial orientation) of animals from experimental Group A.
- FIG. IB are representative in vivo radiographs (lateromedial orientation) of animals from experimental Group B.
- FIG. 1C are representative in vivo radiographs (lateromedial orientation) of animals from experimental Group C.
- FIG. 3A are representative radiographs, sagittal, and transverse micro-CT images at 4-weeks post-operation from animals in Group A, B, or C.
- FIG. 3B are representative radiographs, sagittal, and transverse micro-CT images at 4-weeks post-operation from animals in Group A, B, or C.
- FIG. 4 is a schematic representation of the varied callus formation in animals from Group A, B, or C at 4 weeks post-surgery.
- the red-shaded area is an approximation of the mineralized callus volume.
- the data are represented as Mean ⁇ SEM; * P ⁇ 0.01 vs B, # P ⁇ 0.0.1 vs C.
- the data are represented as Mean ⁇ SEM; * P ⁇ 0.01 vs B, # P ⁇ 0.0.1 vs C.
- Bone mineral volume is expressed as the percentage of bone mineral volume to total volume.
- the data are represented as Mean ⁇ SEM; * P ⁇ 0.05 vs B, # P ⁇ 0.0.5 vs C.
- the data are represented as Mean ⁇ SEM; * P ⁇ 0.01 vs B, # P ⁇ 0.0.1 vs C.
- the data are represented as Mean ⁇ SEM; * P ⁇ 0.01 vs B, # P ⁇ 0.0.1 vs C.
- FIG. 8 is a representative graph of ultimate load to failure (ULF) at 4- and 8-weeks post surgery for animals in Group A, B, or C (for each Group A-C, the bar on the left is 4 weeks and the bar on the right is 8 weeks). Data are represented as the mean +/- S.E.M. *P ⁇ 0.05 vs 4-week groups; #P ⁇ 0.01 vs 8-week groups.
- FIG. 9A are representative histological images of Von Kossa- and H&E-stained bone specimens obtained at 4 weeks post-surgery from animals in Group A, B, or C.
- FIG. 9B are representative histological images of TRAP+ osteoclast-stained bone specimens obtained at 4 weeks post-surgery from animals in Groups A, B, or C (left, middle, and right panels, respectively).
- White arrows indicate osteoclasts, and yellow arrows indicate osteocytes.
- FIG. 10A are representative Von Kossa- and H&E-stained histological images of bone specimens obtained at 8 weeks post-surgery from animals in Group A, B, or C.
- FIG. 10B are representative TRAP+ osteoclast-stained histological images of bone specimens obtained at 8 weeks post-surgery from animals in Group A, B, or C (left, middle, and right panels, respectively).
- White arrows indicate osteoclasts, and yellow arrows indicate osteocytes.
- FIG. 11 is a representative immunoblot of MCF-7 cell lysate probed with an anti-P-Akt antibody, wherein the MCF-7 cells were incubated with b-TCBP-HRG.
- FIG. 12 is a representative immunoblot of MCF-7 lysate probed with an anti-P-Akt antibody, wherein the MCF-7 cells were incubated with b-TCBP-HRG (free) or b-TCBP-HRG (b-TCP -bound).
- FIG. 13 outlines the procedure for generating a tibial defect in goats as described in Example
- FIG. 14A are Mean Radial BV and Mean Moment Angle plots that illustrate the pattern and extent of new bone mineralization in the defect site for each treatment group.
- FIG. 14B are Total Bone Volume plots in the 2.5 cm central region and 5 cm full defect region. Variation of total new bone volume among goats within treatment group was measured. At medium dose and high doses, tBMP-2 demonstrated comparable bone formation that was superior to the low dose and substrate only groups. For each Group A-D, the bar on the left corresponds to the 2.5 cm central region, and the bar on the right corresponds to the 5 cm region.
- FIG. 14C is a Dose-Response model fit curve using non-linear least squares regression built based on bone volume data in 2.5 cm central region (red dots).
- the solid blue central line is the fit of the dose-response model.
- the three orange points from bottom to top identify the model -estimated doses at which 50%, 75%, and 90% of maximum effect is achieved on the log scale.
- the orange lines are 75% confidence intervals for such doses.
- FIG. 15 outlines the procedure for generating and treating a tibial defect in sheep as described in Example 7.
- FIG. 16A are representative radiographs at each month of the study described in Example 7, in the treatment group receiving 2 mg tBMP-2 per cc defect volume.
- FIG. 16B is a graph of the mean ⁇ standard deviation bone volumes as measured from CT images for the study described in Example 7. For each week of treatment, the bars from left to right (dark to light shading) represent: 2 mg/cc tBMP2, 5 mg/cc tBMP2, and autograft control.
- FIG. 16C are representative radiographs (AP and ML views) of the tibia defects in all conditions. 2 mg/cc dose groups resulted in significant bone growth, as did the 5 mg/cc and control conditions. Results were generally consistent across the multiple sheep tested.
- FIG. 16D is a representative H&E histology image from the 2 mg/cc group at 8 weeks showing normal bone formation adjacent to the cut ends of the original cortex. Arrows indicate cortex (blue, top right arrow), connective (black, bottom right arrow) and cartilaginous tissue (grey, bottom left arrow), and new bone growth (green, top left arrow).
- FIG. 16E is a tetrachrome histology image from the 2 mg/cc group. At 8 weeks, residual polymer fibers are visible. Some are surrounded by new bone growth and some are surrounded by connective tissue with multinucleated giant cells associated with the biological breakdown of the fibers.
- polypeptides for targeted delivery of a therapeutic agent to a region of a subject comprising a defect.
- the region comprises bone and the therapeutic agent is delivered to treat a bone defect.
- the polypeptide is a targeting polypeptide comprising one or more of the polypeptides of Table A.
- the targeting polypeptide comprises Formula I: AoBoCoDoEoFoGoHoIoJoKoLo (Formula I) (SEQ ID NO: 35), where: Ao is V, L, I, G, S, T or A; Bo is I, L, V, Q, T, S, G or A; Co is G, A, V or S; Do is E, D, L or G; Eo is S, T, P T, E or D; Fo is T or S; Go is H, T or S; Ho is H or T; L is R, S, K, P or H; Jo is P, S, R or K; Ko is W, F, S, P, V, A or G; and Lo is absent or is S, T G, (or A).
- Formula I does not include LLADTTHHRPWT (SEQ ID NO: 1).
- chimeric polypeptides comprising the targeting polypeptide and a therapeutic agent.
- the therapeutic agent comprises one or more of the polypeptides of Table B.
- any of the targeting and/or chimeric polypeptides described herein can bind to one or more substrates comprising b TCP (e.g., a Mastergraft strip,
- any of the targeting and/or chimeric polypeptides described herein can bind to silicon nitride or a substrate comprising silicon nitride.
- compositions that comprise any of the targeting and/or chimeric polypeptides described herein.
- the compositions further comprise a substrate including b TCP (e.g., a Mastergraft strip, Vitoss Foam Pack, chronOS Strip, Vitoss Micromorsels, Lifelnk500, Hyperelastic Bone, bioactive glass, b TCP powder, b TCP spray dried powder, hydroxyapatite powder, hydroxyapatite -coated bone screw, b TCP granules, hydroxyapatite granules, and ReBOSSIS).
- the compositions further comprise a substrate comprising silicon nitride.
- kits that include any of these compositions. Also provided herein are methods of promoting bone or cartilage formation in a subject in need thereof, methods of replacing and/or repairing bone or cartilage in a subject in need thereof, and methods of treating a bone fraction or bone loss in a subject in need thereof that include administering to the subject any of the compositions described herein.
- Non-limiting aspects of these polypeptides, compositions, kits, and methods are described below, and can be used in any combination without limitation. Additional aspects of these polypeptides, compositions, kits, and methods are known in the art.
- chimeric polypeptides comprising a targeting polypeptide (e.g., a polypeptide capable of binding to a carrier material) and a therapeutic agent.
- a targeting polypeptide e.g., a polypeptide capable of binding to a carrier material
- the term “chimeric polypeptide” is interchangeable with a “fusion protein”, “polypeptide composition” and the like.
- the therapeutic agent comprises one or more of the peptides of Table B, or a functional portion thereof.
- the chimeric polypeptide comprises a targeting polypeptide comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to one or more of SEQ ID NOS: 1-43 or 401-422.
- the targeting polypeptide comprises Formula I.
- the targeting polypeptide comprises two or more targeting polypeptides. In some embodiments, two or more targeting polypeptides is no more than about 50, 45, 40, 35, 30, 25, 20, 15, or 10 targeting polypeptides. In some embodiments, two or more targeting polypeptides is about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, or 30 targeting polypeptides. In some embodiments, two or more targeting polypeptides is about 2 to about 10 targeting polypeptides. In some embodiments, two or more targeting polypeptides is about 5 targeting polypeptides.
- the targeting polypeptide of the chimeric polypeptide comprise Formula I: AoBoCoDoEoFoGoHoIoJoKoFo (Formula I) (SEQ ID NO: 35), wherein: Aois V, F, I, G, S, T, or A; Bo is I, F, V, Q, T, S, G, or A; Co is G, A, V, or S; Do is E, D, F, or G; Eo is S, T, P T, E, or D; Fo is T or S; Go is H, T, or S; Ho is H or T; Io is R, S, K, P, or H; Jo is P, S, R, or K; Ko is W, F, S, P, V, A, or G; and Fo is absent or is S, T, G, or A.
- Non-limiting examples of targeting polypeptides that may be present in any of the chimeric polypeptides described herein are listed in Table A below.
- Table A Exemplary targeting polypeptide sequences
- Table C Exemplary Chimeric Polypeptides
- any of the chimeric polypeptides described herein comprise one or more targeting polypeptides.
- the chimeric polypeptide comprises one to about ten targeting polypeptides.
- the chimeric polypeptide comprises about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 targeting polypeptides.
- the targeting polypeptide comprises one or more polypeptides that bind to a carrier material.
- the one or more polypeptides is about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 polypeptides.
- the targeting polypeptide comprises from about 10 to about 100, from about 10 to about 90, from about 10 to about 80, from about 10 to about 70, from about 10 to about 60, from about 10 to about 50, from about 10 to about 40, from about 10 to about 30, from about 20 to about 100, from about 20 to about 90, from about 20 to about 80, from about 20 to about 70, from about 20 to about 60, from about 20 to about 50, from about 20 to about 40, or from about 30 to about 80 amino acids.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 1.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 2.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 3.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 4.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 5.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 6.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 7.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 8.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 9.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 10.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 11.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 12.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 13.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 14.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 15.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 16.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 17.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 18.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to SEQ ID NO: 19.
- the chimeric polypeptide comprises one or more therapeutic agents of Table B, or a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a therapeutic agent of Table B.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- a carrier material e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 501.
- the chimeric polypeptide comprises SEQ ID NO: 501.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 502.
- the chimeric polypeptide comprises SEQ ID NO: 502.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 503.
- the chimeric polypeptide comprises SEQ ID NO: 503.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 504. In some embodiments, the chimeric polypeptide comprises SEQ ID NO: 504. In some aspects, further provided are compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 505.
- the chimeric polypeptide comprises SEQ ID NO: 505.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 506. In some embodiments, the chimeric polypeptide comprises SEQ ID NO: 506. In some aspects, further provided are compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tri calcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 507.
- the chimeric polypeptide comprises SEQ ID NO: 507.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 508, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 508.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 509, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 509.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 510, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 510.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 511, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 511.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 512, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 512.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 513, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 513.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 514, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 514.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 515, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 515.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 516, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 516.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 517, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 517.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 518, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 518.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 519, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 519.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 520, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 520.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 521, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 521.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 522, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 522.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 523, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 523.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 524, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 524.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 525, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 525.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 526, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 526.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 527, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 527.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 528, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 528.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 529, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 529.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 530, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 530.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 531, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 531.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 532, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 532.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 533, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 533.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 534, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 534.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 535, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 535.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 536, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 536.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 537, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 537.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 538, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 538.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 539, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 539.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 540, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 540.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 541, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 541.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 542, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 542.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 543, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 543.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 544, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 544.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 545, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 545.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 546, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 546.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 547, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 547.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 548, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 548.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 549, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 549.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 550, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 550.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 551, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 551.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 552, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 552.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 553, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 553.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 554, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 554.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 555, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 555.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 556, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 556.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 557, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 557.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 558, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 558.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 559, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 559.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 560, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 560.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 561, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 561.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 562, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 562.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 563, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 563.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 564, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 564.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 565, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 565.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 566, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 566.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 567, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 567.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 568, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 568.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 569, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 569.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 570, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 570.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 571, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 571.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 572, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 572.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 573, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 573.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 574, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 574.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 575, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 575.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 576, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 576.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 577, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 577.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 578, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 578.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 579, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 579.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 580, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 580.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 581, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 581.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 582, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 582.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 583, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 583.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 584, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 584.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 585, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 585.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 586, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 586.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 587, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 587.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 588, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 588.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 589, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 589.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 590, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 590.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 591, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 591.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 592, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 592.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 593, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 593.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 594, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 594.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 595, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 595.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 596, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 596.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 597, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 597.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 598, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 598.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 599, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 599.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 600, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 600.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 601, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 601.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 602, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 602.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 603, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 603.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 604, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 604.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 605, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 605.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 606, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 606.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 607, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 607.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 608, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 608.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 609, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 609.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 610, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 610.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 611, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 611.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 612, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 612.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 613, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 613.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 614, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 614.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 615, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 615.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 616, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 616.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 617, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 617.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 618, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 618.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 619, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 619.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 620, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 620.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 621, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 621.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 622, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 622.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 623, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 623.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 624, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 624.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 625, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 625.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 626, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 626.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 627, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 627.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 628, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 628.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 629, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 629.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 630, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 630.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 631, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 631.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 632, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 632.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 633, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 633.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 634, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 634.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 635, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 635.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 636, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 636.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 637, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 637.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 638, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 638.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide comprises a sequence at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 639, wherein the chimeric polypeptide comprises X.
- the chimeric polypeptide comprises SEQ ID NO: 639.
- compositions comprising the chimeric polypeptide and a carrier material, e.g., a carrier material provided herein.
- Non-limiting exemplary carrier materials may comprise one or more of the following: tricalcium phosphate, beta tricalcium phosphate, alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, and chelated divalent metal ions.
- methods of treating a defect in an organ and/or tissue comprising administering to a subject in need thereof the chimeric polypeptide and/or composition.
- the chimeric polypeptide further comprises a linker sequence between two targeting polypeptides. In some embodiments, the chimeric polypeptide further comprises a linker sequence between the targeting polypeptide and therapeutic agent.
- the chimeric polypeptide comprises a signal sequence at its N- terminus.
- the chimeric polypeptide comprises a tag sequence (e.g., a poly-Elis tag, chitin-binding protein (CBP), maltose-binding protein (MBP), strep-tag, glutathione-S-transferase (GST), thioredoxin, or Fc region). Additional examples of tags are known in the art.
- the chimeric polypeptide comprises a lead sequence at its N-terminus that may assist with expression of the polypeptide.
- the lead sequence comprises MPIGS (SEQ ID NO: 704).
- MPIGS SEQ ID NO: 704
- Non-limiting exemplary embodiments of a chimeric polypeptide are provided herein: (1) In a first embodiment, the chimeric polypeptide comprises a targeting polypeptide. (2) The chimeric polypeptide of embodiment 1, wherein the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 1. (3) The chimeric polypeptide of embodiment 1, wherein the targeting polypeptide comprises SEQ ID NO: 1.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 2.
- the targeting polypeptide comprises SEQ ID NO:
- the chimeric polypeptide of any previous embodiment, wherein the targeting polypeptide comprises SEQ ID NO: 4.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 6.
- the targeting polypeptide comprises SEQ ID NO: 7.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 8.
- the chimeric polypeptide of any previous embodiment, wherein the targeting polypeptide comprises SEQ ID NO: 8.
- the chimeric polypeptide of any previous embodiment, wherein the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 10.
- the chimeric polypeptide of any previous embodiment, wherein the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 14.
- the chimeric polypeptide of any previous embodiment, wherein the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 16.
- the chimeric polypeptide of any previous embodiment, wherein the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 18.
- the chimeric polypeptide of any previous embodiment, wherein the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 20.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 24.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 30.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 34.
- the targeting polypeptide comprises SEQ ID NO: 38.
- the targeting polypeptide comprises SEQ ID NO: 404.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 405.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 411.
- the targeting polypeptide comprises SEQ ID NO: 412.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 413.
- the targeting polypeptide comprises SEQ ID NO: 413.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 415.
- BMP bone morphogenetic protein
- the BMP comprises BMP -2.
- the BMP comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- the chimeric polypeptide of embodiment 135, wherein the BMP comprises SEQ ID NO: 32.
- the chimeric polypeptide of embodiment 133 or embodiment 134 wherein the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to a sequence set forth in Table B.
- the chimeric polypeptide of embodiment 140 wherein the two or more is 2, 3, 4, or 5 therapeutic sequences.
- the chimeric polypeptide of embodiment 140, wherein the two or more is from two to about ten.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 501, or wherein the chimeric polypeptide comprises SEQ ID NO: 501.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 502, or wherein the chimeric polypeptide comprises SEQ ID NO: 502.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 503, or wherein the chimeric polypeptide comprises SEQ ID NO: 503.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%,
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 505, or wherein the chimeric polypeptide comprises SEQ ID NO: 505.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 506, or wherein the chimeric polypeptide comprises SEQ ID NO: 506.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 507, or wherein the chimeric polypeptide comprises SEQ ID NO: 507.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 508 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 508.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 509 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 509.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 510 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 510.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%,
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%,
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%,
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 522 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 522.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 523 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 523.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 524 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 524.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 525 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 525.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 526 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 526.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 527 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 527.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 528 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 528.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 529 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 529.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 530 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 530.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 531 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 531.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 532 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 532.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 533 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 533.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 534 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 534.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 535 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 535.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 536 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 536.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 537 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 537.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 538 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 538.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 539 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 539.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 540 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 540.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 541 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 541.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 542 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 542.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 543 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 543.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 544 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 544.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 546 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 546.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 547 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 547.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 548 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 548.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 549 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 549.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 550 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 550.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 551 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 551.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 552 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 552.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 553 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 553.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 554 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 554.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 555 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 555.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 556 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 556.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 557 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 557.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 558 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 558.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 559 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 559.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 560 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 560.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 561 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 561.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 562 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 562.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 563 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 563.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 564 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 564.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 565 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 565.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 566 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 566.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 567 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 567.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 568 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 568.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 569 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 569.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 570 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 570.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 571 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 571.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 572 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 572.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 573 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 573.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 574 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 574.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 575 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 575.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 576 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 577.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 578 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 579.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 580 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 580.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 581 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 581.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 582 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 582.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 583 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 583.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 584 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 584.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 585 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 585.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 586 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 586.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 587 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 587.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 588 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 588.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 589 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 589.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 590 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 590.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 591 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 591.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 592 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 592.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 593 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 593.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 594 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 594.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 595 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 595.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 596 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 596.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 597 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 597.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 598 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 598.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 599 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 599.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 600 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 600.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 601 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 601.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 602 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 602.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 603 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 603.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 604 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 604.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 605 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 605.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 606 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 606.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 607 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 607.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 608 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 608.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 609 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 609.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 610 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 610.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 611 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 611.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 612 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 612.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 613 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 613.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 614 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 614.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 615 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 615.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 616 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 616.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 617 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 617.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 618 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 618.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 619 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 619.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 620 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 620.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 621 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 621.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 622 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 622.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 623 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 623.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 624 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 624.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 625 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 625.
- chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 626 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 626.
- (271) The chimeric polypeptide of any previous embodiment, comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 627 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 627.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 628 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 628.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 629 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 629.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 630 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 630.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 631 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 631.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 632 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 632.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 633 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 633.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 634 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 634.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 635 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 635.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 636 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 636.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 637 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 637.
- the chimeric polypeptide of any previous embodiment comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 638 and the sequence comprises X; or wherein the chimeric polypeptide comprises SEQ ID NO: 638.
- a composition comprising the chimeric polypeptide of any previous embodiment.
- the composition of embodiment 284, wherein the targeting polypeptide binds to the carrier material.
- the composition of embodiment 284 or embodiment 285, wherein the carrier material comprises calcium phosphate.
- composition of embodiment 286, wherein the calcium phosphate comprises tri -calcium phosphate.
- the carrier material comprises hydroxyapatite.
- the carrier material comprises alpha tricalcium phosphate, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, vanadates, and related ceramic minerals, or chelated divalent metal ions, or any combination thereof.
- K D values of any of the chimeric polypeptides described herein for binding of a target polypeptide to a carrier material e.g., b-TCP.
- a carrier material e.g., b-TCP.
- an electrophoretic mobility shift assay e.g., a filter binding assay, surface plasmon resonance, and a biomolecular binding kinetics assay, etc.
- the chimeric polypeptides provided herein are useful orthopedic materials, and can be used as bone void fillers and for bone reconstructions. In some embodiments, the chimeric polypeptides described herein are osteo-conductive and easily resorbed.
- a neighboring pair of two targeting polypeptides directly abut each other.
- a neighboring pair of two targeting polypeptides are separated by a linker sequence.
- a chimeric polypeptide provided herein comprising a targeting polypeptide and a therapeutic agent
- the targeting polypeptide and therapeutic agent are separated by a linker sequence.
- a linker sequence is present between two targeting polypeptides and/or between a targeting polypeptide and a therapeutic agent.
- the therapeutic agent comprises a mammalian growth factor.
- BMP -2 comprising SEQ ID NO: 32.
- the targeting polypeptide comprises one or more sequences of Table B.
- a chimeric polypeptide comprising a linker positioned between the targeting polypeptide and a therapeutic agent the presence of the linker increases solubility of the chimeric polypeptide as compared to a chimeric polypeptide without the linker.
- the linker is optimized in sequence and/or length.
- a chimeric polypeptide comprising the linker is more soluble than the chimeric polypeptide without the linker.
- a therapeutic agent in a chimeric polypeptide comprising the linker is more bioavailable than without the linker.
- the linker comprises a sequence of about 5 to about 50 amino acids. In some embodiments, the linker is a flexible linker, where at least about five of the amino acids have no regular secondary structure. In some embodiments, regular secondary structure comprises any helical structure like an alpha helix or 3 io helix or p helix, a beta turn, omega loop, and/or a beta sheet. In some embodiments, the linker comprises at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85% or 90% glycine, alanine, serine, glycine and alanine, glycine and serine, alanine and serine, or glycine, alanine, and serine.
- the linker comprises at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85% or 90% a combination of alanine, serine, glycine, and threonine.
- the linker comprises 1, 2, 3, 4, or 5 sequences having GSEG (SEQ ID NO: 702).
- the linker comprises 1, 2, 3, 4, or 5 sequences having SEGG (SEQ ID NO: 703).
- a linker comprising a majority of A, S, G, and T provide improved solubility of the chimeric polypeptide.
- a linker comprising a length of about 30 to about 45 amino acids provides improved solubility of the chimeric polypeptide.
- the linker comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to ASGAGGSEGGGSEGGTSGATGAGTSTSGGGASTGGGTG (SEQ ID NO: 701). In some embodiments, the linker comprises at least about 10, 15, 20, 25, or 30 contiguous amino acids of SEQ ID NO: 701. In some embodiments, the linker comprises a sequence at least about 90% identical to SEQ ID NO: 701. In some embodiments, the linker comprises SEQ ID NO: 701. In some embodiments, the linker sequence is positioned between a targeting polypeptide and a therapeutic agent. In some instances, the therapeutic agent comprises a mammalian growth factor. For instance, BMP -2 comprising SEQ ID NO: 32. In some instances, the targeting polypeptide comprises one or more sequences of Table A.
- a linker sequence comprises or consists of TGGSGEGGTGASTGGSAGTGGSGGTTSGEAGGSSGAG (SEQ ID NO: 33) or GSGATG (SEQ ID NO: 45).
- the chimeric polypeptide comprises a linker that has an amino acid sequence that has at least 70% (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%) sequence identity to SEQ ID NO: 33.
- a linker sequence comprises GSGS (SEQ ID NO: 705), GSGSGS (SEQ ID NO: 706), SGSG (SEQ ID NO: 707), SGSGSG (SEQ ID NO: 708), GSSG (SEQ ID NO: 709), SS, or GGGGS (SEQ ID NO: 710), or a combination thereof.
- a linker sequence can be 1 amino acid to about 100 amino acids, 1 amino acid to about 95 amino acids, 1 amino acid to about 90 amino acids, 1 amino acid to about 85 amino acids, 1 amino acid to about 80 amino acids, 1 amino acid to about 75 amino acids, 1 amino acid to about 70 amino acids, 1 amino acid to about 65 amino acids, 1 amino acid to about 60 amino acids, 1 amino acid to about 55 amino acids, 1 amino acid to about 50 amino acids, 1 amino acid to about 45 amino acids, 1 amino acid to about 40 amino acids, 1 amino acid to about 35 amino acids, 1 amino acid to about 30 amino acids, 1 amino acid to about 25 amino acids, 1 amino acid to about 20 amino acids, 1 amino acid to about 15 amino acids, 1 amino acid to about 10 amino acids, 1 amino acid to about 5 amino acids, about 5 amino acids to about 100 amino acids, about 5 amino acids to about 95 amino acids, about 5 amino acids to about 90 amino acids, about 5 amino acids to about 85 amino acids, about 5 amino acids to about 80 amino acids, about 5 amino acids to about 75 amino acids, about 5 amino acids
- a targeting polypeptide as described herein can be tethered to a mammalian growth factor.
- a linker sequence e.g., any of the linker sequences described herein or known in the art is disposed between the targeting polypeptide and the mammalian growth factor.
- Mammalian growth factors can be osteoinductive molecules that are capable of initiating and enhancing the bone repair process.
- Bone morphogenetic proteins represent a distinct subset of the transforming growth factor-b (TGFbeta) family. A number of these BMP (BMP -2, BMP-7, and BMP- 14) enhance the speed of bone healing in defects and non-unions.
- the mammalian growth factor comprises: epidermal growth factor (EGF), platelet derived growth factor (PDGF), insulin like growth factor (IGF-1), fibroblast growth factor (FGF), fibroblast growth factor 2 (FGF2), fibroblast growth factor 18 (FGF 18), transforming growth factor alpha (TGF- a), transforming growth factor beta (TGF-b), transforming growth factor beta 1 (TGF-bI), transforming growth factor beta 3 (TGF ⁇ 3), osteogenic protein 1 (OP-1), osteogenic protein 2 (OP- 2), osteogenic protein 3 (OP-3), bone morphogenetic protein 2 (BMP -2), bone morphogenetic protein 3 (BMP-3), bone morphogenetic protein 4 (BMP -4), bone morphogenetic protein 5 (BMP-5), bone morphogenetic protein 6 (BMP-6), bone morphogenetic protein 7 (BMP-7), bone morphogenetic protein (BMP-9), bone morphogenetic protein 10 (EGF), platelet derived growth factor (PDGF), insulin like growth factor (I
- the mammalian growth factor can be a human growth factor.
- mammalian growth factors and mature peptides and/or functional portions thereof are provided in Table B.
- reference to a mammalian growth factor includes a non -human mammalian growth factor.
- a mammalian growth factor includes a non-human mammalian growth factor homologous to a human growth factor, such as one or more of the human growth factors of Table B.
- a non-human mammalian growth factor is homologous to a human growth factor if the non-human mammalian growth factor is at least about 80% identical to the human mammalian growth factor as determined using the NCBI Blast alignment algorithm as of the date of this fding. In some cases, the coverage is at least about 90%.
- a non-human mammalian growth factor is homologous to a human growth factor if the non-human mammalian growth factor has at least about 80% positives as compared to the human mammalian growth factor as determined using the NCBI Blast alignment algorithm as of the date of this filing. In some cases, the coverage is at least about 90%.
- a non-human mammalian growth factor is homologous to a human growth factor if the non-human mammalian growth factor aligned with the human growth factor using the NCBI Blast as of the date of this filing has an E value of less than about IE-40, at least about 1E- 50, IE-60, IE-70, or IE-10, with a query cover of at least about 90%.
- Table B Exemplary human growth factors
- reference to a mammalian growth factor includes the mature peptide of any mammalian growth factor herein.
- the mature peptide is a canonically accepted mature peptide.
- the mammalian growth factor does not comprise a signal sequence.
- the mammalian growth factor does not comprise the full- length pro-protein.
- the mammalian growth factor has the amino acid sequence of the secreted growth factor in vivo.
- reference to a mammalian growth factor includes a functional portion of the mammalian growth factor. A function portion of the mammalian growth factor is a region that has a therapeutic effect.
- a functional portion of a mammalian growth factor is osteoinductive.
- a functional portion of a mammalian growth factor is capable of initiating and/or enhancing bone repair.
- a functional portion of a mammalian growth factor may have osteogenic activity.
- Non-limiting in vitro assays to determine whether a growth factor or portion thereof, such as those described herein, has osteogenic activity are described in Kim et al., Amino Acids 42: 1455- 1465, 2012; Lee et al., ACSMed. Chem. Lett. 2(3):248-251, 2011; and Wang et al., Genetics Mol.
- the mammalian growth factor comprises a sequence that is at least 70% identical (e.g., at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, or at least 99% identical) to any of the sequences in Table B or any secreted human growth factor, and has osteogenic activity.
- the amino acids in a mammalian growth factor that are conserved between different species are likely important for osteogenic activity and may not be mutated, while amino acids in a mammalian growth factor that are not conserved between different species are not likely important for osteogenic activity and may be mutated.
- the mammalian growth factor comprises BMP -2. In some embodiments, the mammalian growth factor is a mature peptide of BMP -2 (e.g., does not comprise a signal sequence). In some embodiments, the mammalian growth factor comprises a functional portion of BMP -2. In some embodiments, the functional portion of BMP -2 comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to
- the mammalian growth factor comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32. In some embodiments, the mammalian growth factor comprises a sequence at least about 90% identical to SEQ ID NO: 32. In some embodiments, the mammalian growth factor comprises SEQ ID NO: 32.
- the targeting polypeptide comprises two or more targeting polypeptides. In some embodiments, two or more targeting polypeptides is no more than about 50, 45, 40, 35, 30, 25, 20, 15, or 10 targeting polypeptides. In some embodiments, two or more targeting polypeptides is about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, or 30 targeting polypeptides. In some embodiments, two or more targeting polypeptides is about 2 to about 10 targeting polypeptides. In some embodiments, two or more targeting polypeptides is about 5 targeting polypeptides. In some embodiments, the targeting polypeptide binds to a carrier material, as noted elsewhere herein. As a non-limiting example, the targeting polypeptide binds to a calcium phosphate.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 1. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 2. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 3. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 4.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 5. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 6. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 7. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 8.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 9. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 10. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 11. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 12.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 13. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 14. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 15. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 16.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 17. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 18. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 19. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 20.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 21. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 22. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 23. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 24.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 25. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 26. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 27. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 28.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 29. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 30. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 31. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 36.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 37. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 38. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 39. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 40.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 41. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 42. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 43. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 401.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 402. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 403. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 404. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 405.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 406. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 407. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 408. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 409.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 410. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 411. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 412. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 413.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 414. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 415. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 416. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 417.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 418. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 419. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 420. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 421. In some embodiments, the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 422.
- the targeting polypeptide comprises Formula I:
- AoBoCoDoEoFoGoHoIoJoKoLo (SEQ ID NO: 35), where: Ao is V, L, I, G, S, T, or A; Bo is I, L, V, Q, T, S, G, or A; Co is G, A, V, or S; Do is E, D, L, or G; Eo is S, T, P T, E, or D; Fo is T or S; Go is H, T, or S; Ho is H or T; Io is R, S, K, P, or H; Jo is P, S, R, or K; Ko is W, F, S, P, V, A, or G; and Lo is absent or is S, T, G, (or A).
- Formula I does not include LLADTTHHRPWT (SEQ ID NO: 1).
- a targeting polypeptide comprising Formula I.
- the targeting polypeptide of any one of embodiments 1-45, wherein K0 is S.
- the chimeric polypeptide of embodiment 58 comprising a therapeutic agent.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical one or more sequences of Table B.
- the targeting polypeptides described herein can have a total length of about 5 amino acids to about 200 amino acids, about 5 amino acids to about 100 amino acids, about 5 amino acids to about 80 amino acids, about 5 amino acids to about 60 amino acids, about 10 amino acids to about 100 amino acids, about 10 amino acids to about 80 amino acids, about 10 amino acids to about 80 amino acids, about 20 amino acids to about 100 amino acids, about 20 amino acids to about 80 amino acids, about 20 amino acids to about 60 amino acids, about 30 amino acids to about 100 amino acids, about 30 amino acids to about 80 amino acids, about 30 amino acids to about 60 amino acids, about 40 amino acids to about 100 amino acids, about 40 amino acids to about 80 amino acids, about 40 amino acids to about 60 amino acids, or about 60 amino acids.
- nucleic acids that encode any of the chimeric polypeptides or targeting polypeptides described herein.
- vectors that include any of the nucleic acids provided herein.
- a “vector” according to the present disclosure is a polynucleotide capable of inducing the expression of a recombinant protein (e.g., any of the chimeric polypeptides or targeting polypeptides described) in a host cell.
- a vector provided herein can be, e.g., in circular or linearized form.
- Non-limiting examples of vectors include plasmids, SV40 vectors, adenoviral viral vectors, and adeno-associated virus (AAV) vectors.
- Non -limiting examples of vectors include lentiviral vectors or retroviral vectors, e.g., gamma-retroviral vectors.
- retroviral vectors include those derived from Moloney murine leukemia virus, myeloproliferative sarcoma virus, murine embryonic stem cell virus, murine stem cell virus, spleen focus forming virus, or adeno-associated virus.
- retroviral vectors are described in, e.g., U.S. Patent Nos.
- Exemplary vectors in which any of the nucleic acids provided herein can be inserted, are described in, e.g., Ausubel et al., Eds. “Current Protocols in Molecular Biology” Current Protocols, 1993; and Sambrook et al., Eds. “Molecular Cloning: A Laboratory Manual,” 2nd ed., Cold Spring Harbor Press, 1989.
- the vectors further include a promoter and/or enhancer operably linked to any of the nucleic acids described herein.
- promoters include promoters from human cytomegalovirus (CMV), mouse phosphoglycerate kinase 1, polyoma adenovirus, thyroid stimulating hormone a, vimentin, simian vims 40 (SV40), tumor necrosis factor, b-globin, a- fetoprotein, g-globin, b-interferon, g-glutamyl transferase, human ubiquitin C (UBC), mouse mammary tumor virus (MMTV), Rous sarcoma virus, glyceraldehyde -3 -phosphate dehydrogenase, b- actin, metallothionein II (MT II), amylase, human EFla, cathepsin, MI muscarinic receptor, retroviral LTR (e.g.
- CMV cytomegalovirus
- human T-cell leukemia virus HTLV human T-cell leukemia virus
- AAV ITR interleukin -2, collagenase, platelet- derived growth factor, adenovirus E2, stromelysin, murine MX, rat insulin, glucose regulated protein 78, human immunodeficiency virus, glucose regulated protein 94, a-2 -macroglobulin, MHC class I, HSP70, proliferin, immunoglobulin light chain, T-cell receptor, HLA DQa, HLA ⁇ ()b, interleukin-2 receptor, MHC class II, prealbumin (transthyretin), elastase I, albumin, c-fos, neural cell adhesion molecule (NCAM), H2B histone, rat growth hormone, human serum amyloid (SAA), muscle creatinine kinase, troponin I (TN I), and Gibbon Ape Leukemia Virus (GALV).
- the promoter may be an induc
- the vectors provided herein further include a poly(A) sequence, which is operably linked and positioned 3 ’ to the sequence encoding the chimeric polypeptide or targeting polypeptide.
- a poly(A) sequence include those derived from bovine growth hormone (Woychik et ah, Proc. Natl. Acad. Sci. U.S.A. 81(13): 3944-3948, 1984, and U.S. Patent No. 5,122, 458), mouse ⁇ -globin, mouse -a-globin (Orkin et ah, EMBOJ. 4(2): 453-456, 1985), human collagen, polyoma virus (Batt et ah, Mol.
- HSV TK Herpes simplex virus thymidine kinase gene
- IgG heavy chain gene polyadenylation signal U.S. Patent Application Publication No. 2006/0040354
- hGH human growth hormone
- SV40 poly(A) site e.g., SV40 late and early poly(A) site
- the poly(A) sequence includes a highly conserved upstream element (AATAAA).
- the this AATAAA sequence can, e.g., be substituted with other hexanucleotide sequences with homology to AATAAA which are capable of signaling polyadenylation, including, e.g., ATTAAA, AGTAAA, CATAAA, TATAAA, GATAAA, ACTAAA, AATATA, AAGAAA, AATAAT, AAAAAA, AATGAA, AATCAA, AACAAA, AATCAA, AATAAC, AATAGA, AATTAA, and AATAAG. See, e.g., WO 06012414 A2).
- a poly(A) sequence can, e.g., be a synthetic polyadenylation site. See, e.g., Levitt el al, Genes Dev. 3(7): 1019-1025, 1989).
- a poly(A) sequence can be the polyadenylation signal of soluble neuropilin-1: AAATAAAATACGAAATG (SEQ ID NO: 711). Additional examples of poly(A) sequences are known in the art. Additional examples and aspects of vectors are also known in the art.
- a chimeric polypeptide e.g., any of the chimeric polypeptides described herein
- a targeting polypeptide e.g., any of the targeting polypeptides described herein
- the introducing step includes introducing into a cell an expression vector including a nucleic acid sequence encoding the chimeric polypeptide or the targeting polypeptide to produce a recombinant cell.
- the expression vector includes chaperones (e.g., GroES, GroEL) and glutathione to aid with in vitro folding.
- a chimeric polypeptide or targeting polypeptide described herein can be produced by any cell, e.g., a eukaryotic cell or a prokaryotic cell.
- the term “eukaryotic cell” refers to a cell having a distinct, membrane -bound nucleus. Such cells may include, for example, mammalian (e.g., rodent, non-human primate, or human), insect, fungal, or plant cells.
- the eukaryotic cell is a yeast cell, such as Saccharomyces cerevisiae.
- the eukaryotic cell is a higher eukaryote, such as mammalian, avian, plant, or insect cells.
- the eukaryotic cell is a mammalian cell (e.g., a Chinese Hamster Ovary (CHO) cell).
- the term “prokaryotic cell” refers to a cell that does not have a distinct, membrane- bound nucleus.
- the prokaryotic cell is a bacterial cell.
- the bacterial cell is a chemically competent E.coli K12 cell (e.g., Shuffle® T7; New England BioLabs) or a BL21(DE3) pLysS chemically competent E.coli cell.
- Cells can be maintained in vitro under conditions that favor proliferation, differentiation, and growth. Briefly, cells can be cultured by contacting a cell (e.g., any cell) with a cell culture medium that includes the necessary growth factors and supplements to support cell viability and growth.
- a cell e.g., any cell
- a cell culture medium that includes the necessary growth factors and supplements to support cell viability and growth.
- Non-limiting examples of methods that can be used to introduce a nucleic acid into a cell include lipofection, transfection, electroporation, microinjection, calcium phosphate transfection, dendrimer-based transfection, cationic polymer transfection, cell squeezing, sonoporation, optical transfection, impalection, hydrodynamic delivery, magnetofection, viral transduction (e.g., adenoviral and lentiviral transduction), and nanoparticle transfection.
- a cell e.g., a eukaryotic cell
- techniques well-known in the art e.g., ammonium sulfate precipitation, polyethylene glycol precipitation, cobalt column, heparin column, ion-exchange chromatography (anion or cation), chromatography based on hydrophobic interaction, metal -affinity chromatography, ligand -affinity chromatography, and size exclusion chromatography.
- carrier materials that may be combined with a targeting polypeptide, therapeutic agent, and/or chimeric polypeptide herein.
- the targeting polypeptide binds to the carrier material.
- a carrier material is a material for which a targeting polypeptide herein is capable of binding.
- the targeting polypeptide is coated on the surface of the carrier material.
- carrier materials include calcium phosphate (e.g., tricalcium phosphate), hydroxyapatite, fluorapatite, bone (e.g., demineralized bone), glasses (bioglasses) such as silicates, and vanadates.
- the carrier material comprises a ceramic material.
- provided are devices comprising a carrier material and an agent.
- the agent comprises a therapeutic agent.
- the agent comprises a targeting polypeptide.
- the agent comprises a chimeric polypeptide comprising a targeting polypeptide and a therapeutic agent.
- the targeting polypeptide has an affinity for the carrier material, or a component of the carrier material.
- the dissociation constant (KD) for binding between the targeting polypeptide and the carrier material or component thereof is: (i) at least about 1 fM, at least about 10 fM, at least about 100 fM, or at least about 1 pM; and (ii) less than about 100 mM, less than about 90 mM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 1 pM, or less than about 100 pM.
- the carrier material is a material in a subject, e.g., a mammalian subject.
- the carrier material comprises bone.
- the targeting polypeptide binds to bone with a KD of: (i) at least about 1 fM, at least about 10 fM, at least about 100 fM, or at least about 1 pM; and (ii) less than about 100 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 1 pM, or less than about 100 pM.
- the carrier material comprises demineralized bone.
- the targeting polypeptide binds to bone with a KD of: (i) at least about 1 fM, at least about 10 fM, at least about 100 fM, or at least about 1 pM; and (ii) less than about 100 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 1 pM, or less than about 100 pM.
- the carrier material comprises cartilage.
- the targeting polypeptide binds to cartilage with a KD of: (i) at least about 1 fM, at least about 10 fM, at least about 100 fM, or at least about 1 pM; and (ii) less than about 100 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 1 pM, or less than about 100 pM.
- the carrier material comprises calcium phosphate. In some embodiments, the carrier material comprises tricalcium phosphate. In some embodiments, the targeting polypeptide binds to tricalcium phosphate with a KD of: (i) at least about 1 fM, at least about 10 fM, at least about 100 fM, or at least about 1 pM; and (ii) less than about 100 mM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 1 pM, or less than about 100 pM.
- the carrier material comprises b-TCP.
- the targeting polypeptide binds to b-TCP with a KD of: (i) at least about 1 fM, at least about 10 fM, at least about 100 fM, or at least about 1 pM; and (ii) less than about 100 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 1 pM, or less than about 100 pM.
- the carrier material comprises alpha tricalcium phosphate.
- the targeting polypeptide binds to alpha tricalcium phosphate with a KD of: (i) at least about 1 fM, at least about 10 fM, at least about 100 fM, or at least about 1 pM; and (ii) less than about 100 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 1 pM, or less than about 100 pM.
- the carrier material comprises hydroxyapatite.
- the targeting polypeptide binds to hydroxyapatite with a KD of: (i) at least about 1 fM, at least about 10 fM, at least about 100 fM, or at least about 1 pM; and (ii) less than about 100 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 1 pM, or less than about 100 pM.
- the carrier material comprises fluorapatite.
- the targeting polypeptide binds to b-TCP with a KD of: (i) at least about 1 fM, at least about 10 fM, at least about 100 fM, or at least about 1 pM; and (ii) less than about 100 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 1 pM, or less than about 100 pM.
- the carrier material comprises glass.
- the glass comprises a bioglass.
- the glass comprises a silicate.
- the targeting polypeptide binds to a glass with a KD of: (i) at least about 1 fM, at least about 10 fM, at least about 100 fM, or at least about 1 pM; and (ii) less than about 100 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 1 pM, or less than about 100 pM.
- the carrier material comprises a ceramic mineral.
- the targeting polypeptide binds to the ceramic mineral with a KD of: (i) at least about 1 fM, at least about 10 fM, at least about 100 fM, or at least about 1 pM; and (ii) less than about 100 mM, less than about 90 mM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 1 pM, or less than about 100 pM.
- the carrier material comprises a vanadate.
- the carrier material comprises a chelated divalent metal ion.
- a dissociation constant is measured using any method known in the art and/or mentioned herein.
- the dissociation constant is measured using a release assay, wherein sample protein released into solution is quantified using ELISA.
- the dissociation constant is measured using released fluorescence, e.g., using a carrier material bound to green fluorescent protein (GFP).
- the dissociation constant is measured using the targeting polypeptide.
- the dissociation constant is measured using a chimeric polypeptide comprising the targeting polypeptide.
- the dissociation constant is measured using the carrier material.
- the dissociation constant is measured using the component of the carrier material (e.g., a tricalcium phosphate or a hydroxyapatite).
- the targeting polypeptide is capable of remaining bound to the carrier polypeptide in a physiological buffer (e.g., phosphate buffered saline) at 37°C for at least about 2, 3,
- a physiological buffer e.g., phosphate buffered saline
- the binding is measured using the targeting polypeptide. In some embodiments, the binding is measured using a chimeric polypeptide comprising the targeting polypeptide. In some embodiments, the binding is measured using the carrier material. In some embodiments, the binding is measured using the component of the carrier material (e.g., a tricalcium phosphate or a hydroxyapatite).
- b-TCP is an osteoconductive material that supports bone mineralization by easily dissolving at low pH and serves as a rigid substrate for cell attachment.
- reference to b-TCP includes reference to a carrier material comprising b-TCP.
- compositions described herein comprising a chimeric polypeptide and b-TCP include compositions comprising the chimeric polypeptide and a carrier material comprising b-TCP.
- the b-TCP carrier material comprises at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% by weight b-TCP.
- the b-TCP carrier material comprises about 30% to about 50%, or about 40%, b-TCP.
- b-TCP as described herein can be in a variety of different forms. Examples of such forms include a granular form, a porous form, a powder, a putty (e.g., a moldable putty), a paste, a scaffold, fiber form, a coating on a solid surface (e.g., a coating on a medical device), or any combination thereof.
- a putty e.g., a moldable putty
- a paste e.g., a moldable putty
- a paste e.g., a paste
- a scaffold e.g., a scaffold
- fiber form e.g., a coating on a solid surface
- the b-TCP can be used in a variety of different shapes (e.g., a cross, a ladder, a sphere, an ellipsoid, a square, a triangular pyramid, a rod, a cone, a torus, or a wedge, or any combination thereof) and sizes (e.g., largest average diameter of about 1 mm, about 2 mm, about 3 mm, about 4 mm, about 5 mm, about 6 mm, about 7 mm, about 8 mm, about 9 mm, about 1 cm, about 2 cm, about 3 cm, about 4 cm, about 5 cm, about 6 cm, about 7 cm, about 8 cm, about 9 cm, or about 10 cm).
- shapes e.g., a cross, a ladder, a sphere, an ellipsoid, a square, a triangular pyramid, a rod, a cone, a torus, or a wedge, or any combination thereof
- sizes e.g., largest average diameter of about
- a b-TCP carrier material is porous (e.g., about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% porous when dry (no hydration)). In some embodiments, a b-TCP carrier material is about 90% to about 99%, or about 95% to about 99% porous when dry. In some embodiments, a b-TCP carrier material is about 98% porous when dry.
- a b-TCP carrier material comprises one or more additional materials.
- the one or more additional materials comprises siloxane -containing vaterite (SiV). In some embodiments, the one or more additional materials comprises poly(L-lactide-co- glycolide) (PLGa, CAS No. 30846-39-0). In some embodiments, the carrier material comprises about 40% by weight b-TCP, about 30% by weight SiV, and about 30% by weight PLGa.
- the b-TCP is in the form of fibers.
- the fiber is formed by electrospinning.
- the fiber is resorbable.
- the fiber diameter is from about 1 mM to about 500 mM, or from about 1 pM to about 300 pM, from about 3 pM to about 250 pM, or from about 3 pM to about 150 pM.
- the maximum fiber diameter is about 500 pM, about 400 pM, about 300 pM, or about 250 pM.
- the true density is from about 1 g/cm3 to about 10 g/cm3, from about 1 g/cm3 to about 5 g/cm3, or about 1, 2, 3, 4, or 5 g/cm3.
- the true density is about 2.5 g/cm3.
- the b-TCP fiber comprises b-TCP and a bioabsorbable polymer.
- the b-TCP fiber comprises b-TCP and calcium carbonate.
- the calcium carbonate comprises silicone.
- the b-TCP fiber comprises b-TCP, a bioabsorbable polymer or resin, and calcium carbonate.
- the b-TCP fiber is biodegradable.
- the bioabsorbable polymer comprises polylactic acid (PLA) and/or polylactic acid-glycolic acid copolymer (PLGA).
- a non-limiting example for preparing a b- TCP fiber herein comprises electrospinning.
- the b-TCP fiber comprises a PLGA resin comprising calcium phosphate particles, where the fiber is produced using electrospinning.
- the calcium phosphate particles comprise silicon.
- the b-TCP fiber comprises PLA and b-TCP silicon-comprising vaterite.
- the b-TCP fiber comprises a biodegradable fiber produced by electrospinning, wherein the biodegradable fiber comprises calcium phosphate particles in an amount of 40% to 60% by weight, silicon -releasing calcium carbonate particles in an amount of 10% by weight or more, and a poly-L-lactic acid polymer in an amount of 30% by weight or more as the remainder, and wherein an amount of amorphous phase of the poly-L-lactic acid polymer is from 75% to 98% by weight.
- the b-TCP fiber comprises ReBOSSIS® (ORTHOReBIRTH).
- the b-TCP fiber comprises ReBOSSIS85 Bone Void Filler (ORTHOReBIRTH).
- a targeting polypeptide herein is combined with a b-TCP fiber.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to one or more of SEQ ID NO: 1-31, 36-43, or 401-422.
- the targeting polypeptide is part of a chimeric polypeptide further comprising a therapeutic agent.
- the therapeutic agent comprises a mammalian growth factor.
- the mammalian growth factor comprises the mature peptide of the mammalian growth factor.
- the mammalian growth factor comprises the mature peptide of BMP -2, comprising a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- the b-TCP fiber is ReBOSSIS85 Bone Void Filler.
- a chimeric polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 502.
- compositions that include any of the chimeric polypeptides or targeting polypeptides described herein.
- the compositions can further include b-TCP (e.g., any of the types of b-TCP described herein).
- the b-TCP is formulated as a powder, a putty (e.g., a moldable putty), a paste, a scaffold (e.g., a porous scaffold), a sponge, and/or a coating on a solid surface (e.g., a coating on a medical device).
- the b-TCP can be disposed on or in a scaffold, a mesh, or a sponge (e.g., a resorbable sponge).
- compositions e.g., pharmaceutical compositions
- a sterile vial or a pre-loaded syringe are disposed in a sterile vial or a pre-loaded syringe.
- compositions are formulated for different routes of administration (e.g., intraarticular, injection into a joint, or injection proximal to a bone fissure or fracture).
- routes of administration e.g., intraarticular, injection into a joint, or injection proximal to a bone fissure or fracture.
- Single or multiple administrations of any of the pharmaceutical compositions described herein can be given to a subject depend on, for example: the dosage and frequency as required and tolerated by the subject.
- a dosage of the pharmaceutical composition should provide a sufficient quantity of the chimeric polypeptide to effective treat or ameliorate conditions (e.g., bone defects, bone fractures, cartilage defects, or cartilage loss), or symptoms.
- kits that include any of the chimeric polypeptides or any of the targeting polypeptides described herein, or any of the compositions (e.g., pharmaceutical compositions) described herein.
- the kits can include instructions for performing any of the methods described herein.
- the kits can include at least one dose of any of the compositions (e.g., pharmaceutical compositions) described herein.
- the kits can include a syringe for administering any of the pharmaceutical compositions described herein.
- the kits described herein are not so limited; other variations will be apparent to one of ordinary skill in the art.
- compositions provided herein can be produced using the methods described herein or methods known in the art.
- granulated b-TCP powder can be sintered, sieved, and fabricated into a desired shape (e.g., any of the shapes described herein).
- the purity of the b-TCP present in any of the compositions described herein can be greater than about 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95%, or greater than 99% pure.
- the purity of b-TCP present in any of the compositions described herein can be greater than 1%, greater than 2%, greater than 3%, greater than 4%, greater than 5%, greater than 6%, greater than 7%, greater than 8%, greater than 9%, greater than 10%, greater than 12%, greater than 14%, greater than 15%, greater than 16%, greater than 18%, greater than 20%, greater than 22%, greater than 24%, greater than 25%, greater than 26%, greater than 28%, greater than 30%, greater than 32%, greater than 34%, greater than 35%, greater than 36%, greater 38%, greater 40%, greater than 42%, greater than 44%, greater than 45%, greater than 46%, greater than 48%, greater than 50%, greater than 52%, greater than 54%, greater than 55%, greater than 56%, greater than 58%, greater than 60%, greater than 62%, greater than 64%, greater than 65%, greater than 66%, greater than 68%, greater than 70%, greater than 72%, greater than 74%.
- the composition can further include one or more pore forming agents.
- pore forming agents include, e.g., inorganic salts, such as sodium chloride, saccharides (e.g., sucrose or glucose), gelatin (e.g., gelatin spheres), or paraffin (e.g., paraffin spheres).
- compositions described herein can be generated by contacting any of the chimeric polypeptides or any of the targeting polypeptides to any of the types of b-TCP described herein.
- the b-TCP can be in the form of a granular/powder form, a porous form, a putty (e.g., a moldable putty), a paste, a scaffold, and/or a coating on a solid surface (e.g., a coating on a medical device).
- provided herein are methods of treating a subject with a polypeptide or composition described herein.
- the subject is treated with a chimeric polypeptide described herein.
- the subject is treated with a composition described herein.
- a chimeric polypeptide comprising BMP -2 and a carrier comprising calcium phosphate.
- the subject is suffering from a defect in bone, cartilage, soft tissue, tendon, fascia, ligament, organ, osteotendinous tissue, dermal, or osteochondral, or a combination of one or more of the aforementioned defects.
- a defect is a lack of bone, cartilage, soft tissue, tendon, fascia, ligament, organ, osteotendinous tissue, dermal, or osteochondral, or a combination of one or more of the aforementioned defects.
- a defect in the subject arises from trauma.
- a defect in the subject arises due to a congenital condition.
- a defect in the subject arises due to an acquired condition.
- Non-limiting examples of conditions suitable for treatment with a polypeptide or composition described herein include osteoarthritis, disc degeneration, congenital defect, spinal stenosis, spondylolisthesis, spondylosis, bone fracture, scoliosis, kyphosis, spinal fusion (PLF, and interbody fusions), trauma repair of bone, dental repair, craniomaxillofacial repair, ankle fusion, kyphoplasty, balloon osteoplasty, scaphoid facture repair, tendeno-osseous repair, osteoporosis, avascular necrosis, congenital skeletal malformations, costal reconstruction, subchondral bone repair, cartilage repair (e.g., at low doses), or trauma, or a combination thereof.
- BMP -2 is also involved in hair follicle development, therefore the methods may comprise treatment to hair follicles.
- the trauma may be to the bone, cartilage, soft tissue, tendon, fascia, ligament, organ, osteotendinous tissue, or dermal tissue, or osteochondral tissue.
- the method is to treat an osteochondral injury.
- a defect refers to the absence, loss, and/or break in a tissue and/or organ of the body.
- a “bone defect” refers to the absence or loss (e.g., partial loss) of bone at an anatomical location in a subject where it would otherwise be present in a control healthy subject.
- a bone defect may be the result of, e.g., an infection (e.g., osteomyelitis), a tumor, a trauma, or an adverse event of a treatment.
- a bone defect may also affect the muscles, soft tissue, tendons, or joints surrounding the bone defect and cause injury.
- a bone defect includes damage to a soft tissue.
- a “cartilage defect” refers to the absence or loss (e.g., partial loss) of cartilage at an anatomical location in a subject where it would otherwise be present in a control healthy subject.
- a cartilage defect may be the result of, e.g., disease, osteochondritis, osteonecrosis, or trauma.
- a cartilage defect may affect the knee joint.
- the method may comprise spinal fusion.
- spinal fusion is a surgical technique to join two or more vertebrae.
- the spinal fusion comprises PLF.
- the spinal fusion comprises interbody fusions
- kits for promoting bone or cartilage formation in a subject in need thereof that include: administering to the subject a therapeutically effective amount of any of the compositions described herein. Some embodiments of these methods can further include first selecting a subject in need of bone or cartilage formation. In some embodiments, the composition is administered to the subject proximal to the desired site of bone or cartilage formation in the subject. Also provided herein are methods of replacing and/or repairing bone or cartilage in a subject in need thereof that include: administering to the subject a therapeutically effective amount of any of the compositions described herein. Some embodiments of these methods can further include first selecting a subject in need of bone replacement, bone repair, cartilage replacement, or cartilage repair. In some embodiments, the composition is administered to the subject proximal to the desired site of bone or cartilage replacement or repair in the subject.
- the subject has a bone fracture or a bone defect.
- the subject requires a vertebral fusion of the spine.
- the subject has a cartilage tear or cartilage defect.
- the subject has cartilage loss.
- Imaging techniques e.g., magnetic resonance imaging, X-ray, or computed tomography.
- Methods of detecting bone or cartilage formation, or replacement or repair of bone or cartilage in a subject include, e.g., imaging techniques (e.g., magnetic resonance imaging, X-ray, or computed tomography).
- imaging techniques e.g., magnetic resonance imaging, X-ray, or computed tomography.
- Suitable animal models for treatment of a bone fraction or bone loss, bone or cartilage formation, or bone or cartilage replacement or repair are known in the art. Non-limiting examples of such animal models are described in the Examples and in, e.g., Drosse et ah, Tissue Engineering Part C 14( 1): 79-88, 2008; Histing et ah, Bone 49:591-599, 2011; and Poser et ah, Hindawi Publishing Corporation, BioMed Research International; Article ID 348635, 2014.
- a method of treatment comprises administering to the subject a polypeptide or composition herein.
- the subject is administered a chimeric peptide described herein, (e.g., comprising a targeting polypeptide and optionally a growth factor).
- the subject is administered a composition comprising a chimeric peptide described herein and a carrier material.
- the carrier material is a ceramic material.
- the ceramic material comprises calcium phosphate and/or hydroxyapatite.
- administration comprises implanting a polypeptide or composition herein.
- a polypeptide and/or composition herein comprising BMP -2 is administered to the subject.
- the BMP -2 comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, or 100% identical to SEQ ID NO: 32.
- the BMP -2 is administered to induce formation of bone in the subject.
- the BMP -2 is administered to induce formation of cartilage.
- the BMP -2 is administered in a spinal fusion.
- about 0.5 mg to about 10 mg of a polypeptide is administered for every cubic centimeter (cc) of defect volume.
- cc cubic centimeter
- the polypeptide comprises a chimeric peptide described herein.
- the polypeptide comprises one or more targeting polypeptide, e.g., as described herein.
- the polypeptide comprises a growth factor, e.g., as described herein.
- the defect volume is calculated or estimated by multiplying the length of the defect by the area of the defect (pi multiplied by defect radius squared).
- a method of delivering a therapeutic agent to an organ or tissue of a subject comprising delivering to the organ or tissue a carrier material comprising the therapeutic agent.
- delivery comprises surgically introducing the carrier material to the organ or tissue.
- the tissue comprises cartilage.
- the tissue comprises cartilage.
- the therapeutic agent is bound to the carrier material.
- the therapeutic agent is non -covalently bound to the carrier material.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 1.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 2.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 5.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 6.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 7.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 8.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 9.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 10.
- the targeting polypeptide comprises a sequence at least about 70%,
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 12.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 13.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 14.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 15.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 16.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 17.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 18.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 21.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 22.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 23.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 24.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 25.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 26.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 27.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 28.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 29.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 30.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 31.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 35.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 36.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 37.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 38.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 39.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 40.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 41.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 42.
- (111) The method of any one of embodiments 71-110, wherein the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 43.
- (112) The method of any one of embodiments 71-111, wherein the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 401.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 402.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 403.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 404.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 405.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 406.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 407.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 408.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 409.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 410.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 411.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 412.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 413.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 414.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 415.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 416.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 417.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 418.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 419.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 420.
- the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 421.
- (133) The method of any one of embodiments 71-132, wherein the targeting polypeptide comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 422.
- (134) The method of any one of embodiments 70-133, wherein the therapeutic agent and targeting polypeptide are connected via a linker.
- (135) The method of embodiment 134, wherein the linker comprises a peptide.
- linker comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 701.
- therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 32.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 46.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 47.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 152.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 168.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 268.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 176.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 48.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 49.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 50.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 51.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 52.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 53.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 54.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 55.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 56.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 57.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 58.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 59.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 60.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 61.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 62.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 63.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 64.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 65.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 66.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 67.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 68.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 69.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 70.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 71.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 72.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 73.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 74.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 75.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 76.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 77.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 78.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 79.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 80.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 81.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 82.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 83.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 84.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 85.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 86.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 87.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 88.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 89.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 90.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 91.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 92.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 93.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 94.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 95.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 96.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 97.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 98.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 99.
- the therapeutic agent comprises a sequence at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 100.
- the therapeutic agent is part of a composition comprising any one of SEQ ID NOS: 501-648.
- the biological material comprises a growth factor as listed in Table B, or a polypeptide comprising a sequence at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of Table B.
- a method of coating a device with a biologic material comprising coating the device with any polypeptide comprising a polypeptide of Table C.
- the composition and/or biologic material is non -covalently bound to the device.
- the device comprises one or more carrier materials described herein.
- Example 1 A Preclinical Study of tBMP-2 in a b-TCP carrier in a rat critical size femoral defect model
- the aim of this study was to examine the safety and effect of modified recombinant human bone morphogenetic protein (rhBMP) known as tBMP-2 in a beta-tricalcium phosphate (b-TCP) putty matrix in the replacement and repair of bone in a rat critical size defect model.
- rhBMP modified recombinant human bone morphogenetic protein
- b-TCP beta-tricalcium phosphate
- the tBMP-2 variant exhibits very tight binding to calcium phosphate ceramics and thus allows for targeted delivery of tBMP-2 to implant sites.
- This report covers animal arrival, assignment to groups, surgical creation of defect and administration of test, reference or control item.
- this report covers the post-operative period up to and including Week 8, and end-point in vivo and ex vivo measurements. Included are the clinical summaries, radiographs, end-point clinical pathology and organ histopathology, histomorphometry of treated legs (odd-numbered animals), and mechanical strength testing of treated legs (even-numbered animals).
- the bone specimens form the tBMP-2 + b -TCP putty group clearly demonstrated vastly improved bone healing at 4 and 8 weeks post-surgery when compared to samples from animals in the rhBMP+ACS or the b -TCP putty alone treatment groups.
- the aim of this study was to evaluate the performance of a modified variant of recombinant human BMP -2 (rhBMP -2) called tBMP-2.
- the tBMP-2 variant exhibits very tight binding to calcium phosphate ceramics and thus allows for targeted delivery of tBMP-2 to implant sites.
- the ability to tether BMP -2 in this manner can allow for longer persistence times, lower doses, and, it is expected, superior outcomes as compared to the treatment controls studied herein.
- the rat is a validated animal model for assessing the effect of treatments on critical -sized defects in the femur (4-6). Sixty male rats (plus spares) were required: ten animals in each group per time point. One animal was replaced after successful administration of the test item at day 5 post surgery as he was losing weight and not eating. Animals that were euthanized or humanely killed after successful administration of the test item were necropsied and had tissue collected for histopathology. The number of animals used in this study was considered sufficient for evaluation of results.
- the animals were housed in conventional conditions (targeted temperature 22 ⁇ 3 °C, 12/ 12- hour light/dark cycle) in standard open top cages that satisfy the size requirements specified in the Animal Welfare Regulations (Animal Welfare Act 1985, v 15.10.2015. Attorney General’s Department, Gouverment of South Australia). Animals were housed individually for the entirety of the experiment. The animals had access to standard laboratory rat chow (Specialty Feeds, Glen Forest, Australia) 25-30 g/day. Immediately post-operatively, and when rats were not thriving, the food was soaked in water for easier palatability. Chlorinated tap water was provided to the animals ad libitum. Food and water were not withheld at any time.
- each animal was uniquely identified by a subcutaneously implanted microchip which was scanned using a barcode reader. For the purpose of the study, each animal was also given a number from 1-70 (to include replacement and spared required). As the initial batch of animals gained weight too quickly, some animals were replaced prior to surgery. The replacement animals were given the number of the animal they replaced and the suffix (a) was added. Numbers went up to 68a with a couple of gaps.
- Animals were assigned to groups by a weight-ordered distribution. The heavier animals were used first. The animals gained weight rapidly, even on the restricted food allowance. Two weeks into the surgeries, it was deemed necessary to remove some animals from the study (n 16) as these animals were already too heavy (>425g). These animals were replaced with animals in the 250-300 g range. The replacement animals were also assigned to treatment groups on a weight-ordered distribution. As the first surgical group had originally been assigned to the 8-week end-point group, animals were reassigned to either 4- or 8- week end-points to ensure the lighter animals were evenly distributed amongst the treatment and end-point times.
- cephalosporin Cephalosporin, Hospira Inc, Lake Forest IL, USA
- microchip was inserted into the scruff of the neck (after clipping hair) using a microchip implanter.
- the microchip was inserted until completely covered by skin.
- the wounds were closed with one or two wound clips if required.
- the area was swabbed with betadine. This was performed under isoflurane in O2 anaesthesia at the same time as the defect surgery and test- or reference -item placement.
- the defects were created in the right femur of all rats as described for the RatFix RISystem. Briefly, all anaesthetized rats were placed on a warming pad in lateral recumbency with the right leg facing upwards. The surgical site was shaved and aseptically prepared with iodine or chlorhexidine scrub and solution. A skin incision between the greater trochanter and the knee joint was made and the superficial fascia incised. The intermuscular plane between the vastus lateralis and the biceps femoris was separated and the periosteum of the femur incised. The PEEK plate was fitter into the jug and secured with suture material. The jig-plate assembly was fixed to the craniolateral surface of the femur by pulling the sutures through under the femur, allowing the assembly to be tightened to the femur.
- the plate was attached to the femur by six bicortical titanium screws. Standardised 6-mm defects were created (marked on the plate) using the Gigli wire saw guided by the sawing device of the jig. After defect sawing, the jig and bone piece were removed. The fresh defect was flushed with sterile saline and dried with gauze in preparation of test item or reference item, or vehicle administration into the defect size. In the event that the plate itself was damaged with the cutting wire, reducing stability, that animal would be replaced. No replacements due to plate damage were required.
- Baseline radiographs were taken immediately after creation of the defect and administration of the test or reference item to show position of treatment articles (where visible), and placement of the plate, whilst the animal was still under anaesthesia.
- X-rays were taken on the anaesthetized animals (isoflurane) immediately after surgery, and at 2, 4 (end-point for half of the animals), 6 and 8 weeks (end-point for the remaining animals) post- operatively.
- the radiographs were taken in lateromedial and craiocaudal projections for assessment of bone healing and to exclude implant loosening or failure. All in -life radiographs were taken using a Villa Visitor Mobile X-ray Unit (Villaqueli Medicali, Buccinasco, Italy), using a dental image capture device (Soredex, Digora Optime, Tuusula, Finland).
- the images were transferred to the PIRL picture archiving and communication system (PACS, Carestream Vue Motion, Rochester, USA) by the radiographer for storage and access.
- Specimen were fixed in 10% formalin for 7 days prior to processing.
- Formalin-fixed bones were cut using a slow-speed saw (Buehler Ltd, IL, USA) along the sagittal plane using a diamond- tipped cutting blade before being submerged in 70% ethanol.
- bones were processed for resin embedding via several dehydration steps. Briefly, bones were submerged in 2 x 90% ethanol and 1 x 100% ethanol steps over 48 hours. Bones were then transferred into a solution containing methymethacrylate (MMA) and 10% v/v polyethylene glycol (PEG) and stored at room temperature for 10-14 days.
- MMA methymethacrylate
- PEG polyethylene glycol
- Resin embedding then occurs by preparing a solution of MMA, 10% PEG, and 0.4% peroxydicarbonate (Perkadox) and incubation at 37 °C for 24 hours to allow the resin to harden. The exposed cut surface was placed facing down in the tube. The resin-set bones were then removed from their tubes and fixed to stubs for sectioning. For each bone, 5 -pm thick sections were cut using a tungsten-carbide blade (Leica RM2255, Wetzlar, GER). Sections were placed on to gel-coated slides and dipped 2 times in a spreading solution (70% ethanol/30% 2-ethoxyethanol) heated to 70 °C.
- a spreading solution 70% ethanol/30% 2-ethoxyethanol
- sections were flattened, covered by strips of polyethylene and clamped together separated by blotting paper, before being placed into a 37 °C oven. Prior to commencing staining procedures, sections were placed in acetone for 15 minutes, unless otherwise stated. All sections were digitally scanned at lOOx magnification (3D Histech scanner, TMA-MASTER01).
- Acetone treated sections were rinsed in demineralised water for 2 minutes. Sections were then placed in a 1% silver nitrate solution and placed in front of a UV lamp for 60 minutes. Washed slides were then treated with 2.5% sodium thiosulphate solution for 5 minutes. Washed slides were then counterstained with H&E. To stain for H&E, sections were placed in haematoxylin for 8 minutes to stain cell nuclei before being rinsed in demineralised water for 2 minutes and dipped in acid alcohol (%), typically, 4-5 minutes. After rinsing in demineralised water, sections were dipped in lithium carbonate 4-5 times and placed in eosin for 4 minutes. Once removed, excess eosin was removed with a squeeze bottle of absolute alcohol, sections were hydrated, placed in xylene and mounted in xylene-based mounting medium.
- Acetone treated sections underwent a 60-minute incubation in Tris-HCL buffer (pH 9.4) at 37 °C for 60 minutes in an acid phosphatase (AcP) stain prepared by adding 0.0355 g of tartaric acid dissolved in 35 mL of sodium acetate (pH 5.2) to 100 pL basic fucshin in a 100 pL solution containing 0.4 mg of sodium nitrite. This solution was then added to a solution containing 0.04 g Napthol ASBI phosphate (Sigma- Aldrich, Missouri, USA) in 2 mL dimethylformamide.
- AcP acid phosphatase
- Acetone sections were immediately placed in xylene and mounted in DPX. Slides were viewed under a fluorescent microscope (Olympus BX53; Olympus, Tokyo, JP).
- a comprehensive necropsy is defined as examination of the external surface of the body, all orifices, and the cranial, thoracic, and abdominal cavities, and their contents. If abnormalities were found in tissues or organs other than those listed below, they were also collected for histology.
- the end-point pCT was manually and subjectively scored as described by Chhabra et al. (2005) using the grading system described in Table 4.
- end-point data pCT, mechanical testing, histomorphometry, clinical pathology
- Group A animals received ⁇ BMR-2+b-TOR (0.615-0.620 mg tBMP-2 in b-TCP putty to fill defect); Group B animals received InFUSETM Bone Graft of rhBMP-2 +ACS (2 pg rhBMP-2 on ACS to fill defect); Group C animals received b-TCP to fill the defect. All test and control items were mixed on the day of surgery (tBMP -coated b-TCP to putty or rhBMP to ACS). Following administration of the treatment article, the wounds were closed in two muscle layers with subcutis and intracutaneous vicryl sutures. The wounds were closed exteriorly with intradermal sutures to prevent chewing by the rats. The wounds were washed with liberal amounts chlorhexidine solution. A small amount of tea tree oil was applied to the area surrounding the actual wound to prevent the animals from worrying the suture side.
- the anticipated route of human administration is by surgical implantation into a bone defect. Therefore, that route was used in this study.
- the bone defects were surgically created, the area flushed with saline, then the test or control items were placed in the defect immediately.
- test item (tBMP-2 + b-TCP Putty)
- tBMP-2 stock 3.53 mg/mL
- tBMP-2 stock 3.53 mg/mL
- All liquid was removed, and retained for analysis.
- the pellet was washed with 1 mL of sterile phosphate-buffered saline (PBS pH 7.4) and mixed gently to wash away any excess unbound protein.
- PBS pH 7.4 sterile phosphate-buffered saline
- b- TCP and putty were mixed 1:1.
- tBMP-2 + b-TCP putty formulation was placed in the surgically -created defect. Assuming approximately 90% binding, the final dose of tBMP which was administered to the rat in the defect was 615-620 pg. Sterility was maintained at all steps. b-TCP binding to tBMP-2 was done no more than 48 hours prior to surgery. If b-TCP was bound/washed the day before surgery, it was stored at 4 °C. b-TCP and putty were not mixed more than one hour prior to implantation, as it will dehydrate with time and become less malleable.
- Recombinant human bone morphogenetic protein + absorbable collagen sponge (InFUSETM Bone Graft; size XX small; Medtronic Sofamor Danek, Inc) was used as per packet insert with modifications as described below.
- BMP -2 vial contents were reconstituted with the provided sterile water to give 1.5 mg/mL rhBMP-2. This concentration is intended for human use. To bring this concentration to the range typically used in rats, it was diluted 1 in 60 with PBS (25 pg/mL). A defect volume of approximately 75.5 mm 3 was assumed, therefore the ACS was trimmed to form a 6-mm x 4-mm block for insertion into the defect.
- the rhBMP-2 + absorbable collagen sponge and the tBMP-2 + b-TCP putty were prepared as described above.
- the final dose each rat received of the BMP -2 formulations was 2 pg rhBMP-2 for the reference item and approximately 615-620 pg tBMP of the test item.
- the initial animals were numbered 1-63, of which 60 were assigned to the study.
- the animals were fed ad lib on arrival, but this was reduced to 35-30 g when it was found at their third weighing that they were gaining weight too quickly.
- the initial surgeries were delayed by one week, and as the animal’s weights continued to increase, the decision was made to remove the heaviest sixteen animals from the study and get replacement animals.
- the replacement animals were assigned numbers.
- FIG. 1A FIG. IB and FIG. 1C).
- FIG. 2 shows representative radiographs of animals from all groups at 0, 2, 4, 6, and 8 weeks post-surgery.
- the defect was only visible in Group B animals that received the rhBMP + ACS.
- the putty (with or without protein) in animals from Groups A and C appear to be outside the confines of the defect (more obvious in mediolateral view). This was the case in all animals, even when the surgeon reported that the putty appeared to be completely contained within the defect, and touching the muscle tissue had been completely avoided on insertion of the test or control items.
- each specimen was scanned by high resolution pCT (Skyscan, Model 1174, Bruker microCT). Specimens were wrapped in PBS-soaked gauze and secured within a humidified tube prior to scanning. All scans were performed at 6.4 pm voxel resolution and X-ray tube potential of 50 kV and 800 pA. Images were acquired over 180 degrees with intervals of 0.8 degrees and frames were averaged from 2 images taken at each step. For each scan, the images were then reconstructed into a z-stack of images to represent the transverse plane of the femur (N-Recon software, Bruker microCT).
- FIG. 4 shows a graphical representation of bridging of periosteal callus. Moderate callus was observed in Group B samples, whereas Group C samples showed little or no callus.
- the cortical bone mineral volume, in BV/TV terms was 4-fold greater than levels in Group B (P ⁇ 0.05) but not significantly greater than in Group C (FIG. 6B).
- TCB was markedly increased in Group A when compared to Groups B and C (FIG. 7A and FIG. 7B).
- BMV in Group A is not significantly increased when compared to Group B.
- the mechanical strength testing of femoral callus was performed using 3 point bending method (5940 and BlueHill 3 software, v3.25, Instron, MA, USA). Each specimen was stored in PBS-soaked gauze at -80°C until ready for testing. Prior to testing, specimens were gradually thawed to 4°C over three days to maintain tissue integrity. On the day of testing, samples were scanned by micro-CT in a humidified chamber and kept cool prior to allowing specimens to reach room temperature for mechanical testing. For each specimen, the rat-fix plate was cut immediately prior to testing using a slow speed rotary diamond tipped saw lubricated with cooled phosphate buffered saline.
- the mid-point of the rat-fix plate was cut to remove the support of the plate in the fracture stabilization. This cut was done so as to cause minimal disturbance to the surrounding callus.
- each bone was then loaded into the 3-point jig with the rat-fix plate in contact with the low anvils with a 10 mm span such that the upper anvil was positioned directly above the cut- point on the plate.
- the downward motion of the upper anvil tests the resistance, and thus the strength, of the callus.
- the plate separates at the mid-point cut, minimizing the contribution of the plate to the measure of Ultimate Uoad to Failure (UUF).
- UUF Ultimate Uoad to Failure
- UUF was determined by the peak force immediately prior to the failure of callus as determined by the force-displacement curve.
- Group A exhibited 2.5 -fold increase in UUF when compared to Group B at the same time point (P ⁇ 0.001).
- Group B demonstrated increased UUF when compared to Group C and both time points.
- Group A exhibits extensive evidence of mineralization akin to mature trabecular bone (FIG. 9A).
- Significant remodelling of bone was observed by the presence of osteoclasts (FIG. 9B, white arrows), and the presence of osteocytes in Group A specimens (FIG. 9B, yellow arrows) which is indicative of mature mineralized bone.
- Osteoblastic activity was observed in the form of double -fluorochrome labelled mineral accretion. The osteoblastic bone formation was frequently observed as Tines’ colored green and red which are in association with each other (FIG.
- FIG. 10A and FIG. 10B the same pattern of activity between the groups was continued (FIG. 10A and FIG. 10B).
- Group A there appeared to be greater distribution of mature bone across all sections, consistent with pCT analyses.
- a degree of intra-trabecular, or intra- cortical labelling of mineral (FIG. 10B, orange arrows) suggested a further maturing of bone consistent with late-stage bone healing.
- Group B specimens appeared to exhibit all stages of callus formation and remodelling. That is, there was evidence of lack of periosteal bridging at times, the presence of cartilage, woven bone, lamellae bone, and evidence of remodelling as well.
- Group C the persistent lack of healing suggested that this group contained a treatment which was most comparable to a critical -sized defect model without any scaffold of healing agents.
- sixty-one animals were successfully treated with one of three test items following surgical creation of a critical size defect in the right femur. The post-operative recovery was unremarkable in the majority of animals.
- the test items were all placed within the defects, but on X-ray, it could be seen that the compounds containing the b-TCP putty were spread out of the defect area and into the surrounding tissue. As the collagen sponge was not visible on X-ray, it was not possible to judge if the sponge had moved out of the defect area.
- Radiographic and histological examination of the treated femurs showed that the Group A animals ( ⁇ BMR-2+b-TOR putty) had the most evidence of formation of mature bone in the defect site compared to the other two groups. This was shown by bridging of the periosteal callus, increased mineralization, presence of osteocytes, active remodelling of the bone (as shown by the presence of osteoclasts) and evidence of angiogenesis (shown by the presence of red blood cells and adipocytes). Whilst some evidence of mineralization of callus is present in the Group B (rhBMP+ACS) samples, this appeared to be less developed than for Group A. Group C (b-TCP putty) showed no evidence of mineralization, suggesting that having a scaffold alone could not induce new bone growth within eight weeks of application into a critical-sized defect.
- Group A animals also had significantly stronger bones than either Group B or Group C animals as evidenced by ultimate load to failure tests. This was evident at both four and eight weeks post-treatment.
- Group A exhibited the most advanced healing when compared to the other groups.
- radiographic evidence of periosteal bridging was a measure that no samples achieved in Group C and often was not observed in Group B, even at 8 weeks post-surgery.
- radiographic scores at 8 weeks post-surgery were comparable to 4 week scores, the mechanical strength of the callus was more than double the levels at 4 weeks post-surgery and at least 3-fold greater than levels in Group B, suggesting that considerable bone mineralization occurred within the callus region in the second 4 week period.
- the bone specimens form the tBMP-2 - ⁇ -b-TCP putty group clearly demonstrated vastly improved bone healing at 4- and 8-weeks post-surgery when compared to samples from animals in the rhBMP +ACS or the b-TCP putty alone treatment groups.
- chimeric polypeptides comprising a targeting polypeptide that binds to b-TCP maintained activity of the tethered protein (in this example, HRG).
- the chimeric polypeptide (lOx b-TCP-histidine rich glycoprotein HRG) refolded at 22 °C in buffer 10, and following incubation of the chimeric polypeptide with MCF-7 breast cancer cells, Akt activity was detected (FIG. 11). This result indicated that the chimeric polypeptide stimulated signalling activity in the target cell and was able to cause Akt phosphorylation.
- the Akt activity was determined in lOx b-TCP-HRG bound to a b-TCP peptide (FIG. 12).
- Binding assays were performed to quantify the affinity of tBMP-2 protein to various substrates, including commercially available bone graft materials, ceramic powders, 3D printable scaffold materials, and a plasma-sprayed hydroxyapatite coating.
- the tBMP-2 used in this study 10 comprises
- tBMP-2 protein was applied to each material and allowed to bind under light agitation for 90 - 120 minutes.
- the flow through was aspirated (removing the tBMP-2 which did not bind to the substrate material), and a wash was conducted with acetate buffer.
- the bound tBMP-2 was quantified by either 1) running non-reducing SDS Page gel electrophoresis and comparing the eluted tBMP-2 band to the tBMP-2 load band with Image J Gel Analysis tool, or 2) conducting a Bradford assay (with a BSA standard curve) on the eluted tBMP-2 25 and tBMP-2 load. Dividing the eluted tBMP-2 quantity by the original tBMP-2 load quantity and multiplying by 100 gave the % of tBMP-2 load that was strongly tethered to the substrate after the binding incubation step.
- Table 6 summarizes the materials that were evaluated as well as the % of tBMP-2 load which was effectively tethered to the substrate (% Bound).
- Ceramic -binding protein variants were generated by fusing targeting polypeptides that bind to ceramics such as calcium phosphate (Ca-P04) and hydroxyapatite to protein biologies, including 5 BMP2, BMP7, IGF1, FGF18, TGF 3. EGF, and NRG1.
- the resulting protein variants (tBMP2, tBMP7, tIGFl, tFGF18, tTGF S. tEGF, and tNRGl, respectively) and the modification details are provided in Table 7.
- Dimeric binding motif refers to the presence of two binding domains due to the dimeric nature of the ligand.
- tBMP-2 accelerates bone repair in a rigorous and challenging segmental bone defect animal model (CCTDM).
- Bone morphogenetic protein- 2 (BMP -2) is the most effective osteoinductive agent identified to date and is used in clinical orthopaedic practice to actively promote bone formation.
- BMP-2 use is limited by cost and the need to control release and delivery.
- a method for controlled, local delivery of BMP -2 activity has been engineered using a fusion protein that enables specific binding and retention of bioactive BMP -2 (tBMP-2) on beta-tricalcium phosphate ceramic substrates (CS).
- tBMP-2 bioactive BMP -2
- CS beta-tricalcium phosphate ceramic substrates
- tBMP-2 Ceramic scaffold composed of b-TCP granules (CaP Biomaterials, East Troy,
- the treatment procedures are outlined in FIG. 13.
- the Surgery 1 procedure included creating a 5-cm bone/periosteal defect in tibial diaphysis, stripping 2-cm periosteum from each segment, removing 10 cm 3 of cranial tibialis/gastrocnemius, placing 5-cm custom smooth or textured PMMA spacer, and stabilizing with interlocking intramedullary nail.
- IM Induced Membrane
- the implant at each graft site was supplemented with 6 cc of bone marrow aspirated from the sternum to provide a source of osteogenic connective tissue progenitors in a marrow -derived clot.
- Follow up procedures were performed during the 12 weeks after Surgery 2, including anterior-posterior (AP) and mediolateral (ML) Radiographs every 4 weeks and physical examination (lameness). Twelve weeks after Surgery 2, tibia were harvested and fixed in Formalin. Outcomes measured included Micro CT (primary outcome), Radial % Bone Volume (BV) and Moment Angle plots, Total Bone Volume (mm3) in 2.5 cm central region, and 12-weeks radiographs (AP and ML views).
- AP anterior-posterior
- ML mediolateral
- FIG. 14D The radiographic data (FIG. 14D) show that tBMP-2 demonstrates superior bone formation in a greater number of animals than the low dose and control conditions and the amount of new bone formed in both tBMP-2 groups was significantly higher than in the substrate -only group.
- Mean radial percent BV analysis illustrate a tendency for bone to form most readily in the medial- posterior aspect of the defect (FIG. 14A).
- FIG. 14C The results show a statistically significant dose-response (FIG. 14C), with medium dose and high dose tBMP-2 demonstrating comparable bone formation that was superior to the carrier only group (FIG. 14B). Even the lowest dose elicited bone formation. No adverse effects were noted in any animals, including the highest dosed animals.
- tBMP-2 delivered on a ceramic carrier can maintain local BMP- 2 concentrations necessary to induce bone formation with high efficacy in a severely compromised tissue bed with a good safety margin, even when combined with autogenous bone marrow -derived cells.
- the local concentration can be maintained over the time scales required to induce complete osteoinduction.
- the tBMP-2 technology tested in this study has demonstrated safety and efficacy in the most challenging large animal model that is available. It was notable that bioactivity remained only where the device was implanted.
- This example demonstrates the effectiveness of tBMP-2 (SEQ ID NO: 502) in a challenging ovine critical tibial defect model (OCTDM) as compared to autograft, the current standard of care.
- FIG. 15 provides an outline of the first and second surgeries, Surgery 1 and Surgery 2, respectively.
- Surgery 1 included excision of 4 cm of the tibial diaphysis, reaming of the tibia if necessary, stabilization of the tibia with a stainless-steel intramedullary nail and two proximal and two distal cross-locking bolts, placing a polymethyl methacrylate (PMMA) spacer and molding such that it replicated the dimensions of the tibia and overlapped the ends of the osteotomy site by a few millimetres.
- Surgery 2 was performed 4 weeks after Surgery 1, where the spacer was removed and the defect (contained within an induced fibrous membrane) was filled with the test materials or control item.
- PMMA polymethyl methacrylate
- Radiographs were taken immediately after each surgery and every two weeks following one month of post-graft recovery to evaluate bone formation, union and remodelling of the defect.
- the groups were divided between 8- and 16-week endpoints and the following methods were used for analysis: hematology, biochemistry, pathology, mechanical testing, micro computed tomography and bone histology.
- Two sheep were excluded from data analyses due to nail failure and two sheep presented with infection (not related to surgery or treatment) that may have impacted healing.
- tBMP- 2 delivered by a cotton-like ceramic bone void filler provides an adequate osteoinductive signal to induce new bone formation comparable to autograft as demonstrated by radiographic (FIG. 16A) and CT (FIG. 16B) data, and it can maintain local BMP -2 concentrations necessary to induce bone formation with high efficacy in a severely compromised tissue bed with a good safety margin as shown in FIGS. 16D-16E.
- tBMP-2 technology tested in this study demonstrated safety and efficacy in this challenging large animal model, enabling the selection of tBMP-2 formulation for future preclinical and clinical trials.
- Improved materials and strategies for bone regeneration in compromised tissue beds will enable better outcomes for military and civilian patients suffering from large traumatic lower extremity injuries and reduce the need for amputation.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Physical Education & Sports Medicine (AREA)
- Immunology (AREA)
- General Chemical & Material Sciences (AREA)
- Physics & Mathematics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Plant Pathology (AREA)
- Microbiology (AREA)
- Inorganic Chemistry (AREA)
- Rheumatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
- Materials For Medical Uses (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2022562617A JP2023525960A (ja) | 2020-04-15 | 2021-04-14 | 骨に標的治療薬を送達するための組成物および方法 |
| CN202180042758.XA CN115916239A (zh) | 2020-04-15 | 2021-04-14 | 用于靶向治疗性递送至骨的组合物和方法 |
| EP21787730.7A EP4135750A4 (en) | 2020-04-15 | 2021-04-14 | COMPOSITIONS AND METHODS FOR TARGETED THERAPEUTIC RELEASE IN BONE |
| KR1020227039125A KR102821039B1 (ko) | 2020-04-15 | 2021-04-14 | 골에의 표적화된 치료적 전달을 위한 조성물 및 방법 |
| CA3180156A CA3180156A1 (en) | 2020-04-15 | 2021-04-14 | Compositions and methods for targeted therapeutic delivery to bone |
| AU2021254751A AU2021254751B2 (en) | 2020-04-15 | 2021-04-14 | Compositions and methods for targeted therapeutic delivery to bone |
| BR112022020809A BR112022020809A2 (pt) | 2020-04-15 | 2021-04-14 | Composições e métodos para entrega terapêutica direcionada ao osso |
| US18/046,810 US12264187B2 (en) | 2020-04-15 | 2022-10-14 | Compositions and methods for targeted therapeutic delivery to bone |
| US19/059,012 US20250179136A1 (en) | 2020-04-15 | 2025-02-20 | Compositions and methods for targeted therapeutic delivery to bone |
| JP2025152835A JP2026004340A (ja) | 2020-04-15 | 2025-09-12 | 骨に標的治療薬を送達するための組成物および方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063010639P | 2020-04-15 | 2020-04-15 | |
| US63/010,639 | 2020-04-15 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/046,810 Continuation US12264187B2 (en) | 2020-04-15 | 2022-10-14 | Compositions and methods for targeted therapeutic delivery to bone |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2021211683A2 true WO2021211683A2 (en) | 2021-10-21 |
| WO2021211683A3 WO2021211683A3 (en) | 2021-11-18 |
Family
ID=78084414
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/027230 Ceased WO2021211683A2 (en) | 2020-04-15 | 2021-04-14 | Compositions and methods for targeted therapeutic delivery to bone |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US12264187B2 (https=) |
| EP (1) | EP4135750A4 (https=) |
| JP (2) | JP2023525960A (https=) |
| KR (1) | KR102821039B1 (https=) |
| CN (1) | CN115916239A (https=) |
| AU (1) | AU2021254751B2 (https=) |
| BR (1) | BR112022020809A2 (https=) |
| CA (1) | CA3180156A1 (https=) |
| TW (1) | TW202203961A (https=) |
| WO (1) | WO2021211683A2 (https=) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11752211B2 (en) | 2014-06-23 | 2023-09-12 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
| US11773138B2 (en) | 2018-10-12 | 2023-10-03 | Theradaptive, Inc. | Polypeptides including a beta-tricalcium phosphate-binding sequence and uses thereof |
| WO2024249507A1 (en) * | 2023-05-30 | 2024-12-05 | Theradaptive, Inc. | Compositions comprising an interleukin and a calcium compound for treating a cancer |
| US12264187B2 (en) | 2020-04-15 | 2025-04-01 | Theradaptive, Inc. | Compositions and methods for targeted therapeutic delivery to bone |
| WO2025166305A1 (en) * | 2024-02-02 | 2025-08-07 | Theradaptive, Inc. | Bone formation compositions and methods of use |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN120789330A (zh) * | 2025-08-04 | 2025-10-17 | 中国人民解放军总医院第四医学中心 | 一种外科钛合金融合器活性涂层的制备方法 |
Family Cites Families (60)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0173552B1 (en) | 1984-08-24 | 1991-10-09 | The Upjohn Company | Recombinant dna compounds and the expression of polypeptides such as tpa |
| US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
| US4880610A (en) | 1988-04-20 | 1989-11-14 | Norian Corporation | In situ calcium phosphate minerals--method and composition |
| US5152791A (en) | 1989-12-07 | 1992-10-06 | Olympus Optical Co., Ltd. | Prosthetic artificial bone having ceramic layers of different porosity |
| US5491082A (en) | 1991-03-18 | 1996-02-13 | Director-General Of Agency Of Industrial Science And Technology | Plasminogen activator covalently bonded to a porous body of β-tricalcium phosphate |
| US7008634B2 (en) | 1995-03-03 | 2006-03-07 | Massachusetts Institute Of Technology | Cell growth substrates with tethered cell growth effector molecules |
| DE19608753C1 (de) | 1996-03-06 | 1997-06-26 | Medigene Gmbh | Transduktionssystem und seine Verwendung |
| US6455495B1 (en) | 1997-02-14 | 2002-09-24 | The Salk Institute For Biological Studies | Methods and compositions for delivery of therapeutic agents to bone tissue employing conjugates of negatively charged peptide oligomers with therapeutic agents |
| AU770196B2 (en) | 1999-02-04 | 2004-02-12 | Warsaw Orthopedic, Inc. | Osteogenic paste compositions and uses thereof |
| IL142900A0 (en) * | 1999-09-03 | 2002-04-21 | Amgen Inc | Compositions and methods for the prevention or treatment of cancer and bone loss associated with cancer |
| AU2001277854B2 (en) | 2000-06-29 | 2007-03-01 | North Shore-Long Island Jewish Health System | Modulators of cellular proliferation and angiogenesis, methods for use and identification thereof |
| US6949251B2 (en) | 2001-03-02 | 2005-09-27 | Stryker Corporation | Porous β-tricalcium phosphate granules for regeneration of bone tissue |
| US20040197892A1 (en) | 2001-04-04 | 2004-10-07 | Michael Moore | Composition binding polypeptides |
| US20030113714A1 (en) | 2001-09-28 | 2003-06-19 | Belcher Angela M. | Biological control of nanoparticles |
| WO2003072593A2 (en) | 2002-02-21 | 2003-09-04 | University Of Virginia Patent Foundation | Bone targeting peptides |
| US20030221931A1 (en) | 2002-02-28 | 2003-12-04 | Steve Marsh | Sliding device |
| US20050084962A1 (en) | 2003-08-20 | 2005-04-21 | Bruce Simon | Methods of treatment using electromagnetic field stimulated stem cells |
| US7473682B2 (en) | 2003-10-29 | 2009-01-06 | Ramot At Tel Aviv University Ltd. | Angiogenic peptides and uses thereof |
| US20060051396A1 (en) | 2004-06-16 | 2006-03-09 | Affinergy, Inc. | Biofunctional coatings |
| WO2006012414A2 (en) | 2004-07-20 | 2006-02-02 | Critical Therapeutics, Inc. | Novel polyadenylation signal for use in expression vectors |
| US7871978B2 (en) | 2004-11-04 | 2011-01-18 | University Of Virginia Patent Foundation | Bone tropic peptides |
| WO2006062776A2 (en) | 2004-11-29 | 2006-06-15 | The Regents Of The University Of California | Hydroxyapatite-binding peptides for bone growth and inhibition |
| US20060193916A1 (en) | 2005-01-07 | 2006-08-31 | Acologix, Inc. | Formulations of peptides for periodontal and dental treatments |
| US8137664B2 (en) | 2005-02-02 | 2012-03-20 | Sdgi Holdings, Inc. | Method and kit for repairing a defect in bone |
| WO2007073661A1 (fr) * | 2005-12-26 | 2007-07-05 | Yantai Zhenghai Bio-Technology Co., Ltd. | Matieres de squelette de collagene activees et leurs facteurs speciaux de restauration active fusionnee |
| US7592009B2 (en) | 2006-10-10 | 2009-09-22 | Ecole Polytechnique Federale De Lausanne (Epfl) | Polypeptide ligands for targeting cartilage and methods of use thereof |
| US9295755B2 (en) | 2006-10-18 | 2016-03-29 | Wisconsin Alumni Research Foundation | Multilayer tissue regeneration system |
| US7977313B2 (en) | 2007-04-27 | 2011-07-12 | Affinergy, Inc. | Methods and compositions for promoting localization of pharmaceutically active agents to bone |
| US8075562B2 (en) | 2007-06-25 | 2011-12-13 | Wisconsin Alumni Research Foundation | Controlled release of biopharmaceutical growth factors from hydroxyapatite coating on bioresorbable interference screws used in cruciate ligament reconstruction surgery |
| US20100098761A1 (en) | 2007-08-03 | 2010-04-22 | University Of Massachusetts Medical School | Polymer Compositions For Biomedical And Material Applications |
| WO2009108934A2 (en) | 2008-02-28 | 2009-09-03 | Osteotherapeutics, L.L.C. | Injectable calcium phosphate cememts formulated with bioactive agents and methods for making same |
| WO2009111014A2 (en) | 2008-03-04 | 2009-09-11 | Crystal Bioscience Inc. | Gel microdrop composition and method of using the same |
| US8158366B2 (en) | 2008-04-07 | 2012-04-17 | Auburn University | Methods of identifying peptides and compositions that bind to oocytes in a species-specific manner |
| US20100049322A1 (en) | 2008-08-19 | 2010-02-25 | Warsaw Orthopedic, Inc. | Osteochondral repair implants and methods |
| GB0818255D0 (en) * | 2008-10-06 | 2008-11-12 | Agency Science Tech & Res | Isolation and identification of glycosaminoglycans |
| CN104357381A (zh) | 2008-10-31 | 2015-02-18 | 辛西斯有限责任公司 | 用于活化干细胞的方法和装置 |
| WO2010052715A2 (en) | 2008-11-07 | 2010-05-14 | Ramot At Tel Aviv University Ltd. | Devices and methods for local treatment of cardiovascular diseases |
| US20100260673A1 (en) | 2009-04-10 | 2010-10-14 | Qizhen Cao | Phage display peptide probes for imaging early responses to antiangiogenic treatment |
| US8420774B2 (en) | 2009-12-01 | 2013-04-16 | Wisconsin Alumni Research Foundation | Decorating hydroxyapatite biomaterials with modular biologically active molecules |
| WO2011116391A1 (en) | 2010-03-19 | 2011-09-22 | Lifenet Health | Bmp-2 peptides & methods of use |
| US8778869B2 (en) | 2010-06-09 | 2014-07-15 | Wisconsin Alumni Research Foundation | Tissue regeneration system |
| EP2648740B1 (en) * | 2010-12-06 | 2022-02-09 | Massachusetts Institute of Technology | Tricalcium phosphate binding peptides and uses thereof |
| US20130268074A1 (en) | 2010-12-21 | 2013-10-10 | Prosthexis Pty Ltd | Prosthetic menisci and method of implanting in the human knee joint |
| CN102532272A (zh) | 2011-12-29 | 2012-07-04 | 陕西师范大学 | HepG2细胞表面特异性结合的多肽 |
| CN104193803B (zh) | 2014-07-25 | 2016-08-17 | 河南科技大学 | 鸭肝炎病毒i型vp1蛋白抑制肽及其应用 |
| US20160159869A1 (en) | 2014-12-09 | 2016-06-09 | Northwestern University | Bmp-2-binding peptide amphiphile nanofibers |
| CN108473981B (zh) | 2015-12-04 | 2022-04-12 | 卡里布生物科学公司 | 工程化靶向核酸的核酸 |
| EP3631450B1 (en) | 2017-05-29 | 2022-11-23 | Charité - Universitätsmedizin Berlin | Cd8 t cell subsets as a biomarker for predicting non-fusion after spinal fusion surgery |
| US10675330B2 (en) | 2018-03-21 | 2020-06-09 | Warsaw Orthopedic, Inc. | Injectable bone morphogenetic protein |
| WO2019232283A1 (en) | 2018-05-30 | 2019-12-05 | Purdue Research Foundation | Targeting anabolic drugs for accelerated fracture repair |
| CN110746500A (zh) | 2018-07-24 | 2020-02-04 | 浙江瑞谷生物科技有限公司 | 一种编码重组人骨形态发生蛋白质-2的氨基酸序列 |
| US20200102458A1 (en) | 2018-09-28 | 2020-04-02 | Icl Specialty Products Inc. | Cool Roof Coating Containing Multifunctional Additive |
| CN113166202B (zh) * | 2018-10-12 | 2024-09-13 | 治疗调适公司 | 包括β-磷酸三钙-结合序列的多肽及其用途 |
| JP7128902B2 (ja) * | 2018-12-25 | 2022-08-31 | Orthorebirth株式会社 | 複数の電界紡糸繊維からなる綿形状の構造を有する骨再生用材料 |
| US20220096600A1 (en) | 2019-02-07 | 2022-03-31 | Baylor College Of Medicine | Periosteal skeletal stem cells in bone repair |
| US20220323641A1 (en) | 2019-08-20 | 2022-10-13 | Theradaptive, Inc. | Materials for delivery of tetherable proteins in bone implants |
| US20230203115A1 (en) | 2020-03-06 | 2023-06-29 | Theradaptive, Inc. | Therapeutic compositions comprising graft materials and beta-tcp binding peptides and uses thereof |
| JP2023525960A (ja) | 2020-04-15 | 2023-06-20 | セラダプティブ インク | 骨に標的治療薬を送達するための組成物および方法 |
| AU2021297422B2 (en) | 2020-06-21 | 2023-12-14 | Orthorebirth Co., Ltd. | Osteoinductive bone regeneration material and production method of the same |
| WO2022182749A2 (en) | 2021-02-24 | 2022-09-01 | Theradaptive, Inc. | Ceramic compositions and methods of use |
-
2021
- 2021-04-14 JP JP2022562617A patent/JP2023525960A/ja active Pending
- 2021-04-14 BR BR112022020809A patent/BR112022020809A2/pt unknown
- 2021-04-14 CA CA3180156A patent/CA3180156A1/en active Pending
- 2021-04-14 AU AU2021254751A patent/AU2021254751B2/en active Active
- 2021-04-14 KR KR1020227039125A patent/KR102821039B1/ko active Active
- 2021-04-14 EP EP21787730.7A patent/EP4135750A4/en active Pending
- 2021-04-14 CN CN202180042758.XA patent/CN115916239A/zh active Pending
- 2021-04-14 WO PCT/US2021/027230 patent/WO2021211683A2/en not_active Ceased
- 2021-04-15 TW TW110113629A patent/TW202203961A/zh unknown
-
2022
- 2022-10-14 US US18/046,810 patent/US12264187B2/en active Active
-
2025
- 2025-02-20 US US19/059,012 patent/US20250179136A1/en active Pending
- 2025-09-12 JP JP2025152835A patent/JP2026004340A/ja active Pending
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11752211B2 (en) | 2014-06-23 | 2023-09-12 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
| US11773138B2 (en) | 2018-10-12 | 2023-10-03 | Theradaptive, Inc. | Polypeptides including a beta-tricalcium phosphate-binding sequence and uses thereof |
| US12264187B2 (en) | 2020-04-15 | 2025-04-01 | Theradaptive, Inc. | Compositions and methods for targeted therapeutic delivery to bone |
| WO2024249507A1 (en) * | 2023-05-30 | 2024-12-05 | Theradaptive, Inc. | Compositions comprising an interleukin and a calcium compound for treating a cancer |
| WO2025166305A1 (en) * | 2024-02-02 | 2025-08-07 | Theradaptive, Inc. | Bone formation compositions and methods of use |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2021211683A3 (en) | 2021-11-18 |
| AU2021254751B2 (en) | 2025-01-30 |
| TW202203961A (zh) | 2022-02-01 |
| KR20230011289A (ko) | 2023-01-20 |
| US20250179136A1 (en) | 2025-06-05 |
| JP2026004340A (ja) | 2026-01-14 |
| EP4135750A4 (en) | 2024-08-21 |
| BR112022020809A2 (pt) | 2023-02-23 |
| AU2021254751A1 (en) | 2022-11-17 |
| KR102821039B1 (ko) | 2025-06-13 |
| US20230235002A1 (en) | 2023-07-27 |
| CA3180156A1 (en) | 2021-10-21 |
| EP4135750A2 (en) | 2023-02-22 |
| CN115916239A (zh) | 2023-04-04 |
| US12264187B2 (en) | 2025-04-01 |
| JP2023525960A (ja) | 2023-06-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11773138B2 (en) | Polypeptides including a beta-tricalcium phosphate-binding sequence and uses thereof | |
| US12264187B2 (en) | Compositions and methods for targeted therapeutic delivery to bone | |
| Oryan et al. | Bone injury and fracture healing biology | |
| JP5399264B2 (ja) | 骨成長粒子及びそれの骨誘導組成物 | |
| Shibahara et al. | Honeycomb scaffold-guided bone reconstruction of critical-sized defects in rabbit ulnar shafts | |
| KR102751476B1 (ko) | 자가 골 이식편 대체재 | |
| Kim et al. | Promising efficacy of Escherichia coli recombinant human bone morphogenetic protein-2 in collagen sponge for ectopic and orthotopic bone formation and comparison with mammalian cell recombinant human bone morphogenetic protein-2 | |
| US20230203115A1 (en) | Therapeutic compositions comprising graft materials and beta-tcp binding peptides and uses thereof | |
| Kanjilal et al. | Bone morphogenetic proteins (BMPs) and bone regeneration | |
| Bigham-Sadegh et al. | Hydroxyapatite and demineralized calf fetal growth plate effects on bone healing in rabbit model | |
| HK40090498A (zh) | 用於靶向治疗性递送至骨的组合物和方法 | |
| Masuda et al. | Combined administration of BMP-2 and HGF facilitate bone regeneration through angiogenic mechanisms | |
| HK40056601A (en) | Polypeptides including a beta-tricalcium phosphate-binding sequence and uses thereof | |
| HK40056601B (zh) | 包括β-磷酸三钙-结合序列的多肽及其用途 | |
| WO2025201369A1 (zh) | 一种包含bmp-2的组合物及其制备方法及用途 | |
| Boerckel | Mechanical regulation of bone regeneration and vascular growth in vivo | |
| Glatt | Influence of the mechanical environment upon the healing of segmental bone defects in the rat femur |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| ENP | Entry into the national phase |
Ref document number: 3180156 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022562617 Country of ref document: JP Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022020809 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202217061889 Country of ref document: IN |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021254751 Country of ref document: AU Date of ref document: 20210414 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2021787730 Country of ref document: EP Effective date: 20221115 |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21787730 Country of ref document: EP Kind code of ref document: A2 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112022020809 Country of ref document: BR Free format text: APRESENTE O RELATORIO DESCRITIVO. |
|
| ENP | Entry into the national phase |
Ref document number: 112022020809 Country of ref document: BR Kind code of ref document: A2 Effective date: 20221013 |