WO2021202863A1 - Anticorps de ror-1 humain et lymphocytes car-t anti-ror-1 - Google Patents
Anticorps de ror-1 humain et lymphocytes car-t anti-ror-1 Download PDFInfo
- Publication number
- WO2021202863A1 WO2021202863A1 PCT/US2021/025355 US2021025355W WO2021202863A1 WO 2021202863 A1 WO2021202863 A1 WO 2021202863A1 US 2021025355 W US2021025355 W US 2021025355W WO 2021202863 A1 WO2021202863 A1 WO 2021202863A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- car
- ror
- cells
- scfv
- seq
- Prior art date
Links
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims abstract description 62
- 239000012634 fragment Substances 0.000 claims abstract description 13
- 230000003213 activating effect Effects 0.000 claims abstract description 5
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 5
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 27
- 150000001413 amino acids Chemical class 0.000 claims description 25
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 13
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 13
- 210000000822 natural killer cell Anatomy 0.000 claims description 7
- 108020004707 nucleic acids Proteins 0.000 claims description 7
- 102000039446 nucleic acids Human genes 0.000 claims description 7
- 150000007523 nucleic acids Chemical class 0.000 claims description 7
- 230000004913 activation Effects 0.000 claims description 6
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 2
- 210000004027 cell Anatomy 0.000 description 105
- 206010028980 Neoplasm Diseases 0.000 description 41
- 239000013598 vector Substances 0.000 description 25
- 239000000427 antigen Substances 0.000 description 19
- 102000036639 antigens Human genes 0.000 description 19
- 108091007433 antigens Proteins 0.000 description 19
- 201000011510 cancer Diseases 0.000 description 19
- 108090000623 proteins and genes Proteins 0.000 description 18
- 239000002773 nucleotide Substances 0.000 description 13
- 125000003729 nucleotide group Chemical group 0.000 description 13
- 238000003556 assay Methods 0.000 description 11
- 108090000765 processed proteins & peptides Proteins 0.000 description 11
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 10
- 102000004169 proteins and genes Human genes 0.000 description 10
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 9
- 229920001184 polypeptide Polymers 0.000 description 9
- 102000004196 processed proteins & peptides Human genes 0.000 description 9
- 102100037850 Interferon gamma Human genes 0.000 description 8
- 108010074328 Interferon-gamma Proteins 0.000 description 8
- 241000283707 Capra Species 0.000 description 7
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 7
- 230000001472 cytotoxic effect Effects 0.000 description 7
- 238000010186 staining Methods 0.000 description 7
- 241001430294 unidentified retrovirus Species 0.000 description 7
- 101000699762 Homo sapiens RNA 3'-terminal phosphate cyclase Proteins 0.000 description 6
- 241000713666 Lentivirus Species 0.000 description 6
- 102100029143 RNA 3'-terminal phosphate cyclase Human genes 0.000 description 6
- 230000003013 cytotoxicity Effects 0.000 description 6
- 231100000135 cytotoxicity Toxicity 0.000 description 6
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 6
- 239000012636 effector Substances 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 230000003834 intracellular effect Effects 0.000 description 6
- 238000004806 packaging method and process Methods 0.000 description 6
- 239000002953 phosphate buffered saline Substances 0.000 description 6
- 102000005962 receptors Human genes 0.000 description 6
- 108020003175 receptors Proteins 0.000 description 6
- 206010009944 Colon cancer Diseases 0.000 description 5
- 238000002965 ELISA Methods 0.000 description 5
- 102100039615 Inactive tyrosine-protein kinase transmembrane receptor ROR1 Human genes 0.000 description 5
- 241000700605 Viruses Species 0.000 description 5
- 208000029742 colonic neoplasm Diseases 0.000 description 5
- 230000000139 costimulatory effect Effects 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- 238000010361 transduction Methods 0.000 description 5
- 230000026683 transduction Effects 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- -1 4- IBB Proteins 0.000 description 4
- 108090000695 Cytokines Proteins 0.000 description 4
- 102000004127 Cytokines Human genes 0.000 description 4
- 101001103039 Homo sapiens Inactive tyrosine-protein kinase transmembrane receptor ROR1 Proteins 0.000 description 4
- 238000000540 analysis of variance Methods 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 239000013553 cell monolayer Substances 0.000 description 4
- 231100000433 cytotoxic Toxicity 0.000 description 4
- 230000003247 decreasing effect Effects 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 238000009169 immunotherapy Methods 0.000 description 4
- 230000002611 ovarian Effects 0.000 description 4
- 238000002823 phage display Methods 0.000 description 4
- 238000010149 post-hoc-test Methods 0.000 description 4
- 230000011664 signaling Effects 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- 101100166600 Homo sapiens CD28 gene Proteins 0.000 description 3
- 101001103036 Homo sapiens Nuclear receptor ROR-alpha Proteins 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 108010038807 Oligopeptides Proteins 0.000 description 3
- 102000015636 Oligopeptides Human genes 0.000 description 3
- 108010004729 Phycoerythrin Proteins 0.000 description 3
- 108010090804 Streptavidin Proteins 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 239000011324 bead Substances 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 230000006690 co-activation Effects 0.000 description 3
- 238000002784 cytotoxicity assay Methods 0.000 description 3
- 231100000263 cytotoxicity test Toxicity 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 230000002489 hematologic effect Effects 0.000 description 3
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 238000000034 method Methods 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 239000002356 single layer Substances 0.000 description 3
- 210000000130 stem cell Anatomy 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- APKFDSVGJQXUKY-KKGHZKTASA-N Amphotericin-B Natural products O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1C=CC=CC=CC=CC=CC=CC=C[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-KKGHZKTASA-N 0.000 description 2
- 102100027207 CD27 antigen Human genes 0.000 description 2
- 229920001917 Ficoll Polymers 0.000 description 2
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 2
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 2
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- 101710110042 Inactive tyrosine-protein kinase transmembrane receptor ROR1 Proteins 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 108010006700 Receptor Tyrosine Kinase-like Orphan Receptors Proteins 0.000 description 2
- 102000005435 Receptor Tyrosine Kinase-like Orphan Receptors Human genes 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 2
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 108010004469 allophycocyanin Proteins 0.000 description 2
- APKFDSVGJQXUKY-INPOYWNPSA-N amphotericin B Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 2
- 229960003942 amphotericin b Drugs 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- SCJNCDSAIRBRIA-DOFZRALJSA-N arachidonyl-2'-chloroethylamide Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)NCCCl SCJNCDSAIRBRIA-DOFZRALJSA-N 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 102000055277 human IL2 Human genes 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 229930027917 kanamycin Natural products 0.000 description 2
- 229960000318 kanamycin Drugs 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 229930182823 kanamycin A Natural products 0.000 description 2
- 230000002147 killing effect Effects 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 1
- 238000011357 CAR T-cell therapy Methods 0.000 description 1
- 238000011523 CAR-T cell immunotherapy Methods 0.000 description 1
- 102100037904 CD9 antigen Human genes 0.000 description 1
- 101100463133 Caenorhabditis elegans pdl-1 gene Proteins 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 208000033978 Device electrical impedance issue Diseases 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 102000007338 Fragile X Mental Retardation Protein Human genes 0.000 description 1
- 108010032606 Fragile X Mental Retardation Protein Proteins 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 description 1
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101000804792 Homo sapiens Protein Wnt-5a Proteins 0.000 description 1
- 101100038117 Homo sapiens ROR1 gene Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000738335 Homo sapiens T-cell surface glycoprotein CD3 zeta chain Proteins 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 102000004083 Lymphotoxin-alpha Human genes 0.000 description 1
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 241000711408 Murine respirovirus Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 101800001295 Putative ATP-dependent helicase Proteins 0.000 description 1
- 101800001006 Putative helicase Proteins 0.000 description 1
- 101150001095 ROR1 gene Proteins 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 102100037906 T-cell surface glycoprotein CD3 zeta chain Human genes 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 1
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 102000013814 Wnt Human genes 0.000 description 1
- 108050003627 Wnt Proteins 0.000 description 1
- 102000043366 Wnt-5a Human genes 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 230000033289 adaptive immune response Effects 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 108700010039 chimeric receptor Proteins 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 230000001094 effect on targets Effects 0.000 description 1
- 230000005684 electric field Effects 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- JEIPFZHSYJVQDO-UHFFFAOYSA-N ferric oxide Chemical compound O=[Fe]O[Fe]=O JEIPFZHSYJVQDO-UHFFFAOYSA-N 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 210000000232 gallbladder Anatomy 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 108091008915 immune receptors Proteins 0.000 description 1
- 102000027596 immune receptors Human genes 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 239000010410 layer Substances 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 208000003747 lymphoid leukemia Diseases 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000014511 neuron projection development Effects 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 210000004872 soft tissue Anatomy 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4631—Chimeric Antigen Receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/50—Colon
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
Definitions
- the present invention relates to human ROR-1 -specific antibody and anti-ROR-1- CAR-T cells, which are useful in the field of adoptive immunity gene therapy for tumors.
- T cells or T lymphocytes the armed forces of our immune system, constantly look for foreign antigens and discriminate abnormal (cancer or infected cells) from normal cells.
- Genetically modifying T cells with CAR (Chimeric antigen receptor) constructs is the most common approach to design tumor-specific T cells.
- CAR-T cells targeting tumor-associated antigens (TAA) can be infused into patients (called adoptive cell transfer or ACT) representing an efficient immunotherapy approach [1, 2].
- adoptive cell transfer or ACT representing an efficient immunotherapy approach [1, 2].
- the advantage of CAR-T technology compared with chemotherapy or antibody is that reprogrammed engineered T cells can proliferate and persist in the patient (“a living drug”)[3], [4], [1],
- CARs usually consist of a monoclonal antibody-derived single-chain variable fragment (scFv) at the N-terminal part, hinge, transmembrane domain and a number of intracellular co-activation domains: (i) CD28, (ii) CD137 (4-1BB), CD27 or other costimulatory domains, in tandem with an activation CD3-zeta domain.
- scFv monoclonal antibody-derived single-chain variable fragment
- NK cells Natural killer cells, or NK cells, are a type of cytotoxic lymphocyte critical to the innate immune system.
- the role NK cells play is analogous to that of cytotoxic T cells in the vertebrate adaptive immune response. NK cells provide rapid responses to virus-infected cells, acting at around 3 days after infection, and respond to tumor formation.
- Figure 1 show the structures of CAR.
- the left panel shows the structure of the first generation (no costimulatory domains).
- the middle panel shows the structure of the second generation (one co-stimulatory domain CD28 or 4-BB).
- the right panel shows the third generation of CAR (two or several co-stimulatory domains) are shown.
- the Figure is from Golubovskaya, Wu, Cancers, 2016 [4],
- Tyrosine-protein kinase transmembrane receptor ROR1 also known as neurotrophic tyrosine kinase, receptor-related 1 (NTRKR1), is an enzyme that in humans is encoded by the ROR1 gene.
- ROR1 is a member of the receptor tyrosine kinase-like orphan receptor (ROR) family.
- ROR-1 is 937 amino-acid protein, about 104 kb with 30-406 aa extracellular domain. ROR-1 has low expression in most tissues which is advantageous to use it as a target for CAR-T cell therapy.
- the ROR-1 gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system.
- the encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors.
- ROR-1 is receptor for ligand WNT5A which activate downstream NF kappa B signaling pathway and may result in the inhibition of WNT-mediated signaling.
- ROR1 has recently been shown to be expressed on ovarian cancer stem cells and promote migration, invasion and cancer stem cell spheroid formation.
- ROR-1 is shown to be overexpressed in both hematological cancers and solid tumors that makes this target useful for CAR-T therapy.
- ROR-1 Low expression of ROR-1 has been shown in most of normal human tissues such as adipose and soft tissue, bone marrow and immune system, endocrine tissues, female tissue, gastrointestinal tract, kidney and urinary bladder, liver and gallbladder, lung, muscle tissues, male tissues, and skin.
- FIG. 1 The structures of ROR-1 CAR constructs. Abbreviations: ScFv, single chain variable fragment; h-hinge; TM-transmembrane; Figure 3. Binding of ROR-1 done B2 with Human ROR-1 antigen. Different dilutions are shown on X-axis; binding is shown on Y-axis, OD450 nM.
- FIG. 4 FACS with goat anti-human Fab’i antibody to detect ROR-1 -CAR positive cdls. Left pand: isotype staining, right pand: goat anti-human Fab'a human FAB staining. T cdls and ROR-l-CAR-T cdls are shown.
- RTCA assay demonstrates killing activity of ROR-l-CAR-T cdls in vitro.
- Figure 5. The cytotaxidty assay was performed using ROR1 -CAR-T cdls from 3 donors with ACEA XCdligence system at different Effector to Target cdl ratio 3:1 (right pands) and 10:1 (left pands). Cytotaxidty was calculated as (X-Y)*100/X, where X is the average impedance of the target cdl monolayer in the absence of effector cdls and Y is the average impedance of the target cdl monolayer in the presence of effector cdls.
- Figure 6B IFN-gamma secretion after RTC A assay with ROR1-CAR-T cdls from 3 different donors (#000, 155, and 160) using target HCT116, HT29 and Lovo colon cancer cdls.
- the p values for CAR-T cdls vs T cdls are ⁇ 0.0001 by 2-way ANOVA with
- Figures 7A-7D ROR-l-CAR-T cdls significantly decrease Lovo-l xenograft tumor growth.
- Figure 7A shows tumor growth curve.
- Figure 7B and 7C shows tumor size and tumor weight of ex vivo tumors.
- Figure 7D shows mouse body wdght *p ⁇ 0.05 ROR-1- CD28-CD3 CAR-T cdls versus Mock CAR-T cdls.
- figure 8. Flow cytometric analysis of CAR expression, figure 9. Quantitation of cytotoxicity in the RTCA assay. For each cdl line, bars from left to right show: T cdls, then PMC167, FMC869, and FMC870 CAR-T cdls. figure 10.
- a "chimeric antigen receptor (CAR)” is a receptor protein that has been engineered to give T cells the new ability to target a specific protein.
- the receptor is chimeric because they combine both antigen-binding and T-cell activating functions into a single receptor.
- CAR is a fused protein comprising an extracellular domain capable of binding to an antigen, a transmembrane domain, and at least one intracellular domain.
- the "chimeric antigen receptor (CAR)” is sometimes called a “chimeric receptor", a "T-body”, or a “chimeric immune receptor (CIR).”
- extracellular domain capable of binding to an antigen means any oligopeptide or polypeptide that can bind to a certain antigen.
- intracellular domain means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell.
- a “domain” means one region in a polypeptide which is folded into a particular structure independently of other regions.
- scFv single chain variable fragment
- An example of the scFv includes an antibody polypeptide which is formed by a recombinant DNA technique and in which Fv regions of immunoglobulin heavy chain (H chain) and light chain (L chain) fragments are linked via a spacer sequence.
- H chain immunoglobulin heavy chain
- L chain light chain
- tumor antigen means a biological molecule having antigenicity, expression of which causes cancer.
- the inventors have generated human ROR-1 monoclonal antibody using phage display library specifically targeting human ROR-1 antigen.
- the inventors have produced ROR-1 -CAR- T cells to target cancer cells overexpressing ROR-1 tumor antigen.
- the ROR-1 -CAR-T cells of the present invention have high cytotoxic activity against several cancer cell lines and anti-tumor activity in vivo.
- the present invention is directed to a human anti-human ROR-1 antibody or an antigen-binding fragment therefore, comprising VH having the amino acid of SEQ ID NO: 3 and VL having the amino acid of SEQ ID NO: 4.
- the monoclonal anti-human ROR-1 antibody is generated against the extracellular region of the purified recombinant fragment of human ROR-1.
- the monoclonal anti-human ROR-1 antibody is a singlechain variable fragment (scFv).
- the present invention is also directed to a chimeric antigen receptor fusion protein comprising from N-terminus to C-terminus: (i) a single-chain variable fragment (scFv) against ROR-1, (ii) a transmembrane domain, (iii) at least one co-stimulatory domains, and (iv) an activating domain.
- a chimeric antigen receptor fusion protein comprising from N-terminus to C-terminus: (i) a single-chain variable fragment (scFv) against ROR-1, (ii) a transmembrane domain, (iii) at least one co-stimulatory domains, and (iv) an activating domain.
- FIG. 2 shows one structure of ROR-1 CAR construct.
- the second -generation CAR is shown with either CD28 or 4 IBB co-stimulatory domains.
- ScFv can be VH-linker-VL or VL-linker-VH.
- the co-stimulatory domain is selected from the group consisting of CD28, 4- IBB, GITR, ICOS-1, CD27, OX-40 and DAP10.
- a preferred the co-stimulatory domain is CD28.
- a preferred activating domain is CD3 zeta (CD3 Z or CD3Q
- the transmembrane domain may be derived from a natural polypeptide, or may be artificially designed.
- the transmembrane domain derived from a natural polypeptide can be obtained from any membrane-binding or transmembrane protein.
- a transmembrane domain of a T cell receptor a or ⁇ chain, a CD3 zeta chain, CD28, CD3e., CD45, CD4, CDS, CDS, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD 137, ICOS, CD 154, or a GITR can be used.
- the artificially designed transmembrane domain is a polypeptide mainly comprising hydrophobic residues such as leucine and valine. It is preferable that a triplet of phenylalanine, tryptophan and valine is found at each end of the synthetic transmembrane domain.
- a short oligopeptide linker or a polypeptide linker for example, a linker having a length of 2 to 10 amino acids can be arranged between the transmembrane domain and the intracellular domain.
- a linker sequence having a glycine-serine continuous sequence can be used.
- the present invention provides a nucleic acid encoding the ROR-1 CARs.
- the nucleic acid encoding the CAR can be prepared from an amino acid sequence of the specified CAR by a conventional method.
- a base sequence encoding an amino acid sequence can be obtained from the aforementioned NCBI RefSeq IDs or accession numbers of GenBenk for an amino acid sequence of each domain, and the nucleic acid of the present invention can be prepared using a standard molecular biological and/or chemical procedure.
- a nucleic acid can be synthesized, and the nucleic acid of the present invention can be prepared by combining DNA fragments which are obtained from a cDNA library using a polymerase chain reaction (PCR).
- PCR polymerase chain reaction
- a nucleic acid encoding the CAR of the present invention can be inserted into a vector, and the vector can be introduced into a cell.
- a virus vector such as a retrovirus vector (including an oncoretrovirus vector, a lentivirus vector, and a pseudo type vector), an adenovirus vector, an adeno-associated virus (AAV) vector, a simian virus vector, a vaccinia virus vector or a sendai virus vector, an Epstein-Barr virus (EBV) vector, and a HSV vector can be used.
- a virus vector lacking the replicating ability so as not to self- replicate in an infected cell is preferably used.
- a suitable packaging cell based on a LTR sequence and a packaging signal sequence possessed by the vector can be selected for preparing a retrovirus particle using the packaging cell.
- the packaging cell include PG13 (ATCC CRL-10686), PA317 (ATCC CRL-9078), GP+E-86 and GP+envAm- 12, and Psi-Crip.
- a retrovirus particle can also be prepared using a 293 cell or a 293 T cell having high transfection efficiency.
- Many kinds of retrovirus vectors produced based on retroviruses and packaging cells that can be used for packaging of the retrovirus vectors are widely commercially available from many companies.
- a CAR-T cell binds to a specific antigen via the CAR, thereby a signal is transmitted into the cell, and as a result, the cell is activated.
- the activation of the cell expressing the CAR is varied depending on the kind of a host cell and an intracellular domain of the CAR, and can be confirmed based on, for example, release of a cytokine, improvement of a cell proliferation rate, change in a cell surface molecule, or the like as an index.
- release of a cytotoxic cytokine a tumor necrosis factor, lymphotoxin, etc.
- release of a cytokine or change in a cell surface molecule stimulates other immune cells, for example, a B cell, a dendritic cell, a NK cell, and a macrophage.
- the cell expressing the CAR can be used as a therapeutic agent for a disease.
- the therapeutic agent comprises the cell expressing the CAR as an active ingredient, and it may further comprise a suitable excipient.
- the inventors have generated ROR- 1 -ScFv-CD28-CD3 -CAR-T (ROR-1 -CAR-T) cells against solid tumor cancer cells overexpressing ROR-1 (ovarian, cervical cancer, and other cancer).
- the inventors have provided data demonstrating efficient expression of ROR- 1 in different types of cancer.
- ROR-1 -CAR-T cells express higher cytotoxic activity against ROR-1 -positive cancer cells than against non-transduced T cells and Mock-CAR-T cells.
- the advantage of this antibody versus mouse monoclonal or humanized antibodies is that it is a full human sequence that will not generate an immune response against antibody sequence in patients.
- the present human monoclonal anti-human ROR-1 antibody detects ROR-1 in ROR- 1 -positive cancer cells.
- the present ROR-1 antibody can be used for immunotherapy applications: toxin/drug- conjugated antibody, monoclonal therapeutic antibody, humanization of ROR-1 antibody, and CAR-T cell immunotherapy.
- ROR-l-CAR-T cells using the present ROR-1 antibody can be effectively used to target ROR-1 antigen in ROR-1 -positive cell lines.
- ROR-l-CAR-T can be used in combination with different therapeutic agents: checkpoint inhibitors; targeted therapies, small molecule inhibitors, antibodies.
- ROR-1 antibody can be modified with site-directed mutagenesis for affinity tuning.
- ROR-l-CAR-T cells can be used clinically for ROR-1 -positive cells.
- Third generation CAR-T or other co-activation signaling domains can be used for the same ROR-1 -scFv inside CAR.
- ROR-1 with other CAR targeting other tumor antigens or tumor microenvironment (VEGFR-1 -3), PDL-1, CD80 or bi-scFv-CAR can be used to enhance activity of monotherapy ROR-l-CAR.
- Bi-specific antibodies with ROR-1 and CD3 or other antigens can be generated for therapy.
- ROR-l-CAR-T cells can be used against cancer stem cells that are resistant against chemotherapy and form aggressive tumors.
- ROR-l-CAR can be used for generating other types of cells such as CAR-natural killer (NK) cells, iPS (induced pluripotent)-NK or iPS-T cells, ROR-1 -CAR-macrophages, and other ROR-l-CAR hematopoietic cells, which can target ROR-1 -positive cancers.
- the present invention provides T cells, or NK cells, or macrophages, or hematopoietic cells, modified to express the ROR-l-CAR.
- ROR1-CAR can be used both for autologous cells and allogenic hematopoietic cells.
- the following examples further illustrate the present invention. These examples are intended merely to be illustrative of the present invention and are not to be construed as being limiting.
- the inventors generated ROR-1 CAR constructs inside lenti viral vector cloned into the lentiviral vector with either EF1 or MNDU3 promoters to drive expression of CAR.
- Three CAR constructs were prepared.
- the CAR constructs were inside lentiviral vector and had either Amp resistance gene or kanamycin resistance gene as a marker.
- CAR PMC 167 used EF1 promoter and Amp resistance gene, and had CD28 domain.
- CAR PMC869 used MNDU3 promoter and AMP resistance gene, and had 4-1BB domain.
- CAR PMC870 used MNDU3 promoter and kanamycin resistance gene, and had 4-1 BB domain.
- the lenti viruses were generated in 293 T cells and titer was established by RT-PCR. Then equal dose of lentiviruses was used for transduction of T cells, as described in Examples.
- Example 1. ROR-1 antibody detects ROR-1 protein by ELISA and FACS staining
- the human antibody ROR-1, clone B2 detected extracellular ROR-1 protein by ELISA in a dose-dependent manner ( Figure 3).
- the antibody is IgGl type and detects ROR-1 extracellular domain.
- the antibody detected ROR-1 in both hematological cancer cell lines such as Raji, Molt-4, RPMI 8226, lymphoblastic leukemia CEM, leukemia HL-60, and in solid cancer cell lines such as cervical Hela, breast MCF-7, and ovarian SKOV-3 cancers (FACS data not shown).
- ROR-1 antibody clone B2.
- the sequence of VH and VL and ScFv are shown below.
- the structure of ROR-1 scFv is: VH-linker-VL.
- Linker is G4Sx3.
- the bold shows the nucleotide sequence; the underlined shows the nucleotide sequence of V L ; in between (shown in italics font) is the nucleotide sequence encoding a linker.
- ROR-1 scFv nucleotide sequence (SEQ ID NO: 1)
- ROR-1 scFv amino acid sequence (SEQ ID NO: 2) QVQLQESGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHS GSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARGHSSGWYRRYF DLWGRGTLVTVSSGGGGjtGGGG ⁇ GGGG ⁇ EIVLTOSPATLSLSPGERATLSCRASOSV
- VL EIVLTOSPATLSLSPGERATLSCRASOSVSSYLAWYOOKPGOAPRLLIYDASNRATGIP
- the linker sequence is 3xG4S (SEQ ID NO: 5): G G G G S G G GG S G G GG S Example 3A.
- ROR-l-CAR Sequences CD28 as Co-Stimulating Domain
- ROR-l-CAR construct PMC 167) is shown on Figure 2.
- Lentiviral vector Lenti CMV-MCS-EF 1 a-puro was used for cloning of ROR-l-CAR sequence.
- the following nucleotide sequence and amino acid sequences show ROR-1 ScFv - CDS hinge-TM28-CD28-CD3 zeta of the present invention.
- the structure includes Human CDS signaling peptide, human ROR-1 scFv (Vu-Linker 3x(G4S) -VL), human CDS hinge, human CD28 transmembrane, human CD28 co-stimulatory, CD3 zeta domains ( Figure 2).
- ROR-1 scFv Vn-Linker -VL>CD8 hinge CD28 TM.
- CD28-CD3-zeta CD28-CD3-zeta:
- Amino-acid sequence (SEQ ID NO: 7): MALPVTALLLPLALLLHAARP
- Nucleotide Sequence (SEQ ID NO: 10): TTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAA CAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAG TGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAG CCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCC Amino-acid sequence (SEQ ID NO: 11):
- Example 3 A Similar to Example 3 A, we also generated CAR with 41BB costimulatory domain.
- Lentiviral vector Lenti CMV -MC S -MNDU 3 -puro was used for cloning of ROR-l-CAR sequence.
- the following nucleotide sequence and amino acid sequences show ROR-1 ScFv - CDS hinge-IM28-4-lBB-CD3 zeta of the present invention.
- the structure includes Human CDS signaling peptide, human ROR-1 scFv (Vn-Linker 3x(G4S) -V L ), human CDS hinge, human CD28 transmembrane, co-stimulating domains human 4- IBB, CD3 zeta ( Figure 2).
- the only difference between the CAR sequences of Examples 3 A and 3B is the costimulating domain: Example 3 A has CD28 sequence, and Example 3B has 4- IBB sequence.
- the lenti viruses were produced by the standard procedure using 293 cells as described in
- PBMC peripheral blood mononuclear cells
- Isolated PBMC were washed with once lxPBS (pH7.4), no Ca 2+ /Mg 2-h ), and in CAR- T media (AIM V-AlbuMAX(BSA) (Life Technologies), with 5% AB serum and 1.25 pg/mL amphotericin B (Gemini Bioproducts, Woodland, CA), 100 U/mL penicillin, and 100 pg/mL streptomycin), in the absence of human interleukin-2 (huIL-2)(Invitrogen), at a concentration of 5 x 10 s cells/mL, then resuspended to a final concentration of 5x10 s cells/mL in CAR-T medium with 300U/mL huIL2 (from a lOOOx stock; Invitrogen).
- PBMC and beads were then mixed at a 1 : 1 bead-to-cell ratio, by transferring 25 uL of beads to 1 mL of PBMC, and incubated at 37°C in the presence of C02 for 24 hours before viral transduction. Addition of beads activated T cells before addition of virus.
- PBMC peripheral blood mononuclear cells
- 5xl0 6 lentivirus were added to T cells atMOI 10:1, and 2 pL/mL of media of Transplus (Alstem, Richmond, CA) (a final dilution of 1:500). Cells were incubated for an additional 24 hours before repeating addition of virus. Cells were then grown in the presence of 300 U/mL of 1L-2 for a period of 12-14 days (total incubation time was dependent on the final umber of CAR-T cells required). Cells concentrations were analyzed every 2-3 days, with media being added at that time to dilute the cell suspension to lxlO 6 cells/ml.
- FACS buffer Phosphate-buffered saline (PBS) plus 0.1% sodium azide and 0.4% BSA. Cells were then divided at lxlO 6 aliquots.
- the cytotoxicity was performed using ACEA machine according to manufacturer’s protocol as described [6],
- ROR-l-CAR cells (PMC 167) were effectively expanded in vitro (not shown). Mock control with ScFv from intracellular protein were generated and used as a negative control in cytotoxicity and cytokine assay.
- the ROR-1-CAR+ cells were detected by FACS with biotinylated goat anti-human Fab’2 and then stained with phycoerythrin-conjugated streptavidin; the staining was higher in ROR-l-CAR-T cells than in T cells with no CAR+ expression ( Figure 4). Thus, transduction of lentiviral ROR-1 resulted in expression of ROR- 1-CARscFv.
- Example 11 ROR-l-CAR-T cells expressed high cytotoxic activity against ROR-1- positive cancer cells.
- the cytotoxicity assay was performed using RTCA impedance-based assay according to manufacturer’s conditions.
- ROR-1-CD28-CD3 CAR-T cells PMC167
- killed ROR-1 positive SKOV-3 ovarian solid tumor cells not shown
- HCT116, HT29, Lovo-1 colon cancer cells Figure 5
- the integrity of the target cell monolayer was continually monitored via its impedance in a weak electrical field; killing of the target cells by the CAR-T cells decreased the monolayer’s integrity and, therefore, its impedance decreased.
- PMC167-transduced cells were added to the target cells at effectontarget (E:T) ratios of 10:1 and 3 :1; at both ratios, the PMC167 cells caused a sustained decrease in target cell monolayer impedance.
- E:T effectontarget
- Calculation of cytotoxicity at the end of the assay indicated that the PMC167-transduced cells were significantly more cytotoxic than the control T cells at both E:T ratios ( Figure 5).
- Approximately 80% of the target cells were killed by the PMC167-transduced cells at the 10:1 ratio, despite the relatively low frequency of CAR-T cells in the PMC167 cultures.
- Example 14 ROR1-CAR T cells were cytotoxic.
- Figure 8 shows cytometric analysis of CAR expression.
- Non-transduced T cells and PMC 167, PMC 869 and PMC870 CAR-T cells were stained on day 10 with biotinylated goat anti-human Fab ’2 and then with phy coerythrin-conj ugated streptavidin (X-axis). The quantitation of staining frequency is shown on Y-axis.
- Figure 9 shows quantitation of cytotoxicity in the RTCA assay. Cytotoxicity was calculated at the end of the assay as (X-Y)*100/X, where X is the average impedance of the target cell monolayer in the absence of effector cells and Y is the average impedance of the target cell monolayer in the presence of effector cells.
- X is the average impedance of the target cell monolayer in the absence of effector cells
- Y is the average impedance of the target cell monolayer in the presence of effector cells.
- the p value for CAR-T cells vs T cells is ⁇ 0.0001 by 2-way ANOVA with Sidak’s post-hoc test.
- Figure 10 shows IFN-gamma production in response to RORl + tumor cells.
- Medium was collected from the 10:1 RTCA wells, centrifuged to remove cells and analyzed by ELISA for the levels of IFN-7.
- the p values for each of the CAR-T cell cultures vs T cells are ⁇ 0.0001 by 2-way ANOVA with Sidak’s post-hoc test.. All 3 CAR-T cell cultures produced significantly higher levels of IFN- ⁇ than the control T cells in response to each of the target cell lines at each E:T ratio. References
- T cells expressing chimeric antigen receptors can cause anaphylaxis in humans. Cancer Immunol Res 1, 26-31.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Cell Biology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Oncology (AREA)
- Zoology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Gastroenterology & Hepatology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Hematology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
Abstract
La présente invention concerne un anticorps anti-ROR-1 humain, ou un fragment variable monocaténaire (scFv), comprenant VH ayant la séquence d'acides aminés de SEQ ID No :
3 Et VL ayant la séquence d'acides aminés de SEQ ID No : 4. La présente invention concerne en outre un récepteur antigénique chimérique (CAR) ROR-1 comprenant, de l'extrémité N-terminale à l'extrémité C-terminale : (i) un fragment variable monocaténaire (scFv) de la présente invention, (ii) un domaine transmembranaire, (iii) au moins un domaine costimulateur, et (iv) un domaine d'activation. L'anticorps monoclonal de la présente invention présente une liaison sélective et à haute affinité à l'égard de ROR-1.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202180002060.5A CN115443140A (zh) | 2020-04-02 | 2021-04-01 | 人ror-1抗体和抗ror-1-car-t细胞 |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202063004214P | 2020-04-02 | 2020-04-02 | |
US63/004,214 | 2020-04-02 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2021202863A1 true WO2021202863A1 (fr) | 2021-10-07 |
Family
ID=77929676
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2021/025355 WO2021202863A1 (fr) | 2020-04-02 | 2021-04-01 | Anticorps de ror-1 humain et lymphocytes car-t anti-ror-1 |
Country Status (2)
Country | Link |
---|---|
CN (1) | CN115443140A (fr) |
WO (1) | WO2021202863A1 (fr) |
Cited By (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2023020423A1 (fr) * | 2021-08-19 | 2023-02-23 | Shandong Boan Biotechnology Co., Ltd. | Cellules car t double ror1/cd19 ou car ror1 pour traiter des tumeurs |
WO2023077026A1 (fr) | 2021-10-28 | 2023-05-04 | Lyell Immunopharma, Inc. | Procédés de culture de cellules exprimant une protéine de liaison à ror1 |
WO2024064952A1 (fr) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Procédés de culture de cellules déficientes en nr4a surexprimant c-jun |
WO2024064958A1 (fr) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Procédés de culture de cellules déficientes en nr4a |
WO2024077174A1 (fr) | 2022-10-05 | 2024-04-11 | Lyell Immunopharma, Inc. | Procédés de culture de cellules déficientes en nr4a |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20120058906A1 (en) * | 2008-11-07 | 2012-03-08 | Vaughn Smider | Combinatorial antibody libraries and uses thereof |
US20170121414A1 (en) * | 2015-11-03 | 2017-05-04 | Janssen Biotech, Inc. | Subcutaneous Formulations of Anti-CD38 Antibodies and Their Uses |
US20180371081A1 (en) * | 2009-09-25 | 2018-12-27 | Xoma (Us) Llc | Novel Modulators |
CN110590951A (zh) * | 2019-09-27 | 2019-12-20 | 安萌得医药科技(上海)有限公司 | 一种ror1单克隆抗体、制备方法及其应用 |
US20200291120A1 (en) * | 2019-02-11 | 2020-09-17 | Zumutor Biologics Inc. | Anti-clec2d antibodies and methods of use thereof |
US20210047419A1 (en) * | 2015-01-20 | 2021-02-18 | Igm Biosciences, Inc. | Tumor necrosis factor (tnf) superfamily receptor binding molecules and uses thereof |
-
2021
- 2021-04-01 WO PCT/US2021/025355 patent/WO2021202863A1/fr active Application Filing
- 2021-04-01 CN CN202180002060.5A patent/CN115443140A/zh active Pending
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20120058906A1 (en) * | 2008-11-07 | 2012-03-08 | Vaughn Smider | Combinatorial antibody libraries and uses thereof |
US20180371081A1 (en) * | 2009-09-25 | 2018-12-27 | Xoma (Us) Llc | Novel Modulators |
US20210047419A1 (en) * | 2015-01-20 | 2021-02-18 | Igm Biosciences, Inc. | Tumor necrosis factor (tnf) superfamily receptor binding molecules and uses thereof |
US20170121414A1 (en) * | 2015-11-03 | 2017-05-04 | Janssen Biotech, Inc. | Subcutaneous Formulations of Anti-CD38 Antibodies and Their Uses |
US20200291120A1 (en) * | 2019-02-11 | 2020-09-17 | Zumutor Biologics Inc. | Anti-clec2d antibodies and methods of use thereof |
CN110590951A (zh) * | 2019-09-27 | 2019-12-20 | 安萌得医药科技(上海)有限公司 | 一种ror1单克隆抗体、制备方法及其应用 |
Non-Patent Citations (1)
Title |
---|
M. HUDECEK, M.-T. LUPO-STANGHELLINI, P. L. KOSASIH, D. SOMMERMEYER, M. C. JENSEN, C. RADER, S. R. RIDDELL: "Receptor Affinity and Extracellular Domain Modifications Affect Tumor Recognition by ROR1-Specific Chimeric Antigen Receptor T Cells", CLINICAL CANCER RESEARCH, ASSOCIATION FOR CANCER RESEARCH, vol. 19, no. 12, 15 June 2013 (2013-06-15), pages 3153 - 3164, XP055177780, ISSN: 10780432, DOI: 10.1158/1078-0432.CCR-13-0330 * |
Cited By (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2023020423A1 (fr) * | 2021-08-19 | 2023-02-23 | Shandong Boan Biotechnology Co., Ltd. | Cellules car t double ror1/cd19 ou car ror1 pour traiter des tumeurs |
WO2023077026A1 (fr) | 2021-10-28 | 2023-05-04 | Lyell Immunopharma, Inc. | Procédés de culture de cellules exprimant une protéine de liaison à ror1 |
WO2024064952A1 (fr) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Procédés de culture de cellules déficientes en nr4a surexprimant c-jun |
WO2024064958A1 (fr) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Procédés de culture de cellules déficientes en nr4a |
WO2024077174A1 (fr) | 2022-10-05 | 2024-04-11 | Lyell Immunopharma, Inc. | Procédés de culture de cellules déficientes en nr4a |
Also Published As
Publication number | Publication date |
---|---|
CN115443140A (zh) | 2022-12-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11472884B2 (en) | Humanized BCMA antibody and BCMA-CAR-T cells | |
WO2021202863A1 (fr) | Anticorps de ror-1 humain et lymphocytes car-t anti-ror-1 | |
US11725053B2 (en) | Chimeric antigen receptors comprising a human transferrin epitope sequence | |
US20220356262A1 (en) | Humanized bcma antibody and bcma-car-t cells | |
US20220220201A1 (en) | Cs1 antibody and anti-cs1-car-t cells | |
US11932703B2 (en) | Anti-ROR1 antibody and ROR1-targeting engineered cells | |
WO2020180551A1 (fr) | Cellules car-t ayant cd19 scfv humanisé | |
US20210347909A1 (en) | Epcam antibody and epcam-car-t cells | |
US20210340271A1 (en) | Cd37-antibody and cd37-car-t cells | |
US20230303708A1 (en) | Humanized bcma antibody and bcma-car-t cells | |
US20230279140A1 (en) | HUMANIZED CD37 AND Bl-SPECIFIC CD19-HUMANIZED CD37 CAR-T CELLS | |
CN116082507B (zh) | 人源化bcma抗体和bcma-car-t细胞 | |
WO2024114691A1 (fr) | Lymphocytes t-car cs1 humains | |
WO2023000170A1 (fr) | Anticorps cd147 et cellules cd147-car-t | |
US20240239918A1 (en) | Anti-ror1 antibody and ror1-targeting engineered cells |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21779341 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 21779341 Country of ref document: EP Kind code of ref document: A1 |