WO2021173879A1 - Identification of biomimetic viral peptides and uses thereof - Google Patents

Identification of biomimetic viral peptides and uses thereof Download PDF

Info

Publication number
WO2021173879A1
WO2021173879A1 PCT/US2021/019739 US2021019739W WO2021173879A1 WO 2021173879 A1 WO2021173879 A1 WO 2021173879A1 US 2021019739 W US2021019739 W US 2021019739W WO 2021173879 A1 WO2021173879 A1 WO 2021173879A1
Authority
WO
WIPO (PCT)
Prior art keywords
scaffold
binding
cov
amino acid
ace2
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/019739
Other languages
English (en)
French (fr)
Inventor
Andre Ronald WATSON
Alexander Izvorski
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ligandal Inc
Original Assignee
Ligandal Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ligandal Inc filed Critical Ligandal Inc
Priority to CN202180031498.6A priority Critical patent/CN115461068A/zh
Priority to CA3172878A priority patent/CA3172878A1/en
Priority to AU2021227918A priority patent/AU2021227918A1/en
Priority to JP2022550908A priority patent/JP2023514452A/ja
Priority to EP21760562.5A priority patent/EP4110366A4/en
Priority to IL295863A priority patent/IL295863A/en
Priority to KR1020227033145A priority patent/KR20220158723A/ko
Publication of WO2021173879A1 publication Critical patent/WO2021173879A1/en
Priority to US17/822,099 priority patent/US20230242592A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/215Coronaviridae, e.g. avian infectious bronchitis virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0014Skin, i.e. galenical aspects of topical compositions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/50Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
    • A61K9/51Nanocapsules; Nanoparticles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/102Coronaviridae (F)
    • C07K16/104Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/485Exopeptidases (3.4.11-3.4.19)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y304/00Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/17Metallocarboxypeptidases (3.4.17)
    • C12Y304/17023Angiotensin-converting enzyme 2 (3.4.17.23)
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B15/00ICT specially adapted for analysing two-dimensional [2D] or three-dimensional [3D] molecular structures, e.g. structural or functional relations or structure alignment
    • G16B15/20Protein or domain folding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/20011Coronaviridae
    • C12N2770/20021Viruses as such, e.g. new isolates, mutants or their genomic sequences
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/20011Coronaviridae
    • C12N2770/20034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • SARS-CoV-2 which causes COVID-19, is a global pandemic.
  • SARS-CoV-2 and other coronaviruses including MERS and SARS cause severe respiratory illnesses in humans and are believed to have a common origin in viruses that propagate in bats and rodents.
  • Some corona viruses with animal hosts have acquired mutations that extend their host range to include humans.
  • SARS-CoV-2 has mutated and expanded across the human species; a total of 214 haplotypes (i.e. sequence variations) and 344 different strains have been identified. Most of these variations, gained through mutation, recombination, and natural selection, have been found in the Spike (S) protein. Such variations may lead to even more infective and virulent strains.
  • a scaffold comprising a truncated peptide fragment from the binding domain of SARS-CoV-2 spike (S) protein or ACE2 receptor, wherein the scaffold substantially maintains the structure, conformation, and/or binding affinity of the native protein.
  • the scaffold has a size of between 40 and 200 amino acid residues.
  • the scaffold comprises two critical binding motifs from the CoV-2 spike protein binding interface.
  • the scaffold comprises two critical binding motifs from the ACE2 binding interface.
  • the two critical binding motifs are connected by a linker such as a GS linker.
  • the linker has a size of between 1 and 20 amino acid residues.
  • the scaffold comprises one or more modifications including an insertion, a deletion, and/or a substitution.
  • the scaffold further comprises one or more immuno-epitopes, one or more tags, one or more conjugatable domains, and/or a polar head or tail.
  • one or more scaffolds are connected via one or more linkers to form a multi-valent scaffold.
  • one or more scaffolds are attached to an immune-response eliciting domain such as an Fc domain (e.g., a human Fc domain or a humanized Fc domain) to form a fusion protein.
  • one or more scaffolds are attached to a substrate such as a nanoparticle or a chip.
  • one or more scaffolds are conjugated to another peptide or therapeutic agent.
  • compositions comprising one or more scaffolds, one or more conjugates, or one or more fusion proteins disclosed herein.
  • the composition further comprises one or more pharmaceutically acceptable carriers, excipients, or diluents.
  • the composition is formulated into an injectable, inhalable, oral, nasal, topical, transdermal, uterine, or rectal dosage form.
  • the composition is administered to a subject by a parenteral, oral, pulmonary, buccal, nasal, transdermal, rectal, or ocular route.
  • the composition is a vaccine composition.
  • a method of treating or preventing SAR- CoV-2 infection in a subject comprising administering to the subject a therapeutically effective amount of one or more scaffolds, one or more conjugates, one or more fusion proteins, or a composition comprising the one or more scaffolds, one or more conjugates, or one or more fusion proteins disclosed herein.
  • the subject is a mammal. In certain embodiments, the subject is human.
  • a method of blocking SAR-CoV-2 virus entry in a subject comprising administering to the subject a therapeutically effective amount of one or more scaffolds, one or more conjugates, one or more fusion proteins, or a composition comprising the one or more scaffolds, one or more conjugates, or one or more fusion proteins disclosed herein.
  • the subject is a mammal.
  • the subject is human.
  • a method of targeted delivery of one or more therapeutic agents comprising conjugating the one or more therapeutic agents to one or more scaffolds disclosed herein, and delivering the conjugate to a subject in need thereof.
  • a method of obtaining a scaffold that mimics the binding of the native protein from which the scaffold is derived.
  • the method entails the steps of producing a three-dimensional binding model of a first binding partner and a second binding partner, determining the binding interface on each binding partner based on the binding model, analyzing the binding interface to preserve the structure and/or conformation of each binding partner in its native, free or bound state, determining the critical binding residues based on thermodynamic calculation (AG), and determining the amino acid sequence of the binding interface of each binding partner to obtain the scaffold.
  • the three-dimensional binding is produced by a computer program such as SWISS-MODEL.
  • the three- dimensional binding is based on homology of either the first binding partner or the second binding partner to a protein of known sequence and/or structure.
  • the method further entails designing scaffolds of various conformations or folding states to fit with the corresponding binding partner.
  • Figure 1 shows the crystal structure of SARS-CoV-1 (PDBID 6CS2) bound to ACE2 (left) compared to simulated structure of SARS-CoV-2 bound to ACE2 (right).
  • Amino acid residues contributing positively to binding are shown in green, amino acid residues having about 0 AG are shown in yellow and repulsory amino acid residues (+AG) are shown in pink (left) or in orange (right).
  • Figure 2A shows the 3D structure of two previously published SARS-CoV-1 immuno-epitopes.
  • Figures 2B-2D show the 3D structure and the locations of the deduced CoV-2 immuno-epitopes based on homology to SARS-CoV-1 .
  • Figure 3 shows the MHC-I binding prediction results of immuno-epitopes.
  • FIG 4 shows the position of CoV-2 S protein antibody epitopes identified by others in the CoV-2 S protein (residues 15-1137 of SEQ ID NO:2 pictured).
  • the CoV-2 scaffold in the wildtype protein is double underlined.
  • the epitopes are shown in bold while the epitopes having high antigenicity scores are shown in bold and underlined.
  • Figure 5 shows the truncated CoV-2 S protein aligned to ACE2 and the locations of the antibody epitopes (magenta) and the ACE2 binding residues (green).
  • Figure 6 depicts three-dimensional molecular modeling of three representative linkers in the bound conformation.
  • the backbone is depicted as a blue coil.
  • Figure 7 A illustrates the binding of Scaffold #15 (SEQ ID NO:86) to residues 19-169 of ACE2 (SEQ ID NO: 140).
  • the B cell epitopes are shown in magenta, the T cell epitopes are shown in orange, and the ACE2 binding sites are shown in green.
  • Figure 7B illustrates that a modified CoV-2 scaffold having 59 amino acids (with 18 amino acids eliminated from the wildtype sequence) preserves the binding affinity to ACE2.
  • Figure 7C illustrates that a modified CoV-2 scaffold having 67 amino acids (with 10 amino acids eliminated from the wildtype sequence) preserves the binding affinity to ACE2.
  • the B cell antibody immuno-epitopic regions are shown in magenta, the T cell receptor binding, MHC-1 and MHC-2 loading regions are shown in orange, and the ACE2 binding regions are shown in green.
  • Figures 8A-8B show that S protein Scaffold #9 (SEQ ID NO:80) can be fitted to ACE2 (Figure 8A; residues 19-107 of ACE2 shown) to determine its ACE2 binding affinity and KD prediction based on computer modeling ( Figure 8B).
  • Figure 9A shows the computer modeling of CoV-1 (cyan) and CoV-2 (navy) bound to ACE2 (red) based on homology of CoV-1 and CoV-2.
  • Figure 9B shows the computer modeling of CoV-1 (cyan) bound to ACE2 (red).
  • Figure 9C shows the computer modeling of CoV-2 (navy) bound to ACE2 (red).
  • Figures 10A and 10B show the AG calculation to determine key binding residues for CoV-2 and CoV-1 , respectively.
  • Figures 11 A-11 B show the thermodynamic modeling of CoV-2 bound to ACE2, with the binding interface enlarged in Figure 11 B.
  • Figure 11 C shows two critical binding motifs determined for CoV-2: residues 437-455 (SEQ ID NO:65) and residues 473 to 507 (SEQ ID NO:66.
  • the amino acid residues having a negative AG, a positive AG, and about 0 AG are shown in green, orange, and yellow, respectively.
  • the backbone residues are shown in navy.
  • L455 and P491 are shown in magenta.
  • Figures 12A-12J illustrate the folding possibilities (centerO through center9 conformation shown in PyMOL) for CoV-2 Scaffold #1 having an amino acid sequence of SEQ ID NO:72.
  • Figure 13A shows the binding of centerO of CoV-2 Scaffold #9 (SEQ ID NO:80) with ACE2.
  • Figure 13B shows the binding of centerO and center9 of CoV-2 Scaffold #9 with ACE2.
  • Figures 13C-13D show chaotic assortment of center0-center9 of CoV-2 Scaffold #9 with ACE2, showing reasonable average folding and locations of all possible folding states given Heisenberg Uncertainty Principle.
  • Figure 13D shows the enlarged binding interface of Scaffold #9 and ACE2.
  • Figure 14A depicts a simulation of ACE2 bound to CoV-2 S protein.
  • Figures 14B-14D depict ACE2 Scaffold 1 (SEQ ID NO: 141) (purple), simulated via RaptorX, overlaid with wildtype hACE2 (red). The critical binding residues of ACE2 at the interface with the CoV-2 S protein are highlighted green.
  • Figure 15A shows computer modeling of ACE2 Scaffold 1 (SEQ ID NO: 141 truncated from the ACE2 protein.
  • Figure 15B depicts the molecular modeling of ACE2 Scaffold 1 (purple, with critical binding residues shown in green) with the CoV-2 S protein (blue, with antibody binding domains shown in teal arrow). The scaffold binds to the CoV- 2 S protein while preserving the presentation of antibody-binding immuno-epitopic regions of the S protein while bound.
  • Figure 15C depicts ACE2 Scaffold 1 bound to the CoV-2 S protein. ACE2 Scaffold 1 is not predicted to affect the immune binding domains (pink) of the CoV-2 S protein.
  • Figure 16A shows the binding to ACE2 by the Cryo-EM structure of CoV-2 S protein published by others
  • Figure 16B shows the binding to ACE2 by CoV-2 S protein based on SWISS-MODEL.
  • Figure 17A shows the simulated conformation with ACE2 using the structure published by others (top) and the computer simulated structure of this disclosure (bottom).
  • Figure 17B shows the comparison of the Cryo-EM structure of CoV-2 published by others (left) to the disclosed truncated and labeled SWISS-MODEL simulated structure (right).
  • the red dotted oval indicates the location of the missing residues from the Cryo-EM structure.
  • Purple regions indicate B cell immuno-epitopes determined by others, while orange regions indicate ACE2-repulsory regions, green regions indicate ACE2-binding regions, and yellow regions indicate ACE2-neutral regions as determined via PDBePISA.
  • Figure 18 shows that a custom-built peptide robot completed synthesis of a 9- amino acid MHC-1 loading epitope in about 24 minutes, allowing for rapid prototyping prior to commercial scale-up.
  • Figure 19A shows head-to-tail cyclization of the side chain protected peptide in solution by amide coupling using Scaffold #47 (“Ligandal-05,” SEQ ID NO: 118) as an example.
  • Figure 19B shows on resin head-to-tail cyclization by amide coupling using Scaffold #48 (“Ligandal-06,” SEQ ID NO: 119) as an example.
  • Figure 19C shows cyclization of purified linear thioester peptide by NCL using Scaffold #46 (“Ligandal-04,” SEQ ID NO:117) as an example.
  • FIGS 20A-20I are charts depicting biolayer interferometry of Scaffold #4 (“Peptide 1 ,” SEQ ID NO:75), Scaffold #7 (“Peptide 4,” SEQ ID NO:78), Scaffold #8 (“Peptide 5,” SEQ ID NO:79), and Scaffold #9 (“Peptide 6,” SEQ ID NO:80) associated with ACE2-biotin captured on streptavidin sensor tips (2.5 nm capture) to determine dissociation constant of the scaffolds to ACE2. All scaffolds exhibited potent inhibition of RBD binding to ACE2 at 10mM concentrations. As shown in Figures 20A-20D, a clear binding to ACE2 was observed for each scaffold with increasing concentrations (blank values were subtracted).
  • Figure 20E-20H a dose-response curve was also observed, whereby RBD was able to strongly associate with each sensor at 35 mM in the absence of peptide (green, top curve), and experienced a peptide-dose-response- dependent inhibition of binding (blue, cyan and red represent 10, 3 and 1 mM concentrations, respectively).
  • Figure 20I corresponds to RBD-biotin captured on streptavidin sensor tips (5 nm capture), and subsequently bound to ACE2.
  • Figures 21 A-21 F are charts depicting biolayer interferometry of the scaffolds associated with a neutralizing antibody captured on anti-human IgG (AFIC) sensor tips (1 nm capture) was used to determine dissociation constant of Scaffold #4 (“Peptide 1 ,” SEQ ID NO:75), Scaffold #7 (“Peptide 4,” SEQ ID NO:78), Scaffold #8 (“Peptide 5,” SEQ ID NO:79), and Scaffold #9 (“Peptide 6,” SEQ ID NO:80) to the neutralizing antibody ( Figures 21 A-21 D).
  • the dissociation constant of increasing concentrations of RBD was determined with anti-RBD neutralizing antibody (Figure 21 E).
  • Figure 21 F shows that 117 nM RBD was mixed with increasing concentrations of ACE2 prior to introduction to neutralizing antibodies bound to the sensors to demonstrate ACE2’s inhibition of neutralizing antibody binding to the RBD.
  • Figure 22 shows luminescence (RLU) of ACE2-HEK293 cells following SARS- CoV-2 spike infection at 60 hours post-infection when co-transfected with Scaffold #4 (“Peptide 1 ,” SEQ ID NO:75), Scaffold #7 (“Peptide 4,” SEQ ID NO:78), Scaffold #8 (“Peptide 5,” SEQ ID NO:79), and Scaffold #9 (“Peptide 6,” SEQ ID NO:80).
  • Control groups included untransfected ACE2-HEK293 cells (no virus) and ACE2-HEK293 cells transfected with the SARS-CoV2 spike protein.
  • Figures 23A-23D show luminescence (RLU) in ACE2-HEK293 cells transfected with the SARS-CoV-2 spike protein or no virus (control) and Scaffold #8 (“Peptide 5,” SEQ ID NO:79) ( Figure 23A), soluble ACE2 ( Figure 23B), soluble receptor binding domain (RBD) of the SARS-CoV-2 spike protein ( Figure 23C), and a SARS-CoV-2 neutralizing antibody (neuAb) ( Figure 23D).
  • RLU luminescence
  • FIG. 24A shows that Scaffold #4 (“LGDL_NIH_001 SEQ ID NO:75), Scaffold #7 (“LGDL_NIH_004,” SEQ ID NO:78), Scaffold #8 (“LGDL_NIH_005,” SEQ ID NO:79), and Scaffold #9 (“LGDL_NIH_006,” SEQ ID NO:80) exhibited over 90% inhibition of viral load (EC90) in live virus at micromolar concentrations.
  • Figure 24B shows that the scaffolds tested in Figure 24A were not toxic at the effective concentrations.
  • Figure 25 depicts three-dimensional molecular modeling of Scaffold #4 (“Peptide 1,” SEQ ID NO:75 based on a 180ns run (single trajectory) in OpenMM starting from the native-like conformation.
  • Figure 26 is a chart plotting Rosetta score (REU) of Scaffold #4 (SEQ ID NO:75 at indicated timepoints.
  • Figures 27A and 27B are diagrams of epitopes on the S protein that are only exposed during fusion.
  • Figures 28A and 28B are diagrams of binding sites which would prevent the process from moving to the next step of neutralizing.
  • Figure 28C shows the enlarged binding site.
  • Figures 29A and 29B depict three-dimensional molecular modeling of the sequence KMSECVLGQSKRV (SEQ ID NO:8) (shown in red) fitted to the SARS- CoV-2 spike protein (green).
  • SEQ ID NO:8 corresponds to one of the binding sites identified in Figures 27-28 located in the hinge between heptad repeat (FIR) 1 (FHR1 ) and HR2 during the pre-bundle stage.
  • FIR heptad repeat
  • Figure 30 depicts a diagram for extein insertion placement.
  • Figures 31 A-31 D are diagrams generated during peptide screening and optimization.
  • Figures 32A-32B show sequence alignments of representative SARS-CoV-2 S protein scaffolds disclosed herein. Alignment shows amino acid residues 433-511 of SEQ ID NO:2. Critical binding motifs are underlined. Substitutions are double underlined and highlighted yellow. GS linkers are bolded and highlighted blue. Epitopes for B cell and T cell binding are bolded, italicized, and highlighted green. EPEA C-tags are italicized and highlighted gray. Poly charged N- and C-terminal residues are squiggly underlined and highlighted pink. Alternative TCR epitopes are highlighted red.
  • Figures 33A-33E illustrate the siRNA designing process using the IDT siRNA design tool, including the locations and sequences of the selected sense and anti-sense strands (SEQ ID NOs: 143-148).
  • Figure 34 depicts a three-dimensional simulation model of SARS-CoV-1 bound to angiotensin-converting enzyme 2 (ACE2) (PDB ID 6CS2; red) to approximate the binding interface of the SWISS-MODEL simulated SARS-CoV-2 (left); and selected MHC-I and MFHC-II epitope regions for inclusion in Scaffold #8) (pink) represent P807-K835 and A1020-Y1047 in the S1 spike protein.
  • the model on the right depicts the receptor-binding domain (RBD) of the SARS-CoV-2 spike protein (blue/multi-colored) simulated binding with ACE2 (red).
  • RBD receptor-binding domain
  • the simulation model identifies predicted thermodynamically favorable (green), neutral (yellow), and unfavorable (orange) interactions. Outer bounds of amino acids used to generate the scaffold (V433 - V511 ) are shown in cyan on the right.
  • Figure 35 depicts a three-dimensional simulation model of the ACE2 receptor (red) aligned with Scaffold #4, #7, #8, and #9 (top, from left to right). Multiple folding states for Peptide 5 are shown in simulated binding to ACE2 (bottom). Predicted binding residues are indicated in green (top and bottom).
  • Figure 36 shows SARS-CoV-2 genomic sequence (SEQ ID NO: 1 ).
  • Nucleotides 21536-25357 (underlined) encode S protein of SEQ ID NO:2.
  • Nucleotides 26218-26445 double underlined encode envelope protein of SEQ ID NO:3.
  • Figure 37 shows the amino acid sequence of SARS-CoV-2 spike (S) protein (SEQ ID NO: 2).
  • Figure 38 shows the amino acid sequence of ACE2 (SEQ ID NO: 140).
  • the sequences of the S protein that are most likely to expand the host range and increase the stability of SARS-CoV-2 in the human population through natural selection can be predicted.
  • a computational pipeline is developed to estimate the mutation landscape of the SARS-CoV-2 S protein.
  • the predicted sequences are experimentally engineered and their binding to the human receptor ACE2 is measured using biochemical assays and cryo-electron microscopy.
  • Novel mathematical approaches inspired by the structure of genetic algorithms, are developed for the identification of highly probable sequences of the SARS- CoV-2’s S-protein. More specifically, the disclosed approach incorporates descriptors from graph theory, topological data analysis, and computational biophysics into a new machine learning framework that combines neural networks and genetic algorithms. This powerful interdisciplinary approach allows the use of existing data from SARS-CoV-2 to uncover a few candidate sequences that are most likely to occur in the evolution of its viral S-protein. These results are experimentally validated by generating peptides from the obtained sequences. The resulting pipeline provides new solution to better understand the mutation landscape of viral proteins.
  • peptide sequence e.g., the SARS-CoV-2 spike protein
  • optimized peptide scaffolds designed using these methods, formulations comprising these peptide scaffolds, and methods of using these peptide scaffolds and formulations to competitively inhibit viral proteins or treat viral infection, and the use of these peptide scaffolds and formulations as vaccines to prevent viral infection.
  • the disclosed vaccine approach provides a fully synthetic scaffold for mimicking T-cell receptor and antibody binding epitopes, which can be rapidly custom-tailored to new mutant forms of a virus.
  • the synthetic scaffold can serve as a targeting ligand mimicking viral entry to target diseased cells and tissues with therapeutic agents.
  • mini viral scaffolds can be synthesized in hours, and rapidly scaled to a scale of over 100 kg to meet global needs.
  • scaffolds provided herein may separately be used in place of small molecules for inhibiting binding cleft interactions.
  • the scaffolds disclosed herein are peptides generated by modeling off the SARS-CoV-2 spike protein receptor binding motif (RBM) conserved motifs, and have the potential utility as a prophylactic, immune-stimulant, and therapeutic agent against the virus. Therefore, also disclosed herein are compositions comprising one or more scaffolds, which can be used for: 1) inhibiting ACE2-spike interaction and viral entry into ACE2-expressing cells, 2) promoting binding to neutralizing antibodies without competitively displacing neutralizing antibody binding to the RBD; and/or 3) preventing soluble ACE2 association with the RBD.
  • RBM SARS-CoV-2 spike protein receptor binding motif
  • peptide scaffolds designed to block viral binding to cells expressing ACE2, while also stimulating an immune response and promoting exposure of the spike protein for recognition by the immune system.
  • a biomimetic virus decoy peptide technology is developed to compete for binding with cells and expose the virus for binding to neutralizing antibodies.
  • this disclosure relates to methods of computer-assisted three- dimensional (3D) modeling to investigate protein-protein interactions. These methods entail producing a 3D model of a first binding partner and a second binding partner, determining the amino acid sequence, the 3D structure, and the conformation of the interface of each binding partner, truncating the binding interface of each binding partner while maintaining the 3D structure of each to obtain a scaffold representing each binding partner, determining the binding affinity of each amino acid residue in the scaffold based on calculation of thermodynamic energy of each residue, and determining the location and sequence of critical binding motifs in the scaffold.
  • the 3D model is produced with SWISS-MODEL based on protein sequence homology to the first binding partner or the second binding partner.
  • modifications can be made to the scaffold to maintain or improve the structure, conformation, and binding affinity of the scaffold. These modifications include but are not limited to insertions, deletions, or substitutions of one or more amino acid residues in the scaffold.
  • various linkers, conjugatable domains, and/or immuno-epitopes can be added to the scaffold to obtain multi-functional scaffolds.
  • one or more amino acids that are not critical for binding can be deleted or substituted.
  • the binding partners are SARS-CoV-2 S protein and ACE2.
  • the S protein has the amino acid sequence set forth in SEQ ID NO:2.
  • the S protein is a variant, including but not limited to B.1.1.7 variant (SEQ ID NO:137), B.1.351 variant (SEQ ID NO: 138), or P.1 variant (SEQ ID NO: 139).
  • Other variants of coronavirus can be found at nextstrain.org/ncov/global.
  • ACE2 has the amino acid sequence set forth in SEQ ID NO: 140.
  • the term “scaffold” means a continuous stretch of amino acid sequence located at the binding interface of a binding partner and involved with binding to the other binding partner.
  • the scaffold has a size of less than about 120 amino acid residues, less than about 110 amino acid residues, less than about 100 amino acid residues, less than about 90 amino acid residues, less than about 80 amino acid residues, less than about 70 amino acid residues, less than about 60 amino acid residues, or less than 50 amino acid residues.
  • the scaffold maintains the 3D structure and/or conformation of the native, free, or bound state of the protein from which its binding sequence(s) is derived.
  • the scaffold may be designed to maintain an a-helix and/or b sheet structure when truncated from a wildtype protein sequence.
  • the scaffold may comprise one or more modifications such as insertions, deletions, and/or substitutions, provided those modifications do not substantially decrease, and in some embodiments actually increase, binding affinity of the scaffold to its binding partner.
  • the protein sequence of the SARS-CoV-2 spike protein was compared to SARS coronavirus protein sequence (PDB ID 6CS2) to produce a 3D model of CoV-2 binding to ACE2 ( Figure 1).
  • the binding interface of each of CoV-2 and ACE2 was investigated to determine a stretch of amino acid residues involved in binding. This stretch of amino acid sequence may be truncated from the remaining protein sequence, and the structure and/or conformation of this stretch of amino acid sequence is maintained to simulate that of the native protein in free or bound state, thereby to obtain the CoV-2 scaffold or the ACE2 scaffold of this disclosure.
  • a CoV-2 scaffold which has an amino acid sequence at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of residues 433-511 of SEQ ID NO:2
  • the CoV-2 scaffold has an amino acid sequence at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence:
  • amino acid residues in the CoV-2 S protein backbone are shown in plain letters (including 433V-436W, F456-I472, and Y508-V511), amino acid residues having a AG of about 0, which are neutral in binding, are underlined (including N437, S438, N440-K444, G447, N448, N450-L452, R454, S477-V483, G485, C488, P491 , L492, F497, G504, and P507), amino acid residues having a negative AG, which are critical binding residues, are shown in bold (including N439, Y449, Y453, Q474, E484, N487, Q493-Y495, Q498, P499, N501 , and Q506), and amino acid residues having a positive AG, which are repulsory residues, are shown in italicized (including V445, G446, L455, Y473, A
  • one CoV-2 scaffold of this disclosure comprises a first critical binding motif comprising residues 437 to 455 of SEQ ID NO: 2, a second critical binding motif comprising residues 473 to 507 of SEQ ID NO: 2, and a backbone region comprising residues 456 to 472 of SEQ ID NO: 2.
  • the first and second critical binding motif directly interact with ACE2 on the binding interface, while the backbone region comprises amino acid residues that do not directly interact with ACE2.
  • the CoV-2 scaffold may further comprise one or more amino acids from the CoV-2 S protein backbone at the N-terminus, the C-terminus, or both, to achieve a desired size.
  • the CoV-2 scaffold comprises from about 40 to about 200 amino acid residues, from about 50 to about 100 amino acid residues, from about 55 to about 95 amino acid residues, from about 60 to about 90 amino acid residues, from about 65 to about 85 amino acid residues, from about 70 to about 80 amino acid residues.
  • the CoV-2 scaffold comprises about 50 amino acid residues, about 55 amino acid residues, about 60 amino acid residues, about 65 amino acid residues, about 70 amino acid residues, about 75 amino acid residues, about 80 amino acid residues, about 85 amino acid residues, about 90 amino acid residues, about 95 amino acid residues, or about 100 amino acid residues.
  • the size of the CoV-2 scaffold can vary, and certain modifications such as insertions, deletions, and/or substitutions can be incorporated, the scaffold maintains the structure and/or conformation of its native state with regard to the ACE2 binding interface. Preservation of this structure and/or conformation allows the scaffold to bind ACE2 with the same or greater affinity than the full-length S protein despite its truncation. For example, the b sheet structure is maintained and can be stabilized by further modifications.
  • the CoV-2 scaffold comprises L455C and P491 C substitutions such that a disulfide bond is formed between location 455 and location 491 to stabilize the b sheet structure.
  • the CoV-2 scaffold comprises one or more mutations to replace one or more of the existing Cys residues such that the only Cys residues remaining are the ones introduced at locations 455 and 491 to avoid any undesirable interference of formation of a disulfide bond.
  • Cys can be substituted with Gly, Ser, or any other residue as long as the substitution does not compromise the binding affinity to ACE2.
  • Some examples of replacing Cys residues include but not limited to C480G, and C488G.
  • the CoV-2 scaffold disclosed herein may further comprise a loop to connect the N-terminal residue and the C-terminal residue using a linker such as an amine-carboxy linker to obtain a head-to-tail cyclized scaffold.
  • cyclization of the scaffold provides increased stability with lower free energy, enhanced folding, binding, or conjugation to a substrate, and/or enhanced solubility.
  • the loop does not directly interact with the scaffold’s binding partner.
  • the loop allows the scaffold to be attached to an siRNA payload or other substrates.
  • the loop comprises 1-200 amino acid residues. In certain embodiments, the loop comprises less than about 150 amino acid residues.
  • the loop comprises 9-15 Arg and/or Lys residues.
  • the loop comprises a conjugatable domain such as maleimide or other linkers to conjugate the scaffold to a substrate or a poly amino acid chain.
  • the loop comprises one or more immune-activating poly amino acid chain or immune-reactive glycan.
  • the N-terminus and C-terminus can also be connected by forming a disulfide bond, any other appropriate linker (flexible or rigid), click chemistry, PEG, polysarcosine, or bioconjugated.
  • the peptides may be cyclized, stabilized, linear, otherwise click- chemistry or bioconjugated, or substituted with non-natural amino acids, peptoids, glycopeptides, lipids, cholesterol moieties, polysaccharides, or anything that enhances folding, binding, solubility, or stability.
  • an ACE2 scaffold which is at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least
  • the ACE2 scaffold is at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least
  • an ACE2 scaffold of this disclosure comprises a first critical binding motif comprising amino acid residues 19 to 42 of SEQ ID NO: 140, a second critical binding motif comprising residues 64 to 84 of SEQ ID NO: 140, and a backbone region comprising residues 43 to 63 of SEQ ID NO: 140.
  • the first and second critical binding motif directly interact with CoV-2 S protein on the binding interface, while the backbone comprises amino acid residues on the backbone of ACE2 and does not directly interact with CoV-2 S protein.
  • the ACE2 scaffold comprises a linker (shown in bold) connecting the two critical binding motifs, see for example, ACE2 Scaffold 1 (SEQ ID NO:141):
  • the ACE2 scaffold further comprises an EPEA C-tag (underlined), see for example, ACE Scaffold 2 (SEQ ID NO: 142):
  • the ACE2 scaffold may further comprise one or more amino acids or monomeric units from the ACE2 protein backbone or recreating the binding effect of ACE2 at the appropriate interface with the spike protein as derived from ACE2’s N-terminus, the C-terminus, or both, to achieve a desired size, folding and affinity.
  • the ACE2 scaffold comprises from about 10 to about 200 amino acid residues, from about 50 to about 100 amino acid residues, from about 55 to about 95 amino acid residues, from about 60 to about 90 amino acid residues, from about 65 to about 85 amino acid residues, from about 70 to about 80 amino acid residues.
  • the ACE2 scaffold comprises about 50 amino acid residues, about 55 amino acid residues, about 60 amino acid residues, about 65 amino acid residues, about 70 amino acid residues, about 75 amino acid residues, about 80 amino acid residues, about 85 amino acid residues, about 90 amino acid residues, about 95 amino acid residues, or about 100 amino acid residues.
  • the size of the ACE2 scaffold can vary, and certain modifications such as insertions, deletions, and/or substitutions can be incorporated, the scaffold maintains the structure and/or conformation of its native state with regard to the CoV-2 S protein binding interface. Preservation of this structure and/or conformation allows the scaffold to bind the S protein with the same or greater affinity than the full-length ACE2 protein despite its truncation.
  • the N-terminus, C-terminus, or both termini of the ACE2 scaffold are modified with any number of bioconjugation motifs, linkers, spacers, tags (such as his-tag and C-tag) etc.
  • one or more amino acids that are not critical for binding to CoV-2 S protein are deleted or substituted.
  • Additional scaffolds can be designed to mimic ACE2 binding to the CoV-2 S protein. These ACE2 scaffolds can bind to the CoV-2 virus to coat the virus such that the virus is unable to bind to ACE2 thereby to inhibit viral entry into human (or other hosts) body. Moreover, an ACE2 scaffold can be further modified to include, for example, a fragment crystallizable (Fc) domain or an alternate domain that serves to activate an immune response.
  • Fc fragment crystallizable
  • ACE2 Scaffold 1 (SEQ ID NO: 141), comprising a first critical binding motif, a second critical binding motif, and a linker connecting the critical binding motifs, is predicted to have a higher affinity for the CoV-2 S protein than wildtype ACE2. Additionally, in contrast to ACE2, which binds to CoV-2 S protein and blocks the immuno-epitopic region of CoV-2 S protein, ACE2 Scaffold 1 is not expected to affect the immune binding domains of the CoV-2 S protein and allows the immune system to identify the CoV-2 virus. Similar to other scaffolds provided herein, ACE2 Scaffold 1 may be provided in a nanoparticle or other suitable substrate and may act to aggregate the virus.
  • the N- or C- termini may be modified with any number of bioconjugation motifs, linkers, spacers, and the like; and may have various substrates including buckyballs (e.g., C60/C70 fullerenes), branched PEGs, hyper-branched dendrimers, single-walled carbon nanotubes, double- walled carbon nanotubes, KLH, OVA, and/or BSA.
  • ACE2 Scaffold 1 is predicted to have a higher affinity for the virus spike proteins than free ACE2.
  • Immune Epitope Database was utilized to predict key epitopes prior to clinical data emerging on various T cell receptor (TCR) responses across populations with various HLA alleles. These predicted epitopes were compared to known epitopes for MHC-I and MHC-II response in SARS-CoV-1.
  • S5 peptide having an amino acid sequence of LPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYG (residues 788-820 of SARS-CoV-1 )
  • S6 peptide having an amino acid sequence of ASANLAATKMSECVLGQSKRVDFCGKGYH (residues 1002-1030 of SARS-CoV-1 ) exhibited immunogenic responses similar to those found in a parallel investigation using truncated recombinant protein analogs of the SARS-CoV S protein (2).
  • the S5 peptide was defined based on known immunogenicity of the monovalent peptide in terms of its ability to illicit an MHC-I response and antibody response, whereas many other peptides were only immunogenic while present multivalently.
  • the S6 peptide represents a known MHC-II domain from SARS-CoV-1 .
  • ASANLAATKMSECVLGQSKRVDFCGKGY (SEQ ID NO:69) (locations 1020-1047)
  • FIG. 2A The 3D structure of the SARS-CoV-1 immuno-epitopes are shown in Figure 2A, and the 3D structure of the CoV-2 immuno-epitopes and their locations on CoV-2 S protein are shown in Figures 2B-2D.
  • IEDB determined that sequences KMSECVLGQSKRV (SEQ ID NO:71 ) and LLFNKVTLA (SEQ ID NO:7) of SARS-CoV-2 S protein, representing MHC-II and MHC-I binding domains for HLA-A * 02:01 , respectively, would be immunogenic with percentile ranks of 0.9 and 1 .2, respectively. Lower percentile rank represents better binding.
  • Figure 3 shows the MHC-I binding prediction results of these immuno-epitopes. Accordingly, the immuno-epitopes having the following sequences are used in further studies and included in some scaffolds:
  • KMSECVLGQSKRV (SEQ ID NO:71 ), and LLFNKVTLA (SEQ ID NO:7).
  • Additional epitopes can be identified from various databases. For example, in the TepiTool results, YLQPRTFLL (SEQ ID NO:9), FIAGLIAIV (SEQ ID NO:22), and FVFLVLLPL (SEQ ID NO:21 ) are the top scoring FILA-A*0201 epitopes. These topscoring epitopes are very hydrophobic. Some of the top-scoring epitopes, or alternately if available, epitopes that demonstrate immunogenicity in vivo or in vitro can be included in the scaffolds disclosed herein.
  • Figure 4 shows that the antibody epitopes such as B cell epitopes in CoV-2 S protein identified by others (12) are aligned to the CoV-2 S protein amino acid sequence.
  • the truncated CoV-2 S protein having the amino acid sequence of SEQ ID NO:4 (below) is aligned to ACE2 to show the locations of antibody epitopes (magenta), and ACE2 binding residues (green).
  • Sequence search using the Bepipred tool indicates that most of the receptor binding motif (residues 440-501) is predicted as being a B cell linear epitope.
  • PDB can be used to identify B-cell epitopes as well. For example, PDB lists eight epitopes which were previously explored by experiments. Two linear epitopes on the SARS-CoV-2 S protein were demonstrated to elicit neutralizing antibodies in COVID-19 patients (12). Some examples of the B-cell epitopes include: PSKPSKRSFIEDLLFNKV (S21 P2) (SEQ ID NO:30), TESNKKFLPFQQFGRDIA (S14P5) (SEQ ID NO:25),
  • P ATV C G P KKSTN LVKN KC (SEQ ID NO:24), GIAVEQDKNTQEVFAQVK (SEQ ID NO:26), NTQEVFAQVKQIYKTPPI (SEQ ID NO:27), PIKDFGGFNFSQILPDPS (SEQ ID NO:29), PINLVRDLPQGFSALEPL (SEQ ID NO:23), and VKQIYKTPPIKDFGGFNF (SEQ ID NO:28).
  • the scaffolds disclosed herein can be modified to include one or more immuno-epitopes including T cell epitopes and/or B cell epitopes.
  • binding pockets can be predicted in a way that is consistent with Cryo-EM and other high-resolution structural data.
  • This technique can be used to rapidly address future mutations of any known or new viruses, even when genomic data of the entire virus suggests as little as 80% similarity.
  • the technology disclosed herein also incorporates a bioinformatics-driven approach for mapping TCR and BCR/antibody epitopes, allowing for a “compression algorithm” of protein size.
  • the technology disclosed herein utilizes a small peptide, such as a peptide of fewer than 70 amino acids out of an about 1200 amino- acid spike protein, to generate a multi-functional scaffold for ACE2 binding and TCR/antibody recognition.
  • CoV-2 scaffolds or ACE2 scaffolds comprising one or more fragments of amino acid sequence from the binding interface of each of CoV-2 S protein and ACE2 while substantially maintaining the structure and/or conformation of the native protein in its free or bound state.
  • the scaffolds disclosed herein substantially maintain or improve the binding affinity to the corresponding binding partner.
  • the CoV-2 scaffolds disclosed herein substantially maintain or improve the binding affinity to wildtype ACE2; and the ACE2 scaffolds disclosed herein substantially maintain or improve the binding affinity to wildtype CoV-2 S protein.
  • the CoV-2 scaffold or the ACE2 scaffold comprises from about 10 to about 100 amino acid residues, from 15 to about 30 amino acid residues, from about 55 to about 95 amino acid residues, from about 60 to about 90 amino acid residues, from about 65 to about 85 amino acid residues, from about 70 to about 80 amino acid residues.
  • the CoV-2 scaffold or the ACE2 scaffold comprises about 50 amino acid residues, about 55 amino acid residues, about 60 amino acid residues, about 65 amino acid residues, about 70 amino acid residues, about 75 amino acid residues, about 80 amino acid residues, about 85 amino acid residues, about 90 amino acid residues, about 95 amino acid residues, or about 100 amino acid residues.
  • the CoV-2 scaffold or ACE2 scaffold comprises two or more sequences that enhance binding, displacement or immunogenicity of the scaffold(s).
  • the viral-mimetic or pathogen-mimetic scaffolds need not be related to SARS-CoV-2 and its binding to ACE2, and can be derived from any pathogen binding to its concomitant human or host protein binding partner(s), including eukaryote and prokaryote species.
  • a CoV-2 scaffold or an ACE2 scaffold each comprising two critical binding motifs, wherein the critical binding motifs are involved with direct binding to the binding partner.
  • the scaffold further comprises one or more backbone regions comprising amino acid residues not involved with direct binding to the binding partner.
  • the backbone region is located between the two critical binding motifs.
  • the backbone region is located at the N-terminus of the first critical binding motif.
  • the backbone region is located at the C-terminus of the second critical binding motif.
  • the CoV-2 scaffold disclosed herein comprises a first critical binding motif having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% identity to an amino acid sequence of NSNNLDSKVGGNYNYLYRL (SEQ ID NO:65), and a second critical binding motif having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% identity to an amino acid sequence of YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQP (SEQ ID NO:66).
  • the ACE2 scaffold disclosed herein comprises a first critical binding motif having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% identity to an amino acid sequence of STIEEQAKTFLDKFNHEAEDLFYQ (SEQ ID NO: 149), and a second critical binding motif having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% identity to an amino acid sequence of NAGDKWSAFLKEQSTLAQMYP (SEQ ID NO: 150).
  • the scaffolds disclosed herein may have different sizes depending on the number of the amino acid residues from the backbone included between the two critical binding motifs, at the N-terminus of the first critical binding motif and/or at the C-terminus of the second critical binding motif. See, for example, Scaffold #1 (SEQ ID NO:72) (top) and Scaffold #10 (SEQ ID NO:81 ) (bottom), amino acid sequences aligned below.
  • one or more amino acid residues in the scaffold are deleted or substituted.
  • one or more repulsory amino acid residues having a positive AG are deleted or substituted
  • one or more neutral amino acid residues having a AG of about 0 are deleted or substituted
  • one or more amino acid residues outside of the critical binding motifs, e.g., in the backbone region are deleted or substituted.
  • one or more critical amino acid residues having a negative AG can be deleted or substituted.
  • the scaffold is modified by replacing the amino acid residues in the backbone region between the critical binding motifs with a linker such as a GS linker having various lengths.
  • the scaffold comprises a linker having about 1 to about 20 amino acid residues, for example, the linker has 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid residues.
  • Scaffold #1 (SEQ ID NO:72), Scaffold #3 (SEQ ID NO:74), Scaffold #11 (SEQ ID NO:82), Scaffold #12 (SEQ ID NO:83), Scaffold #13 (SEQ ID NO:84), and Scaffold #14 (SEQ ID NO:85), from top to bottom in the order of appearance, amino acid sequences aligned below.
  • the GS linkers are shown in bold.
  • the scaffold comprises one or more immuno-epitopes such as one or more T cell epitopes, one or more B cell epitopes, or both.
  • the immuno- epitopes can be included within a non-interfacing loop structure which replaces the entire or partial sequence of the backbone region between the two critical binding motifs of the scaffold. For example, one or more amino acid residues in the backbone region can be replaced by one or more immuno-epitopes.
  • one or more amino acid residues in the critical binding motif preferably, the repulsory or neutral amino acid residues
  • one or more amino acid residues in the critical binding motif can be replaced by one or more immuno-epitopes.
  • the immuno-epitopes are 9 or 13 amino acid residues long corresponding to MHC-I and MHC-II binding.
  • the T cell epitopes include but are not limited to KMSECVLGQSKRV (SEQ ID NO:8), and LLFNKVTLA (SEQ ID NO:7). Other known epitopes may be included in the scaffold as well.
  • dominant TCR epitopes including KLWAQCVQL (SEQ ID NO:10) (ORFlab, 3886-3894, 17.7 nM, mostly for A*02), YLQPRTFLL (SEQ ID NO:9) (S, 269-277, 5.4 nM, mostly for A*02), and LLYDANYFL (SEQ ID NO:11 ) (ORF3a, 139-147, mostly for A*02) (3).
  • TCR epitopes include PRWYFYYLGTGP (SEQ ID NO: 12) (nucleocapsid), SPRWYFYYL (SEQ ID NO: 13) (nucleocapsid, mostly for B*07:02, A*11 :01 , A*03:01), WSFNPETN (SEQ ID NO:14) (membrane protein), QPPGTGKSH (SEQ ID NO:15) (ORFlab polyprotein), and VYTACSHAAVDALCEKA (SEQ ID NO: 16) (ORFlab polyprotein) (1, 4-6).
  • KTFPPTEPK SEQ ID NO: 17
  • CTDDNALAYY SEQ ID NO: 18
  • TTDPSFLGRY SEQ ID NO: 19
  • FTSDYYQLY SEQ ID NO:20
  • the B cell epitopes include but are not limited to FDEDDS (SEQ ID NO:63), IQKEIDRL (SEQ ID NO:62), KYFKNHTSP (SEQ ID NO:61), MAYR (SEQ ID NO:56), NVLYENQ (SEQ ID NO:57), QSKR (SEQ ID NO:58), YQPY (SEQ ID NO:45), SEFR (SEQ ID NO:36), TPGDSS (SEQ ID NO:38), TTKR (SEQ ID NO:64), YYHKNNKSWM (SEQ ID NO:35), ASTEK (SEQ ID NO:33), AWNRKR (SEQ ID NO:41 ), DPSKPSKRSF (SEQ ID NO:55), DQLTPTWRVY (SEQ ID NO:50), EQDKNTQ (SEQ ID NO:54), ESNKK (SEQ ID NO:47), FPQSA (SEQ ID NO:59), GFQPT (SEQ ID NO:63), FDED
  • Scaffold #10 (SEQ ID NO:81 ), Scaffold #15 (SEQ ID NO:86), Scaffold #16 (SEQ ID NO:87), Scaffold #17 (SEQ ID NO:88), Scaffold #18 (SEQ ID NO:89), Scaffold #19 (SEQ ID NO:90), and Scaffold #20 (SEQ ID NO:91), from top to bottom in the order of appearance, amino acid sequences aligned below.
  • Scaffold #1 (SEQ ID NO:72), Scaffold #3 (SEQ ID NO:74), Scaffold #11 (SEQ ID NO:82), Scaffold #12 (SEQ ID NO:83), Scaffold #13 (SEQ ID NO:84), Scaffold #14 (SEQ ID NO:85), from top to bottom in the order of appearance, amino acid sequences aligned below. Amino acid residues in the critical binding motifs are underlined, and the immuno-epitopes are shown in bold.
  • the immuno- epitopes can replace the entire or partial sequence of the backbone region between the critical binding motifs, and/or can replace partial sequence of the critical binding motif, in particular the repulsory and/or neutral amino acid residues in the critical binding motif.
  • the scaffold comprises one or more Cys substitutions such that a Cys-Cys bridge can be formed at a desired location via a disulfide bond.
  • Cys substitutions such that a Cys-Cys bridge can be formed at a desired location via a disulfide bond.
  • L455C and P491C substitutions are made to introduce a Cys-Cys bridge to maintain or stabilize the b sheet structure of the scaffold.
  • the Cys residues at other locations can be substituted by Gly or other residues to avoid interference of Cys-Cys bridge at the desired location.
  • other click chemistry or diselenide chemistry techniques can be used to bridge two amino acids or monomeric regions of the scaffold(s) to recreate a desired structure.
  • the scaffold further comprises a head and/or a tail comprising one or more charged amino acids such as poly(Arg), poly(Lys), poly(His), poly (Glu) or poly(Asp) attached to the N-terminus, C-terminus, or both.
  • a head and/or a tail comprising one or more charged amino acids such as poly(Arg), poly(Lys), poly(His), poly (Glu) or poly(Asp) attached to the N-terminus, C-terminus, or both.
  • the scaffold comprises one or more amino acid substitutions to increase ACE2 binding affinity, antibody affinity, or both.
  • substitutions that increase ACE2 binding affinity include but are not limited to: N439R, L452K, T470N, E484P, Q498Y, N501T.
  • substitutions that alter antibody affinity include but are not limited to: A372T, S373F, T393S, I402V, S438T, N439R, L4411, S443A, G446T, K452K, L455Y, F456L, S459G, T470N, E471V, Y473F, Q474S, S477G, E484P, F490W, Q493N, S494D, Q498Y, P499T, and N501T.
  • Substitutions that increase ACE2 binding affinity while decreasing or potentially displacing antibody binding and B cell binding to those sequences can contribute to immune evasion and immune escape.
  • the scaffold comprises one or more amino acid substitutions include N501Y, N501T, E484K, S477N, T478K, L452R, and N439K, sequences and other snippets of sequences that need not necessarily be from the S-protein, versus an active sequence that has selection pressure for enhanced pathogenicity or transmissibility, or contributes to antigenic drift/escape.
  • These peptides can be rapidly designed and distributed in advance of worldwide spread to cover specific zones as new strains emerge, and this principle can also be applied to other pathogens (including bacteria, fungi, protozoans, etc.) and viruses.
  • Some exemplary pathogenic variants that enhance ACE2 binding which may or may not correspondingly increase infectivity, pathogenicity, and antibody escape. For example, N426-F443 and Y460-Y491 can be maintained.
  • the scaffold comprises a His tag or a C-tag having an amino acid sequence of EPEA.
  • the scaffolds disclosed herein can be linear peptides.
  • the scaffolds disclosed herein can be cyclic peptides, for example, the linear peptides can be head-to-tail cyclized via an amide bond.
  • Some examples of the head-to-tail cyclic scaffolds include Scaffold #43 (SEQ ID NO:114) and Scaffold #44 (SEQ ID NO: 115) having the following amino acid sequences (GS linker in bold):
  • cyclic scaffolds are predicted to be non-aggregating and non-toxic and have a binding affinity equivalent to or better than the linear scaffolds.
  • alternative linkers can be used to further optimize the cyclic scaffolds.
  • head-to-tail cyclic scaffolds have the following amino acid sequences (linker in bold):
  • additional amino acid residues can be added to the scaffold to achieve a desired size or structure.
  • these scaffolds can be linear peptides or head-to-tail cyclic peptides.
  • Some examples of the scaffolds have the following amino acid sequences (added residues shown in bold):
  • the scaffold is modified to include a linker comprising a Pro residue to obtain a more rigid structure.
  • a linker comprising a Pro residue to obtain a more rigid structure.
  • Some examples of such rigid scaffolds have the following amino acid sequences (Pro-containing linker shown in bold):
  • Figure 6 depicts the three-dimensional molecular modeling of three representative linkers in the bound conformation.
  • the scaffold comprises a PEG chain such as PEG2000 (45-unit) to allow binding to both units of dimeric ACE2.
  • the PEG chain has a length of between 30 and 60 unit, between 35 and 55 units, or between 40 and 50 units.
  • the PEG chain has a length of about 30, about 31 , about 32, about 33, about 34, about 35, about 36, about 37, about 38, about 39, about 40, about 41 , about 42, about 43, about 44, about 45, about 46, about 47, about 48, about 49, about 50, about 51 , about 52, about 53, about 54, about 55, about 56, about 57, about 58, about 59, or about 60 units.
  • the scaffold comprises one or more amino acid substitutions with hydrophilic amino acids or polymeric sequences to reduce aggregation.
  • the scaffold comprises modifications to increase the number of hydrophilic amino acids.
  • the scaffold is configured with hydrophobic amino acids facing inward.
  • PEG, poly(sarcosine), or hydrophilic polymer sequences can be added to increase scaffold solubility.
  • Some examples of such scaffolds have the following amino acid sequences (K substitution shown in bold):
  • the scaffolds disclosed herein can be joined to one or more additional scaffolds or other peptides using an appropriate linker to generate multimeric structures.
  • dimers may be formed by linking two scaffolds or peptides together with a linker.
  • trimers may be formed by linking three scaffolds or peptides with two linkers. Larger multimeric structures, e.g., assemblies including four, five, six, seven, or eight scaffolds or peptides linked together may be generated. Examples of linkers include, but are not limited to, PEG or poly(sarcosine).
  • the scaffold comprises a native F residue at the N- terminus, residues IYQ at the C-terminus, or both. In some embodiments, the scaffold comprises a closing of the head-to-tail cyclic peptide at the residues YQP.
  • scaffolds derived from SARS-CoV-2 S protein are set forth in Table 1 below.
  • Critical binding motifs are underlined, immune-epitopes are bolded and italicized, and linkers are bolded.
  • Alignments of these representative scaffold sequences are set forth in Figures 32A-32B.
  • the obtained scaffolds can be fitted to ACE2 to investigate the binding affinity, as shown in Figures 7A-7C.
  • the CoV-2 scaffolds can be fitted to ACE2 to determine their ACE2 binding affinity and KD prediction based on computer modeling.
  • the selected scaffolds are subject to further structural analysis and modification to achieve higher binding affinity, better efficacy, and/or improved stability.
  • the scaffolds disclosed herein, with or without modifications, can be obtained by any existing technology, for example, by peptide synthesis or by recombinant technology.
  • Biolayer interferometry assay is performed, as demonstrated in the working examples, to screen for scaffolds having high binding affinity to ACE2 and significant inhibition of CoV-2 infection in vitro.
  • Biolayer interferometry (“BLI”) is a method for measuring the wavelength shift of incident white light following loading of a ligand upon a sensor tip surface, and/or binding of a soluble analyte to that ligand on the sensor tip surface.
  • the wavelength shift corresponds to the amount of an analyte present and can be used to determine dissociation constants and competition between multiple analytes and the immobilized ligand period the wavelength shift corresponds to the amount of an analyte presents and can be used to determine dissociation constants and competition between multiple analytes and an immobilized ligand.
  • ACE2 commonly known as the viral entry receptor for SARS-CoV-2, exists in both membrane-bound and soluble forms. While ACE2 prevents infection in vitro when presented in soluble form, it may contribute to the immune cloaking and immunoevasive properties of the virus in vivo, essentially shielding the spike protein in its open conformation from recognition by the adaptive immune system. As demonstrated in the working example, a statistically significant inhibition of SARS-CoV-2 pseudotyped lentiviral infections was observed with ACE2 concentrations as low as 4 nM. Yet the working examples further demonstrate that soluble ACE2 prevented neutralizing antibodies from binding to the spike protein’s receptor binding domain (RBD).
  • RBD receptor binding domain
  • soluble ACE2 exists in plasma concentrations of 16.6-41.1 ng/ml_ (1st and 4th quartile ranges), which corresponds to approximately 193— 478 pM, while some studies report concentrations of 7.9 ng/ml_ in acute heart failure patients and 4.8 ng/ml_ in healthy volunteers, which corresponds to approximately 92 and approximately 56 pM, respectively (4, 6).
  • ACE2 may enhance infection in vivo due to occluding the receptor binding domains of the S1 spike protein in open conformation, given that an individual virus spike only takes on this “open” conformation after exposure to furin (during biosynthesis) and TMPRSS2 (during membrane association) (7; 17). Additionally, the higher concentrations of ACE2 in patients with cardiovascular, diabetic, renal, and vascular disease may further be associated with increased pathogenicity of SARS-CoV-2. Because ACE2 exhibits extremely potent binding affinity for the SARS-CoV-2 receptor binding domain (RBD), which may interfere with neutralizing antibody binding to the virus, the virus may avoid detection by the immune system as a function of soluble ACE2.
  • RBD SARS-CoV-2 receptor binding domain
  • SARS-CoV-2 viral titers in the blood of clinical specimens are lower relative to bronchoalvaeolar lavage, fibrobronchoscope brush biopsy, sputum, nasal swab, pharyngeal swab, and feces (an average of 2 46 reduction versus a cycle threshold of 30 corresponding to ⁇ 2.6 x 10 4 copies/mL), corresponding to approximately 1000 viral copies per mL in the blood (20). Assuming about 100 spikes per virus, this corresponds to approximately 100,000 possible ACE2-binding sites per mL of blood if all spikes are in open conformation.
  • ACE2 is predicted to bind to certain SARS-CoV-2 RBD mutants with as little as 110 to 130 pM Kd and, importantly—when in fully “open” conformation—the SARS-CoV-2 spike protein exhibits comparable binding affinity to neutralizing antibodies that compete for this same binding site (25; 26). This is particularly troubling when considering the ability of ACE2 to hinder neutralizing antibody binding to this site, and that neutralizing antibodies are a product of B cell maturation, whereby B cells must mature antibodies and BCRs to reach single-digit nanomolar or picomolar binding affinities comparable in strength to ACE2-spike binding.
  • SARS-CoV-2 has a binding affinity for ACE2 that is comparable to that of even potently neutralizing antibodies, and according to results provided herein.
  • ACE2 severely abrogates antibody binding to the SARS-CoV-2 spike RBD as well as serving as potent inhibitor of infection of SARS-CoV-2 pseudotyped lentivirus in ACE2-expressing cells in vitro.
  • ACE2 serves both a protective function against infection and inhibitory function on immune recognition of the virus, acting as a competitive inhibitor of neutralizing antibody recognition against the spike protein, with binding affinities ranging from about 676 pM to about 33.97 nM (1 ).
  • ACE2 binding to “open” conformation spike proteins is a viable mechanism at physiological ACE2 concentrations for inhibiting neutralizing antibody formation and binding against the spike protein RBD, and the virus has multiple mechanisms for avoiding detection by neutralizing antibodies as a result.
  • D614G The most recent spike protein mutation, D614G, seems to further increase the density of “open” spike proteins on the surface versus the original sequence, as well as the density of spikes in general, which notably makes this mutant likely to be more sensitive to neutralizing antibodies versus the aspartic acid (D) containing variant, while also increasing infectivity (9; 23).
  • D614G variant seems to display >1 ⁇ 2 log 10 ( ⁇ 3x) increased infectivity in ACE2-expressing cells with SARS-CoV-2 pseudotyped lentiviral infection assays (11 ).
  • compositions comprising one or more scaffolds, a conjugate comprising one or more scaffolds, or a fusion protein comprising one or more scaffolds.
  • the composition further comprises one or more pharmaceutically acceptable carriers, excipients, or diluents.
  • the composition can be formulated into an injectable, inhalable, oral, nasal, topical, transdermal, uterine, lubricant, oil, candy, gummy bear, and/or vaginal and rectal dosage form.
  • the composition is administered to a subject by a parenteral, oral, pulmonary, buccal, nasal, transdermal, rectal, vaginal, catheter, urethral, or ocular route.
  • the scaffolds can be modified by adding a polar head or a polar tail comprising 2-150 amino acid residues, e.g., comprising poly(Arg), poly(K), poly(His), poly(Glu), or poly(Asp) to the N-terminus or the C-terminus, as well as non-natural amino acids and other polymeric species including glycopeptides, polysaccharides, linear and branched polymers, and the like.
  • non-natural amino acids and other polymeric species that may be suitable for use with the scaffolds of the present disclosure include polymeric molecules described in U.S. Provisional Patent Application No. 62/889,496, which is incorporated herein by reference.
  • a recombinant membrane-fusion domain may also be added to the scaffolds via a linker.
  • the scaffolds can be assembled into electrostatic nanoparticles.
  • the scaffolds can be immobilized on chips for surface plasmon resonance (SPR).
  • the scaffolds can serve as ligands for targeted delivery for various therapeutics such as siRNAs, CRISPR based technology and small molecules as part of both synthetic and naturally/recombinantly derived delivery systems, gene and protein-based payloads, and the like.
  • the scaffolds can be either synthetic or recombinant, and can include linkers and synthetic or recombinant modifications to the N-terminus or the C-terminus to further enhance membrane fusion or delivery substrate fusion.
  • the targeted delivery can be nanoparticle-based.
  • Various tags known in the art can be attached to the scaffolds as well, e.g., His-tag and C-tag.
  • the scaffolds may comprise a loop which allows attachment of a conjugatable domain using the existing peptide conjugate technology.
  • the scaffold disclosed herein may be conjugated via maleimide, which is commonly used in bioconjugation, and which reacts with thiols, a reactive group in the side chain of Cys residue.
  • Maleimide may be used to attach the scaffolds disclosed herein to any SH-containing surface as illustrated below:
  • the scaffolds disclosed herein may comprise one or more immuno-epitopes. Further, one or more scaffolds disclosed herein may be conjugated together via linkers or other conjugatable domains to obtain multi-epitope, multi-valent scaffolds. Additionally, the scaffolds disclosed herein can be attached to other immune-response eliciting domains or fragments. In some embodiments, one or more of the scaffolds disclosed herein can be attached to an Fc fragment to form a fusion protein.
  • Both the ACE-2 scaffolds and the CoV-2 scaffolds disclosed herein can be used in compositions as a “coating” to block or inhibit virus entry.
  • the ACE-2 scaffolds can bind to the RBD of the CoV-2 virus to coat the virus thereby to block virus entry into human body.
  • the CoV-2 scaffolds can bind to the ACE2 binding domain to coat the ACE2 receptor thereby to block virus entry into human body.
  • the scaffolds disclosed herein are small peptides having a size of less than 100 amino acids, e.g., about 70 amino acid residues or less and comprising: 1 ) immuno- epitopic regions for T cell receptor MHC-I and MHC-II loading, 2) immuno-epitopic regions for B cell receptor or antibody binding, and 3) ACE2 receptor binding regions.
  • these synthetic or recombinant scaffolds serve as competitive inhibitors for ACE2 binding by the SARS-CoV-2 virus, they are also designed to trigger immune learning and be able to be presented on a variety of immunologically active scaffolds and adjuvants.
  • these scaffolds can readily be conjugated to a variety of immunoadjuvants as well as known and novel substrates for multivalent display.
  • These scaffolds may also be used for a variety of infectious disease-causing agents, ranging from bacteria, fungi, protozoans, amoebas, parasites, viruses, sexually-transmitted diseases, and the like.
  • the disclosed technology allows for targeted delivery of a variety of therapeutic agents, including silencing RNAs, CRISPR and other gene editing based technologies, and small molecule agents to virally-infected cells.
  • the scaffolds disclosed herein can serve as a ligand for nanoparticle-based siRNA delivery and small molecule conjugate approaches in therapeutic design and development.
  • the scaffolds comprising immuno-epitopes can also present key residues for immuno-epitopic recognition by antibodies and T cell receptors through MHC-I and MHC-II loading as determined by predicted antibody binding regions for the most distal loop structures of the entire SARS-CoV-2 protein based on crystal structure data of SARS-CoV-1 with a neutralizing antibody, in addition to IEDB immuno-epitope prediction approaches.
  • the scaffolds disclosed herein are also expected to enhance immune response to SARS-CoV-2 rather than blunting it.
  • approaches such as ACE2-mimetic and antibody therapies are likely to reduce neutralizing antibody response to the virus, since they coat the virus and prevent binding of the adaptive immune system to the portion that is bound, which is the same segment of the spike protein necessary for B cell receptor (BCR) maturation into neutralizing antibodies targeting the spike protein RBD in its “open” conformation.
  • BCR B cell receptor
  • the scaffolds disclosed herein are not expected to interfere in the activity of ACE2, due to binding to the face of the enzyme that does not metabolize angiotensin II.
  • these peptides are also designed to have modular epitopes for MHC-I and MHC-II recognition, which can be customized to the haplotypes of various patient populations, in addition to the inclusion of antibody-binding epitopes within the peptide sequences.
  • the scaffolds disclosed herein are designed to display modular motifs for priming clonal expansion of selective TCR repertoire, which can be facilitated by sequencing of recovered patient TCR repertoires and insertion into these scaffolds and assessing HLA genotypes of target populations (28). This affords a facilitated method for rapid vaccine and antidote design, coupling bioinformatics with structural and patient-derived omics data to create an iterative design approach to treating infectious agents.
  • the in vitro studies provide proof of principle for antibody recognition and effective viral blockade.
  • the synthetic nature of the scaffolds affords utility in tethering these peptides to a variety of substrates via click chemistry, which include but are not limited to C60 buckminsterfullerene, single and multi-walled carbon nanotubes, dendrimers, traditional vaccine substrates such as KLH, OVA and BSA, and the like — though the bare alkyne-terminated peptides are examined in the present example.
  • the synthetic nature, in silico screening, and precise conformation of these peptides allows for rapid synthesis without traditional limitations of recombinant, live-attenuated, gene delivery system, viral vector, or inactivated viral vaccine approaches.
  • compositions provided herein comprising the scaffolds disclosed herein and future permutations of these peptides may be used to facilitate the design, development and scale-up of precise therapeutic agents and vaccines against a variety of infectious agents as part of broader biodefense initiatives.
  • the peptides need not be synthetic, and may optionally comprise recombinant variants or a fusion between a recombinant protein and a moiety selected from the group consisting of synthetic peptides, polymers, peptoids, glycoproteins, polysaccharides, lipopeptides, and liposugars.
  • the scaffolds disclosed herein are designed to overcome many limitations associated with antibody therapies, ACE2-Fc therapies, and other antiviral therapeutics.
  • neutralizing antibodies may be used as “stopgap” therapeutics to prevent the progression of disease, the transient nature of administered antibodies leaves the organism susceptible to reinfection.
  • ACE2 is a potent inhibitor of neutralizing antibody binding to the SARS-CoV-2 spike protein receptor binding domain. Therapeutics that mimic ACE2 and shield this key epitope are likely to bias antibody formation towards off-target sites, which could contribute to antibody-dependent enhancement (ADE), vaccine-associated enhanced respiratory distress (VAERD), and a host of other immunological issues upon repeat viral challenge.
  • ADE antibody-dependent enhancement
  • VAERD vaccine-associated enhanced respiratory distress
  • any approaches that have potential to limit endogenous antibody formation should be carefully reconsidered, due to the viral immuno-evasive techniques spanning a gamut of mechanisms, including but not limited to the spike protein switching between “open” and “closed” conformations, heavy glycosylation limiting accessible regions, and also the presentation of T cell evasion due to MHC downregulation on infected cells and potential MHC-II binding of the SARS-COV-2 spike protein limiting CD4+ T cell responses, which all may be factors in contributing to T cell exhaustion and ineffective and/or transient antibody and memory B cell responses in infected patients.
  • An ideal therapeutic strategy should enhance neutralizing antibody formation, not blunt it, while also preventing the virus from entering cells and replicating(31 ; 32; 33; 34). Indeed, severe and critically ill patients exhibit extreme B cell activation and, presumably, antibody responses. Yet, poor clinical outcomes are seen, suggesting that immune evasion and/or off-target antibody formation is dominant (35; 36).
  • results provided herein indicate that the scaffolds disclosed herein can be used as both therapeutic agents and vaccines due to the presence of key epitopes for antibody formation, and the performance of Scaffold #8 (SEQ ID NO:79) which exhibits one MHC-I epitope and one MHC-II epitope in these experiments.
  • the MHC-I and MHC-II domains can be flexibly substituted to match HLA types in various populations or pooled across panels of peptides exhibiting multiple domains.
  • compositions provided herein may prove to be an effective immune-enhancing strategy in infected patients, with additional potential to serve as a prophylactic vaccine. [0139] Therefore, the scaffolds disclosed herein and the compositions comprising the same can be used to prevent viral association with ACE2 and infection, while also contribute to a decrease in soluble ACE2 shielding of the virus.
  • thermodynamically favorable interaction of an antibody with the virus (about 6 nM KD with the neutralizing antibody studied herein) versus scaffolds provided herein (about 1 mM KD) suggests that the scaffolds can dissociate ACE2, promote antibody formation against the virus during infection, and preferentially train the immune system to eliminate the virus.
  • This working example demonstrates building a structural simulation of the novel virus SARS-CoV-2 using SWISS-MODEL based on a SARS-CoV-2 spike protein sequence (UniProt ID P0DTC2) and its homology to SARS-CoV-1 (PDB ID 6CS2) in the absence of crystallographic or cryo-EM data determining the atomic-resolution structure of SARS-CoV-2 and in the absence of any data on the binding cleft of the CoV-2 virus to the ACE2 receptor.
  • SWISS-MODEL SARS-CoV-2 spike protein sequence
  • PDB ID 6CS2 homology to SARS-CoV-1
  • SARS-CoV-2 spike protein structure was aligned with SARS-CoV-1 spike protein bound to ACE2 (PDB ID 6CS2) using PyMOL (The PyMOL Molecular Graphics System, Version 2.3.5 Schrodinger, LLC.). This structure was then run through PDBePISA to determine the Gibbs free energy (AG) and predicted amino acid interactions between the SARS-CoV-2 spike protein and the ACE2 receptor (10).
  • PyMOL was also used to align a truncated sequence of SARS-CoV-1 (locations 322-515) in its native conformation with the ACE2 receptor to SARS-CoV-2 S protein (locations 336-531) and thermodynamic AG calculations of the simulated binding pocket of SARS-CoV-2 S protein with ACE2 were performed utilizing PDBePISA. Upon the availability of structural data, this approach was compared and determined to have correctly identified the stretches of amino acids necessary for binding to ACE2, as detailed in Example 4.
  • SARS coronavirus (“SARS-CoV”; “SARS-CoV-1”; or “CoV-1”) protein sequence (PDB ID 6CS2) was compared to SARS-CoV-2 S protein sequence (hereinafter “CoV-2”; SEQ ID NO:2, encoded by nucleotides 21536-25357 of SEQ ID NO:1 ) and a homology model was generated using SWISS-MODEL, which was then imported into PyMOL as a PDB file.
  • SARS-CoV SARS coronavirus
  • SARS-CoV-1 SARS-CoV-1 protein sequence
  • Chain A of CoV-2 was aligned with Chain A of SARS-CoV-1 (PDB ID 6CS2) in the bound state to the ACE2 receptor (see Figures 9A-9C).
  • PDB-PISA was run on the binding interface of CoV-2 S protein with the ACE2 receptor to determine the critical binding residues.
  • Figures 10A and 10B show the results of AG calculation for each residue on the binding interface for CoV-2 and CoV-1 , respectively.
  • the key residues of CoV-2 S protein for binding to ACE2 (negative AG) are highlighted in green, while residues having about 0 AG are shown in yellow, and repulsory residues have a positive AG are shown in orange.
  • L455 and P491 shown in magenta, are in proximity based on the computer model, and therefore, maybe replaced by Cys residues to introduce a disulfide bond between these two locations to stabilize the b sheet structure in the CoV-2 binding interface.
  • a peptide scaffold comprising the truncated receptor binding motif (RBM) was designed. This sequence was designed to recreate the structure of the large protein in this motif, with key modifications performed to facilitate b sheet formation. Various deep learning-based approaches were used to simulate the structure of the peptide scaffolds.
  • a SUMMIT supercomputer-based modeling approach can be used to simulate binding of putative scaffolds.
  • a PDBePISA and Prodigy combined approach can be added to the supercomputer's heuristics for assessing binding cleft interactions.
  • the modeling techniques can also include the CD147-SPIKE interactions as components such that the supercomputer's molecular dynamics simulations can predict in the absence of pre-biased alignment.
  • modeling with or without use of the supercomputer can be coupled with the use of RaptorX (or AlphaFold or equivalent) to model a free energy folding state of a random peptide sequence. This allows for combinatorial screening of random peptide sequences using the supercomputer and then running molecular dynamics simulations on a target receptor.
  • RaptorX is an efficient and accurate protein structure prediction software package, building upon a powerful deep learning technique (19). Given a sequence, RaptorX is used to run a homology search tool HHblits to find its sequence homologs and build a multiple sequence alignment (MSA), and then derive sequence profile and inter-residue coevolution information (13).
  • RaptorX is used to feed the sequence profile and coevolution information to a very deep convolutional residual neural network (of about 100 convolution layers) to predict inter-atom distance (i.e., Ca-Ca, Cb-Cb and N-0 distance) and inter-residue orientation distribution of the protein under prediction.
  • inter-atom distance i.e., Ca-Ca, Cb-Cb and N-0 distance
  • RaptorX discretizes the Euclidean distance between two atoms into 47 intervals: 0-2, 2-2.4, 2.4-2.8, 2.8-3.2 ... 19.6-20, and > 20A.
  • RaptorX discretizes the orientation angles defined previously (13) into bins of 10 degrees.
  • RaptorX derives distance and orientation potential from the predicted distribution and builds 3D models of the protein by minimizing the potential.
  • Experimental validation indicates that such a deep learning technique is able to predict correct folding for many more proteins than ever before and outperforms comparative modeling unless proteins under prediction have very close homologs in Protein Data Bank (PDB).
  • PDB Protein Data Bank
  • ACE2 binding interface of ACE2 was investigated in a similar way as disclosed in Example 2.
  • a stretch of amino acid sequence from locations 19-84 of ACE2 appeared to be involved with binding to CoV-2 S protein.
  • the critical binding residues include S19, Q24, D38, Q42, E75, Q76, and Y83, shown in green in Figures 14A- 14D.
  • ACE2 Scaffold 1 having the amino acid sequence STIEEQAKTFLDKFNHEAEDLFYQGSGSGNAGDKWSAFLKEQSTLAQMYP (SEQ ID NO: 141) was synthesized (the GS linker is italicized and underlined).
  • ACE2 Scaffold 1 appeared to have two critical binding motifs: STIEEQAKTFLDKFNHEAEDLFYQ (SEQ ID NO: 149) (locations 19-42), and NAGDKWSAFLKEQSTLAQMYP (SEQ ID NO: 150) (locations 64-84).
  • Figure 15A shows computer modeling of ACE2 Scaffold 1 truncated from the ACE2 protein
  • Figures 15B-15C shows a simulation of ACE2 Scaffold 1 binding to CoV-2 S protein.
  • SWISS-MODEL was used to create a structural simulation of the CoV-2 virus in comparison to SARS-CoV-1 (PDB ID 6CS2).
  • PyMOL was used to align a truncated sequence of SARS-CoV-1 (locations 322 - 515) in its native conformation with the ACE2 receptor to SARS-CoV-2 (locations 336 - 531).
  • Peptide synthesis Peptide scaffold sequences were designed and synthesized in-house or custom synthesized by third-party commercial providers such as sb-PEPTIDE (France). Mass spectrometry was used to confirm the appropriate peptide molecular weights.
  • the peptides were synthesized using standard Fmoc- based solid-phase peptide synthesis (SPPS) utilizing a custom-built peptide robot, demonstrating about 120 second per amino acid coupling of a 9 amino acid sequence.
  • SPPS solid-phase peptide synthesis
  • 30-50 amino-acid peptides were synthesized in as little as 2 hours ( Figure 18).
  • Synthesis may occur by any suitable means.
  • yeast may be used to synthesize proteins.
  • the peptides were synthesized on Rink- amide AM resin.
  • This example illustrates various strategies of head-to-tail cyclization of CoV-2 scaffolds, including: (1) head-to-tail cyclization of the side chain protected peptide in solution by amide coupling (Figure 19A), (2) on resin head-to-tail cyclization by amide coupling (Figure 19B), and (3) cyclization of purified linear thioester peptide by NCL ( Figure 19C).
  • Strategy (1) the synthesis was completed with an HPLC purity of ⁇ 30% of the globally deprotected peptide.
  • Strategy (2) the synthesis was completed, and after de-allylation and global deprotection, the HPLC purity was -25%.
  • the microwave synthesis was completed with -20% crude product obtained with O-Allyl protecting group. After de-allylation on resin cyclization was attempted with PyBOP/DIPEA for 16 hours. Desired product mass was not observed but thioesterification would be the next step.
  • Biolayer interferometry directly interrogates binding between two or more analytes.
  • This example demonstrates in vitro analysis of CoV-2 scaffolds using BLI to characterize binding dynamics by determining dissociation constants of the scaffolds associated with dimeric ACE2, and the inhibitory effects of the scaffolds on ACE2 to binding to the receptor binding domain (“RBD”).
  • BLI was also used to determine the dissociation constants of the scaffolds associated with IgG neutralizing antibody (NAb).
  • An Octet ® RED384 biolayer interferometer (Fortebio) was used with sensor tips displaying anti-human IgG Fc (ACH), streptavidin (SA), nickel-charged tris-nitriloacetic acid (NTA), or anti-penta-his (HIS1 K) in 96-well plates.
  • streptavidin tips 1 mM biotin was used to block the surface after saturation with a given immobilized ligand.
  • the scaffold analytes in solution exhibited nonspecific binding to the sensor tip surface with NTA and HIS1 K tips whereas biotinylated surfaces minimized this nonspecific binding.
  • ACE2-His Sino Biological
  • RBD-his Sino Biological
  • UCSF dimeric-ACE 2-biotin
  • UCSF RBD- biotin
  • Nonspecific binding was still observed with Scaffold #8 (SEQ ID NO:79) binding to a neutralizing antibody on AHC tips, which complicated efforts to determine the KD using Scaffold #8 as the analyte compared to the neutralizing antibody ligand.
  • All stock solutions were prepared in a 1X PBS containing 0.2% BSA and 0.02% Tween20. The following ligands and analytes were studied:
  • BLI was used to determine dissociation constants of selected scaffolds associated with dimeric ACE2 and the inhibitory effects of the scaffolds on ACE2 binding to RBD.
  • the CoV-2 scaffolds tested in this experiment prevented ACE2 from binding to S protein RBD in a concentration-dependent manner. All scaffolds tested exhibited potent inhibition of RBD binding to ACE2 at 10 pM concentrations. The scaffolds were associated with ACE2 at 1 , 3 and 10 pM concentrations until saturation ( Figures 20A-20D).
  • BLI was also used to determine dissociation constants of selected scaffolds associated with an IgG neutralizing antibody. Scaffold #8 exhibited nonspecific binding to the sensor tip ( Figure 21 C), preventing determination of KD against the neutralizing antibody. This nonspecific binding with Scaffold #8 was observed in all studies that did not utilize biotinylated substrates with biotin blocking of the sensor surface. However, single micromolar binding affinities for all other scaffolds were determined with the neutralizing antibody ( Figures 21 A, 21 B, and 21 D). Next, the dissociation constant for increasing concentrations of RBD with anti-RBD neutralizing antibody was measured (Figure 21 E).
  • Example 8 Infection of ACE2-HEK293 cells with SARS-CoV-2 spike protein pseudotyped lentivirus
  • ACE2-HEK293 cells (BPS Bioscience) were transduced with pseudotyped lentivirions displaying the SARS-CoV-2 spike glycoprotein (BPS Bioscience) and assessed for luciferase activity and trypan blue toxicity 60 hours post-infection.
  • a neutralizing monoclonal IgG antibody against SARS-CoV-2 spike glycoprotein (CR3022, antibodies- online), ACE2 (Sino Biological), receptor-binding domain (RBD) of spike glycoprotein (Sino Biological), and selected scaffolds of the present disclosure were used as inhibitors of infection. Infection was quantitated via bioluminescence, and toxicity was characterized via a trypan blue absorbance assay utilizing a SynergyTM H1 BioTek spectrophotometer.
  • Scaffold #4 and Scaffold #7 did not block SARS-CoV-2 spike protein pseudotyped virus infection of ACE2-HEK293 cells at concentrations below 20 mM, as assessed by luciferase activity 60 hours post-infection. Yet, Scaffold #8 and Scaffold #9 both impeded viral infection at 6.66 mM, with Scaffold #8 significantly exhibiting this blocking effect in the nanomolar range (80 nM and 30 nM, p ⁇ 0.05, t-test comparison with virus only). (*, p ⁇ 0.05; ***, p ⁇ 0.001 ; unpaired student’s t-test, technical triplicates).
  • Figures 23A-23D show a virtually complete inhibition of SARS-CoV-2 spike protein pseudotyped virus infection by soluble RBD and soluble ACE2 at 0.33uM, while a SARS-CoV-2 neutralizing antibody inhibited infection to a similar extent at concentration as low as 6 nM. Intriguingly, 12 nM RBD enhanced infection. (*, p ⁇ 0.05; ***, p ⁇ 0.001 ; unpaired student’s t-test, technical triplicates).
  • the novel synthetic peptide scaffolds disclosed herein have been demonstrated to block a virus from associating with cells, while also demonstrating epitopes for antibody and T cell receptor formation.
  • This experiment demonstrates that the tested scaffolds effectively blocked >95% of infection of pseudotyped lentiviruses displaying the SARS-CoV-2 spike protein infecting ACE2-expressing cells without toxicity at EC95 dose, and that the tested scaffolds prevented association of the SARS-CoV-2 receptor binding domain (RBD) with ACE2 even at extremely high RBD concentrations (35 mM).
  • the tested scaffolds exhibited an IC50 in sub-micromolar range with statistically significant viral inhibition at 30 nM.
  • Figure 24A shows that the tested scaffolds exhibited over 90% inhibition of viral load (EC90) in live virus at micromolar concentrations.
  • Figure 24B shows no toxicity with up to 2.5log inhibition of viral load with live SARS-CoV-2 virus.
  • VIAWNSNNLDSKVGGNYNYLYRCFRKSNLKPFERDISTEIYQAGSTPGNGVEGFNGYFCL QSYGFQPTNGVGYQPYRW (SEQ ID NO:75). It was investigated whether the best scoring structure was stable by itself in solution, and how flexible it would be. Peptides can sometimes refold very quickly; if the starting point is not near a local minimum that would be evident from modeling. Whether the peptide is stable at short to intermediate time scales is a much easier question than whether that is the global minimum.
  • Rosetta has a not-entirely physical energy function which is optimized for well-ordered proteins with stable folds but does not perfectly model solvent effects, which drive the loop to fold under. It is possible that there are not particularly good specific binding interactions and that the analysis has trouble with disordered regions. Annealing structures from near the end of the run carefully may be able to find even better Rosetta scores.
  • All scaffold structures can be run through the above-disclosed steps in replicas. Improvements can be made to sample longer time scales efficiently. For example, AMD can give 100x effective speedup vs plain MD, such that even folding from scratch or tracing binding pathways can be analyzed.
  • CKMSECVLGQSKRVQALLFNKVTLAGFNGYFC (SEQ ID NO: 129), which is the loop only from Scaffold #8, with cysteine residues at the N-terminus and C-terminus to ensure closure,; and the partial sequence of KMSECVLGQSKRVDFC (SEQ ID N0:70), which is slightly larger than the immuno-epitope by adding three amino acid residues to the C- terminus (bold and underlined), also looped.
  • This binding pocket is surrounded by the other two chains in the bundle. Any peptide that manages to get in the binding pocket would likely have an ultra-tight binding, maybe at a concentration of single digit nanomolar or less and it would also completely disrupt fusion. Additional analysis is required to determine the series of rearrangements the spike protein goes through to go from its original folded up form to the bound form. There may be multiple pathways, and only some of them may have this site temporarily open during binding. Also, there are many other binding sites where a small fragment of the 6XRA structure may compete with the whole structure. An in silico or in vitro screen of every 10-20 amino acids linear fragments may find more sites.
  • the bold sequence is the resulting cyclic peptide, the rest splices itself out- cyclic 6 amino acids or longer, and the first amino acid can be Cys or Ser.
  • Intein-extein fusion can be used as a mechanism for fusing a peptide or recombinant/synthetic sequence with a self-catalyzing and self-spliced out sequence to create fusion between two peptide sequences.
  • a peptide to act as a “super binder” having very high affinity it is desirable to have a longer loop that sticks out on the ACE2 side and makes more contacts with it.
  • the goal is to improve stability of the scaffold by itself without compromising binding affinity.
  • binding affinity is improved by nudging the same binding residues into better positions.
  • Figures 31 A-31 D illustrate how to screen and optimize the peptide sequence.
  • Step 1 Length 5 loop in RLxxxxxQA, about 60k tries. F at the first position was most prevalent.
  • Step 2 Fix the first F - at this point -YQA seemed to be closer to the next residue than -QA, and therefore, a length 5 loop RLFxxxxxYQA was built, about 15k tries. Very nicely, this reproduced the native -TEIYQA bit; the single best sequence from that run was the RLFDGTEIYQA.
  • Figure 31 B Step 3: The geometry of the second residue was not too incompatible with proline, but the loop builder algorithm had trouble inserting that; tried fixing a proline in that position.
  • siRNA was designed for the envelope protein of SARS-CoV-2 using IDT's silencing RNA design tool.
  • the envelope protein is encoded by nts 26,191-26,288 of SEQ ID NO:1.
  • the following sequences were utilized: 13.4 sense (SEQ ID NO: 143) and 13.4 antisense (SEQ ID NO: 144) (corresponding to nts 26,200-26,224 of SEQ ID NO:1); 13.10 sense (SEQ ID NO: 145) and 13.10 antisense (SEQ ID NO: 146 (corresponding to nts 26,235- 26,259 of SEQ ID NO: 1 ); and 13.5 sense (SEQ ID NO: 147) and 13.5 antisense (SEQ ID NO: 148) (corresponding to nts 26,207-26,231 of SEQ ID NO: 1
  • Figures 33A-33E illustrate the process of designing using the IDT siRNA design tool, including the locations and sequences of selected sense and anti-sense strands.
  • CoV-2 scaffold with or without modification, or with or without immuno- epitope(s)
  • siRNA is mixed with the siRNA according to previously developed methods to create a gene vector with a) immune priming activity and vaccine behavior, and b) silencing RNA behavior for the viral replication. See U.S. Provisional Patent Application No. 62/889,496. This approach can also be used for gene editing, RNA editing, and other protein-based Cas tools to treat a variety of viruses.
  • the scaffolds simulated via RaptorX were aligned with the ACE2 receptor (red, with PDBePISA-predicted binding interfaces in green) using the “align” command in PyMOL. See Figure 35, shown from left to right (top) are Scaffold #4, Scaffold #7, Scaffold #8, and Scaffold #9. Scaffold #4 and Scaffold #7included the wildtype sequence with two cross-linking motif substitutions. Scaffold #8 included MHC-I and MHC-II epitopes, and Scaffold #9 included a GSGSG linker (white) in one of its non-ACE2-interfacing loop regions.
  • scaffolds derived from SARS-CoV-2 S protein are set forth in Table 1 below.
  • Critical binding motifs are underlined, immune-epitopes are bolded and italicized, linkers are bolded, substitutions are double underlined, poly charged N- and C-terminus amino acid residues are squiggly underlined, and EPEA C-term tags are italicized.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Virology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Dermatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Communicable Diseases (AREA)
  • Optics & Photonics (AREA)
  • Nanotechnology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Vascular Medicine (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Spectroscopy & Molecular Physics (AREA)
  • Pulmonology (AREA)
  • Mycology (AREA)
PCT/US2021/019739 2020-02-25 2021-02-25 Identification of biomimetic viral peptides and uses thereof Ceased WO2021173879A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CN202180031498.6A CN115461068A (zh) 2020-02-25 2021-02-25 仿生病毒肽的鉴定及其用途
CA3172878A CA3172878A1 (en) 2020-02-25 2021-02-25 Identification of biomimetic viral peptides and uses thereof
AU2021227918A AU2021227918A1 (en) 2020-02-25 2021-02-25 Identification of biomimetic viral peptides and uses thereof
JP2022550908A JP2023514452A (ja) 2020-02-25 2021-02-25 生体模倣ウイルスペプチドの特定及びその使用
EP21760562.5A EP4110366A4 (en) 2020-02-25 2021-02-25 IDENTIFICATION OF BIOMIMETIC VIRAL PEPTIDES AND THEIR USES
IL295863A IL295863A (en) 2020-02-25 2021-02-25 Identification of biomimetic viral peptides and their uses
KR1020227033145A KR20220158723A (ko) 2020-02-25 2021-02-25 생체모방 바이러스 펩티드의 확인 및 그의 용도
US17/822,099 US20230242592A1 (en) 2020-02-25 2022-08-24 Identification of biomimetic viral peptides and uses thereof

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US202062981453P 2020-02-25 2020-02-25
US62/981,453 2020-02-25
US202063002249P 2020-03-30 2020-03-30
US63/002,249 2020-03-30
US202062706225P 2020-08-05 2020-08-05
US62/706,225 2020-08-05
US202063091291P 2020-10-13 2020-10-13
US63/091,291 2020-10-13

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/822,099 Continuation US20230242592A1 (en) 2020-02-25 2022-08-24 Identification of biomimetic viral peptides and uses thereof

Publications (1)

Publication Number Publication Date
WO2021173879A1 true WO2021173879A1 (en) 2021-09-02

Family

ID=77492020

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/019739 Ceased WO2021173879A1 (en) 2020-02-25 2021-02-25 Identification of biomimetic viral peptides and uses thereof

Country Status (9)

Country Link
US (1) US20230242592A1 (https=)
EP (1) EP4110366A4 (https=)
JP (1) JP2023514452A (https=)
KR (1) KR20220158723A (https=)
CN (1) CN115461068A (https=)
AU (1) AU2021227918A1 (https=)
CA (1) CA3172878A1 (https=)
IL (1) IL295863A (https=)
WO (1) WO2021173879A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11732030B2 (en) 2020-04-02 2023-08-22 Regeneron Pharmaceuticals, Inc. Anti-SARS-CoV-2-spike glycoprotein antibodies and antigen-binding fragments
US11999777B2 (en) 2020-06-03 2024-06-04 Regeneron Pharmaceuticals, Inc. Methods for treating or preventing SARS-CoV-2 infections and COVID-19 with anti-SARS-CoV-2 spike glycoprotein antibodies
IT202200025416A1 (it) * 2022-12-13 2024-06-13 Univ Pisa Biosensore per la rilevazione di particelle virali
EP4155315A4 (en) * 2020-05-22 2024-07-17 Riken MULTIPLE ANTIGENIC PEPTIDE AGAINST CORONAVIRUS AND IMMUNOSTIMULATING COMPOSITION THEREOF
US12496470B2 (en) 2021-07-14 2025-12-16 Regeneron Pharmaceuticals, Inc. Anti-SARS-CoV-2-spike glycoprotein antibodies and antigen-binding fragments
US12539328B2 (en) 2021-09-17 2026-02-03 David Kotlyar Oral vaccine via dental bacteria and emitted peptides to prevent COVID-19 infection

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN117153245B (zh) * 2023-10-18 2024-03-19 无锡市疾病预防控制中心 预测新型冠状病毒S蛋白RBD区域与hACE2受体相互作用的方法

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180161447A1 (en) * 2016-12-14 2018-06-14 Ligandal, Inc. Methods and compositions for nucleic acid and protein payload delivery
US10676511B2 (en) * 2015-09-17 2020-06-09 Ramot At Tel-Aviv University Ltd. Coronaviruses epitope-based vaccines

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11365239B2 (en) * 2020-03-20 2022-06-21 Tsb Therapeutics (Beijing) Co., Ltd. Anti-SARS-COV-2 antibodies and uses thereof

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10676511B2 (en) * 2015-09-17 2020-06-09 Ramot At Tel-Aviv University Ltd. Coronaviruses epitope-based vaccines
US20180161447A1 (en) * 2016-12-14 2018-06-14 Ligandal, Inc. Methods and compositions for nucleic acid and protein payload delivery

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
LAN ET AL.: "Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor", NATURE, vol. 581, no. 7807, 30 March 2020 (2020-03-30), pages 215 - 220, XP037182122, DOI: 10.1038/s41586-020-2180-5 *
SALATA ET AL.: "Coronaviruses: a paradigm of new emerging zoonotic diseases", PATHOGENS AND DISEASE, vol. 77, no. 9, 1 December 2029 (2029-12-01), XP055700938 *
See also references of EP4110366A4 *
TARNOVITSKI ET AL.: "Mapping a Neutralizing Epitope on the SARS Coronavirus Spike Protein: ' Computational Prediction Based on Affinity-selected Peptides", JOURNAL OF MOLECULAR BIOLOGY, vol. 259, no. 1, 26 May 2006 (2006-05-26), pages 190 - 201, XP005415799 *
WAN Y. ET AL.: "Receptor recognition by novel coronavirus from Wuhan: An analysis based on decade-long structural studies of SARS", JOURNAL OF VIROLOGY, vol. 94, no. 7, 17 March 2020 (2020-03-17), pages 1 - 25, XP055808633 *

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11732030B2 (en) 2020-04-02 2023-08-22 Regeneron Pharmaceuticals, Inc. Anti-SARS-CoV-2-spike glycoprotein antibodies and antigen-binding fragments
US12251440B2 (en) 2020-04-02 2025-03-18 Regeneron Pharmaceuticals, Inc. Anti-SARS-CoV-2-spike glycoprotein antibodies and antigen-binding fragments
EP4155315A4 (en) * 2020-05-22 2024-07-17 Riken MULTIPLE ANTIGENIC PEPTIDE AGAINST CORONAVIRUS AND IMMUNOSTIMULATING COMPOSITION THEREOF
US11999777B2 (en) 2020-06-03 2024-06-04 Regeneron Pharmaceuticals, Inc. Methods for treating or preventing SARS-CoV-2 infections and COVID-19 with anti-SARS-CoV-2 spike glycoprotein antibodies
US12496470B2 (en) 2021-07-14 2025-12-16 Regeneron Pharmaceuticals, Inc. Anti-SARS-CoV-2-spike glycoprotein antibodies and antigen-binding fragments
US12539328B2 (en) 2021-09-17 2026-02-03 David Kotlyar Oral vaccine via dental bacteria and emitted peptides to prevent COVID-19 infection
IT202200025416A1 (it) * 2022-12-13 2024-06-13 Univ Pisa Biosensore per la rilevazione di particelle virali

Also Published As

Publication number Publication date
JP2023514452A (ja) 2023-04-05
EP4110366A1 (en) 2023-01-04
CA3172878A1 (en) 2021-09-02
EP4110366A4 (en) 2024-03-27
AU2021227918A1 (en) 2022-10-20
IL295863A (en) 2022-10-01
US20230242592A1 (en) 2023-08-03
KR20220158723A (ko) 2022-12-01
CN115461068A (zh) 2022-12-09

Similar Documents

Publication Publication Date Title
US20230242592A1 (en) Identification of biomimetic viral peptides and uses thereof
Tortorici et al. Structural basis for human coronavirus attachment to sialic acid receptors
Vizarraga et al. Immunodominant proteins P1 and P40/P90 from human pathogen Mycoplasma pneumoniae
Edeling et al. Structural basis of Flavivirus NS1 assembly and antibody recognition
Arimori et al. Engineering ACE2 decoy receptors to combat viral escapability
Ubah et al. Mechanisms of SARS-CoV-2 neutralization by shark variable new antigen receptors elucidated through X-ray crystallography
Freedman et al. Computational prediction of the heterodimeric and higher-order structure of gpE1/gpE2 envelope glycoproteins encoded by hepatitis C virus
Delgado et al. Extracellular loops of the Treponema pallidum FadL orthologs TP0856 and TP0858 elicit IgG antibodies and IgG+-specific B-cells in the rabbit model of experimental syphilis
Freitas et al. Shedding light on the inhibitory mechanisms of SARS-CoV-1/CoV-2 spike proteins by ACE2-designed peptides
Watson et al. Peptide antidotes to SARS-CoV-2 (COVID-19)
Havranek et al. A computationally designed ACE2 decoy has broad efficacy against SARS-CoV-2 omicron variants and related viruses in vitro and in vivo
Lapelosa et al. In silico vaccine design based on molecular simulations of rhinovirus chimeras presenting HIV-1 gp41 epitopes
Delgado-Cunningham et al. Structure of the divergent human astrovirus MLB capsid spike
Jeong et al. Dendrimer-peptide conjugates for effective blockade of the interactions between SARS-CoV-2 spike protein and human ACE2 receptor
Golcuk et al. SARS-CoV-2 Delta variant decreases nanobody binding and ACE2 blocking effectivity
Nguyen et al. Interaction of SARS-CoV-2 with host cells and antibodies: experiment and simulation
US20240101647A1 (en) Sarbecovirus binders
Ke et al. Virion morphology and on-virus spike protein structures of diverse SARS-CoV-2 variants
Soriani et al. Exploiting antigenic diversity for vaccine design: the chlamydia ArtJ paradigm
Das et al. Epitope-based potential vaccine candidate for humoral and cell-mediated immunity to combat severe acute respiratory syndrome coronavirus 2 pandemic
Isaacs et al. A nanobody-based therapeutic targeting Nipah virus limits viral escape
Marzinek et al. A funneled conformational landscape governs flavivirus fusion peptide interaction with lipid membranes
Bano et al. Immunoinformatics study to explore dengue (DENV-1) proteome to design multi-epitope vaccine construct by using CD4+ epitopes
Georgoulia et al. Folding molecular dynamics simulation of a gp41-derived peptide reconcile divergent structure determinations
CN105143250A (zh) 一种改造非抗体类蛋白产生结合分子的方法、所产生的产品和一种长效glp-1受体激动剂

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21760562

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2022550908

Country of ref document: JP

Kind code of ref document: A

Ref document number: 3172878

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021760562

Country of ref document: EP

Effective date: 20220926

ENP Entry into the national phase

Ref document number: 2021227918

Country of ref document: AU

Date of ref document: 20210225

Kind code of ref document: A

WWW Wipo information: withdrawn in national office

Ref document number: 1020227033145

Country of ref document: KR

WWW Wipo information: withdrawn in national office

Ref document number: 295863

Country of ref document: IL