WO2021168298A1 - Inhibitory chimeric receptor architectures - Google Patents

Inhibitory chimeric receptor architectures Download PDF

Info

Publication number
WO2021168298A1
WO2021168298A1 PCT/US2021/018847 US2021018847W WO2021168298A1 WO 2021168298 A1 WO2021168298 A1 WO 2021168298A1 US 2021018847 W US2021018847 W US 2021018847W WO 2021168298 A1 WO2021168298 A1 WO 2021168298A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
chimeric
cell
intracellular signaling
receptor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/018847
Other languages
English (en)
French (fr)
Other versions
WO2021168298A9 (en
Inventor
Russell Morrison GORDLEY
Marcela GUZMAN AYALA
Gary Lee
Nicholas FRANKEL
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Senti Biosciences Inc
Original Assignee
Senti Biosciences Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Senti Biosciences Inc filed Critical Senti Biosciences Inc
Priority to EP21756389.9A priority Critical patent/EP4107174A4/en
Priority to JP2022549811A priority patent/JP2023515471A/ja
Priority to CN202180021605.7A priority patent/CN115298209A/zh
Publication of WO2021168298A1 publication Critical patent/WO2021168298A1/en
Priority to US17/820,804 priority patent/US20230272037A1/en
Anticipated expiration legal-status Critical
Publication of WO2021168298A9 publication Critical patent/WO2021168298A9/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/15Natural-killer [NK] cells; Natural-killer T [NKT] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4203Receptors for growth factors
    • A61K40/4205Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4214Receptors for cytokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4221CD20
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4256Tumor associated carbohydrates
    • A61K40/4257Mucins, e.g. MUC-1
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70539MHC-molecules, e.g. HLA-molecules
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/7056Lectin superfamily, e.g. CD23, CD72
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596Molecules with a "CD"-designation not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/82Translation products from oncogenes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/22Intracellular domain
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/27Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
    • A61K2239/28Expressing multiple CARs, TCRs or antigens
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/41Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a Myc-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/43Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a FLAG-tag

Definitions

  • Chimeric antigen receptors enable targeted in vivo activation of immunomodulatory cells, such as T cells.
  • T cells These recombinant membrane receptors have an antigen-binding domain and one or more signaling domains (e.g ., T cell activation domains).
  • T cell activation domains e.g ., T cell activation domains.
  • T cell activation domains e.g ., T cell activation domains.
  • Inhibitory chimeric antigen receptors are protein constructions that inhibit or reduce immunomodulatory cell activity after binding their cognate ligands on a target cell.
  • Current iCAR designs leverage PD-1 intracellular domains for inhibition, but have proven difficult to reproduce. Thus, alternative inhibitory domains for use in iCARs are needed.
  • chimeric inhibitory receptors comprising: an extracellular protein-binding domain; a transmembrane domain, wherein the transmembrane domain is operably linked to the extracellular protein-binding domain; and one or more intracellular signaling domains, wherein the one or more intracellular signaling domains are operably linked to the transmembrane domain, and wherein at least one of the one or more intracellular signaling domain is capable of preventing, attenuating, or inhibiting activation of a tumor targeting chimeric receptor expressed on an immunomodulatory cell.
  • the one or more intracellular signaling domains are each derived from a protein selected from the group consisting of: SLAP1, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRPa, HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
  • the transmembrane domain is derived from the same protein as one of the one or more intracellular signaling domains.
  • the transmembrane domain further comprises at least a portion of an extracellular domain of the same protein.
  • the transmembrane domain is derived from a first protein and the one or more intracellular signaling domains are derived from a second protein that are distinct from the first protein.
  • one of the one or more intracellular signaling domains are derived from SLAP1.
  • the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • the intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domains is derived from SLAP2.
  • the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • RK SLP SP SL S S S VQGQGP VTME AERSK AT A V ALGSFP AGGP AEL SLRLGEPLTI V SED GD WWT VL SE V S GREYNIP S VH V AK V SHGWL YEGL SREK AEELLLLPGNPGGAFLIRE SQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELA DDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFSEAATGEESLLSE GLRE SL SF YISLNDE A V SLDD A (SEQ ID NO: 6).
  • the intracellular signaling domain comprises the amino acid sequence of
  • RK SLP SP SL S S S VQGQGP VTME AERSK AT A V ALGSFP AGGP AEL SLRLGEPLTI V SED GD WWT VL SE V S GREYNIP S VH V AK V SHGWL YEGL SREK AEELLLLPGNPGGAFLIRE SQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELA DDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFSEAATGEESLLSE GLRE SL SF YISLNDE A V SLDD A (SEQ ID NO: 6).
  • one of the one or more intracellular signaling domains is derived from KIR2DL1.
  • the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to HRW C SNKKNAAVMDQES AGNRT AN SED SDEQDPQEVT YTQLNHC VFTQRKITRP S QRPKTPPTDIIVYTELPNAESRSKVVSCP (SEQ ID NO: 60).
  • the intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domains is derived from KLRG-1.
  • the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLGSG (SEQ ID NO: 61).
  • the intracellular signaling domain comprises the amino acid sequence of MTDS VIY SMLELPT ATQ AQND Y GPQQKS S S SRPSCSCLGSG (SEQ ID NO: 61).
  • one of the one or more intracellular signaling domains is derived from LAIRl .
  • the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to HRQN QIKQ GPPRSKDEEQKPQQRPDL A VD VLERT ADK AT VN GLPEKDRETDT S AL A AGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH (SEQ ID NO:
  • the intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domains is derived from LIR2.
  • the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to LRHRRQGKHWT S T QRK ADF QHP AGA V GPEPTDRGLQ WRS SP AAD AQEENL Y A A VK DTQPEDGVEMDTRAAASEAPQD VT Y AQLHSLTLRRK ATEPPP SQEREPP AEP SIY ATL AIH (SEQ ID NO: 63).
  • the intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domains is derived from LIR3.
  • the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to RRQRHSKHRT SDQRKTDF QRP AGAAETEPKDRGLLRRS SP AAD VQEENL Y AAVKDT Q SEDRVELD SQ SPHDEDPQ AVT Y AP VKHS SPRREMASPP S SL SGEFLDTKDRQ VEED RQMDTEAAASE ASQD VT Y AQLHSLTLRRK ATEPPP SQEGEPP AEP SIY ATL AIH (SEQ ID NO: 64).
  • the intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domains is derived from LIR5.
  • the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to QHWRQGKHRTL AQRQADF QRPPGAAEPEPKDGGLQRRS SP AAD VQGENF C AAVKN TQPEDGVEMDTRQSPHDEDPQAVTYAKVKHSRPRREMASPPSPLSGEFLDTKDRQA EEDRQMDTEAAASEAPQD VT Y AQLHSFTLRQK ATEPPP SQEGASP AEP S VY ATL AIH (SEQ ID NO: 65).
  • the intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domains is derived from SIGLEC-2.
  • the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to KLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISY TTLRFPEMNIPRT GD AES SEMQRPPPDCDDT VT Y S ALHKRQ V GD YENVIPDFPEDEGI HY SELIQF GVGERPQ AQENVD Y VILKH (SEQ ID NO: 66).
  • the intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domains is derived from SIGLEC-10.
  • the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to KILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSP E SKKN QKKQ Y QLP SFPEPK S S T Q APE S QES QEELH Y ATLNFPGVRPRPE ARMPKGT Q ADYAEVKFQ (SEQ ID NO: 67).
  • the intracellular signaling domain comprises the amino acid sequence of
  • KILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSP E SKKN QKKQ Y QLP SFPEPK S S T Q APE S QES QEELH Y ATLNFPGVRPRPE ARMPKGT Q ADYAEVKFQ (SEQ ID NO: 67).
  • the transmembrane domain is derived from a protein selected from the group consisting of: CD8, CD28, O ⁇ 3z, CD4, 4-IBB, 0X40, ICOS, 2B4, CD25, CD7, LAX, LAT, LAIRl, GRB-2, Dok-1, Dok-2, SLAP1, SLAP2, CD200R, SIRPa, HAVR,
  • GITR GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
  • the chimeric inhibitory receptor comprises a transmembrane domain derived from CD28.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to FWVLVVVGGVLACY SLLVTVAFIIFWV (SEQ ID NO: 20).
  • the transmembrane domain comprises the amino acid sequence of FWVLVVVGGVLACY SLLVTVAFIIFWV (SEQ ID NO: 20).
  • the chimeric inhibitory receptor comprises a transmembrane domain derived from KIR2DL1.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to ILIGTSVVIILFILLFFLL (SEQ ID NO: 76).
  • the transmembrane domain comprises the amino acid sequence of ILIGTSVVIILFILLFFLL (SEQ ID NO: 76).
  • the chimeric inhibitory receptor comprises a transmembrane domain derived from KLRG-1.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VAIALGLLTAVLLSVLLYQWI (SEQ ID NO: 78).
  • the transmembrane domain comprises the amino acid sequence of VAIALGLLTAVLLSVLLYQWI (SEQ ID NO: 78).
  • the chimeric inhibitory receptor comprises a transmembrane domain derived from LAIR1.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to ILIGV S VVFLF CLLLL VLF CL (SEQ ID NO: 79).
  • the transmembrane domain comprises the amino acid sequence of ILIGV S VVFLF CLLLL VLF CL (SEQ ID NO: 79).
  • the chimeric inhibitory receptor comprises a transmembrane domain derived from LIR2.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VIGIL V A VVLLLLLLLFLI (SEQ ID NO: 80).
  • the transmembrane domain comprises the amino acid sequence of VIGIL V A VVLLLLLLLFLI (SEQ ID NO: 80).
  • the chimeric inhibitory receptor comprises a transmembrane domain derived from LIR3.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VLIGV S VAFVLLLFLLLFLLL (SEQ ID NO: 81).
  • the transmembrane domain comprises the amino acid sequence of VLIGV S VAFVLLLFLLLFLLL (SEQ ID NO: 81).
  • the chimeric inhibitory receptor comprises a transmembrane domain derived from LIR5.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VLIGVL V V S ILLL SLLLFLLL (SEQ ID NO: 82).
  • the transmembrane domain comprises the amino acid sequence of VLIGVL VVSILLLSLLLFLLL (SEQ ID NO: 82).
  • the chimeric inhibitory receptor comprises a transmembrane domain derived from SIGLEC-2.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to V A V GLGS CL AILIL AIC GL (SEQ ID NO: 83).
  • the transmembrane domain comprises the amino acid sequence of V A V GLGS CL AILIL AIC GL (SEQ ID NO: 83).
  • the chimeric inhibitory receptor comprises a transmembrane domain derived from SIGLEC-10.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to GAFLGIGIT ALLFLCL ALUM (SEQ ID NO: 84).
  • the transmembrane domain comprises the amino acid sequence of GAFLGIGIT ALLFLCL ALUM (SEQ ID NO: 84).
  • the one or more intracellular signaling domains are two intracellular signaling domains.
  • the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from KIR2DL1 and a second intracellular signaling domain derived from LIR2.
  • the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from KIR2DL1 and a second intracellular signaling domain derived from LIR3. [0071] In some aspects, the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from KIR2DL1 and a second intracellular signaling domain derived from LIR5.
  • the first intracellular signaling domain further comprises a transmembrane domain derived from KIR2DL1.
  • the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from LIR2 and a second intracellular signaling domain derived from KIR2DL1.
  • first intracellular signaling domain further comprises a transmembrane domain derived from LIR2.
  • the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from LIR3 and a second intracellular signaling domain derived from KIR2DL1.
  • the first intracellular signaling domain further comprises a transmembrane domain derived from LIR3.
  • the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from LIR5 and a second intracellular signaling domain derived from KIR2DL1.
  • the first intracellular signaling domain further comprises a transmembrane domain derived from LIR5.
  • the protein is not expressed on the target tumor.
  • the protein is expressed on a non-tumor cell.
  • the protein is expressed on a non-tumor cell derived from a tissue selected from the group consisting of brain, neuronal tissue, endocrine, endothelial, bone, bone marrow, immune system, muscle, lung, liver, gallbladder, pancreas, gastrointestinal tract, kidney, urinary bladder, male reproductive organs, female reproductive organs, adipose, soft tissue, and skin.
  • a tissue selected from the group consisting of brain, neuronal tissue, endocrine, endothelial, bone, bone marrow, immune system, muscle, lung, liver, gallbladder, pancreas, gastrointestinal tract, kidney, urinary bladder, male reproductive organs, female reproductive organs, adipose, soft tissue, and skin.
  • the extracellular protein binding domain comprises a ligand-binding domain.
  • the extracellular protein binding domain comprises a receptor binding domain.
  • the extracellular protein binding domain comprises an antigen binding domain.
  • the antigen-binding domain comprises an antibody, an antigen binding fragment of an antibody, a F(ab) fragment, a F(ab') fragment, a single chain variable fragment (scFv), or a single-domain antibody (sdAb).
  • the antigen-binding domain comprises a single chain variable fragment (scFv).
  • each scFv comprises a heavy chain variable domain (VH) and a light chain variable domain (VL).
  • VH and VL are separated by a peptide linker.
  • the peptide linker comprises an amino acid sequence selected from the group consisting of: GGS (SEQ ID NO: 23), GGSGGS (SEQ ID NO: 24), GGSGGSGGS (SEQ ID NO: 25), GGS GGS GGS GGS (SEQ ID NO: 26),
  • GGGGS GGGGS GGGGS GGGGS (SEQ ID NO: 37), and
  • TTTPAPRPPTPAPTIALQPLSLRPEACRPAAGGAVHTRGLDFACDQTTPGERSSLPAFY PGTSGSCSGCGSLSLP SEQ ID NO: 94.
  • the scFv comprises the structure VH-L-VL or VL-L-VH, wherein VH is the heavy chain variable domain, L is the peptide linker, and VL is the light chain variable domain.
  • the transmembrane domain is physically linked to the extracellular protein-binding domain.
  • one of the one or more intracellular signaling domain is physically linked to the transmembrane domain.
  • the transmembrane domain is physically linked to the extracellular protein binding domain and one of the one or more intracellular signaling domains is physically linked to the transmembrane domain.
  • the extracellular protein binding has a high binding affinity.
  • the extracellular protein binding has a low binding affinity.
  • the chimeric inhibitory receptor is capable of suppressing cytokine production from an activated immunomodulatory cell.
  • the chimeric inhibitory receptor is capable of suppressing a cell- mediated immune response to a target cell, wherein the immune response is induced by activation of the immunomodulatory cell.
  • the target cell is a tumor cell.
  • the one or more intracellular signaling domains comprises one or more modifications.
  • the one or more modifications modulate sensitivity of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • the one or more modifications increase sensitivity of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • the one or more modifications reduce sensitivity of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • the one or more modifications modulate potency of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • the one or more modifications increase potency of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • the one or more modifications reduce potency of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • the one or more modifications modulate basal prevention, attenuation, or inhibition of activation of the tumor-targeting chimeric receptor when expressed on an immunomodulatory cell relative to the otherwise identical, unmodified receptor.
  • the one or more modifications reduce basal prevention, attenuation, or inhibition relative to the otherwise identical, unmodified receptor.
  • the one or more modifications increase basal prevention, attenuation, or inhibition relative to the otherwise identical, unmodified receptor.
  • the chimeric inhibitory receptor further comprises a spacer region positioned between the extracellular protein binding domain and the transmembrane domain and operably linked to each of the extracellular protein -binding domain and the transmembrane domain.
  • the chimeric inhibitory receptor further comprises a spacer region positioned between the extracellular protein binding domain and the transmembrane domain and physically linked to each of the extracellular protein binding domain and the transmembrane domain.
  • the spacer region is derived from a protein selected from the group consisting of: CD8a, CD4, CD7, CD28, IgGl, IgG4, FcyRIIIa, LNGFR, and PDGFR.
  • the spacer region comprises an amino acid sequence selected from the group consisting of:
  • a A AIEVM YPPP YLDNEK SN GTIIH VKGKHLCP SPLFPGP SKP (SEQ ID NO: 39), ESKYGPPCPSCP (SEQ ID NO: 40), ESKYGPPAPSAP (SEQ ID NO: 41), ESKYGPPCPPCP (SEQ ID NO: 42), EPK S CDKTHT CP (SEQ ID NO: 43), AAAFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI YIW APL AGTCGVLLL SL VITL Y CNHRN (SEQ ID NO: 44),
  • ACPTGLYTHSGECCKACNLGEGVAQPCGANQTVC (SEQ ID NO: 47), and AVGQDTQEVIVVPHSLPFKV (SEQ ID NO: 48).
  • the spacer region modulates sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • the spacer region increases sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • the spacer region reduces sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • the spacer region modulates potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • the spacer region increases potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • the spacer region reduces potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • the spacer region modulates basal prevention, attenuation, or inhibition of activation of the tumor-targeting chimeric receptor when expressed on an immunomodulatory cell relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • the spacer region reduces basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • the spacer region increases basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • the chimeric inhibitory receptor further comprises an intracellular spacer region positioned between the transmembrane domain and one of the one or more intracellular signaling domains and operably linked to each of the transmembrane domain and one of the one or more intracellular signaling domains.
  • the chimeric inhibitory receptor further comprises an intracellular spacer region positioned between the transmembrane domain and one of the one or more intracellular signaling domains and physically linked to each of the transmembrane domain and one of the one or more intracellular signaling domains.
  • the intracellular spacer region modulates sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • the intracellular spacer region increases sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • the intracellular spacer region reduces sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • the intracellular spacer region modulates potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • the intracellular spacer region increases potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • the intracellular spacer region reduces potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region. [00130] In some aspects, the intracellular spacer region modulates basal prevention, attenuation, or inhibition of activation of the tumor-targeting chimeric receptor when expressed on an immunomodulatory cell relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • the intracellular spacer region reduces basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • the intracellular spacer region increases basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • the inhibitory chimeric receptor further comprises an enzymatic inhibitory domain.
  • the enzymatic inhibitory domain is capable of preventing, attenuating, or inhibiting activation of a tumor-targeting chimeric receptor when expressed on an immunomodulatory cell relative to an otherwise identical chimeric inhibitory receptor lacking the enzymatic inhibitory domain.
  • the enzymatic inhibitory domain comprises an enzyme catalytic domain.
  • the enzyme catalytic domain is derived from an enzyme selected from the group consisting of: CSK, SHP-1, PTEN, CD45, CD148, PTP-MEG1, PTP-PEST, c-CBL, CBL-b, PTPN22, LAR, PTPH1, SHIP-1, and RasGAP.
  • the enzymatic inhibitory domain comprises one or more modifications that modulate basal prevention, attenuation, or inhibition.
  • the one or more modifications reduce basal prevention, attenuation, or inhibition relative to an otherwise identical enzymatic inhibitory domain lacking the one or more modifications.
  • the one or more modifications increase basal prevention, attenuation, or inhibition relative to an otherwise identical enzymatic inhibitory domain lacking the one or more modifications.
  • the tumor-targeting chimeric receptor is a chimeric antigen receptor (CAR) or an engineered T cell receptor (TCR).
  • CAR chimeric antigen receptor
  • TCR engineered T cell receptor
  • the immunomodulatory cell is selected from the group consisting of: a T cell, a CD8+ T cell, a CD4+ T cell, a gamma-delta T cell, a cytotoxic T lymphocyte
  • CTL tumor-infiltrating lymphocyte
  • TIL tumor-infiltrating lymphocyte
  • the immunomodulatory cell is a Natural Killer (NK) cell.
  • NK Natural Killer
  • compositions comprising the chimeric inhibitory receptor as described herein and a pharmaceutically acceptable carrier.
  • expression vectors comprising the engineered nucleic acid as described herein.
  • composition comprising the engineered nucleic acid as described herein or the expression vector as described herein, and a pharmaceutically acceptable carrier
  • isolated immunomodulatory cells comprising the chimeric inhibitory receptor as described herein.
  • the cell further comprises a tumor-targeting chimeric receptor expressed on the surface of the cell.
  • the chimeric inhibitory receptor upon binding of the protein to the chimeric inhibitory receptor, prevents, attenuates, or inhibits activation of the tumor targeting chimeric receptor relative to an otherwise identical cell lacking a chimeric inhibitory receptor.
  • isolated immunomodulatory cells comprising a chimeric inhibitory receptor, wherein the chimeric inhibitory receptor comprises: an extracellular protein binding domain, a transmembrane domain, wherein the transmembrane domain is operably linked to the extracellular protein binding domain, and one or more intracellular signaling domains, wherein the one or more intracellular signaling domains is operably linked to the transmembrane domain, and wherein the one or more intracellular signaling domain are each derived from a protein selected from the group consisting of: SLAPl, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRPa, HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC- 2, and SIGLEC-10; and wherein upon binding of the protein to the chimeric inhibitory receptor, the chimeric inhibitory receptor comprises: an extracellular
  • isolated cells comprising: a chimeric inhibitory receptor, wherein and the chimeric inhibitory receptor comprises: an extracellular protein binding domain, a transmembrane domain, wherein the transmembrane domain is operably linked to the extracellular protein binding domain, and one or more intracellular signaling domains, wherein the one or more intracellular signaling domains are operably linked to the transmembrane domain, and wherein the one or more intracellular signaling domain are each derived from a protein selected from the group consisting of: SLAP1, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRPa, HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10; and a tumor-targeting chimeric receptor expressed on the surface of the cell, wherein upon binding
  • the chimeric inhibitory receptor is recombinantly expressed.
  • the chimeric inhibitory receptor is expressed from a vector or a selected locus from the genome of the cell.
  • the tumor-targeting chimeric receptor is a chimeric antigen receptor (CAR) or an engineered T cell receptor.
  • CAR chimeric antigen receptor
  • the tumor-targeting chimeric receptor prior to binding of the protein to the chimeric inhibitory receptor, is capable of activating the cell.
  • the chimeric inhibitory receptor upon binding of the protein to the chimeric inhibitory receptor, suppresses cytokine production from the activated cell. [00158] In some aspects, upon binding of the protein to the chimeric inhibitory receptor, the chimeric inhibitory receptor suppresses a cell-mediated immune response to a target cell, wherein the immune response is induced by activation of the immunomodulatory cell.
  • the transmembrane domain is physically linked to the extracellular protein binding domain.
  • the intracellular signaling domain is physically linked to the transmembrane domain.
  • the transmembrane domain is physically linked to the extracellular protein binding domain and one of the one or more intracellular signaling domains is physically linked to the transmembrane domain.
  • the target cell is a tumor cell.
  • the cell is selected from the group consisting of: a T cell, a CD8+ T cell, a CD4+ T cell, a gamma-delta T cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a viral-specific T cell, a Natural Killer T (NKT) cell, a Natural Killer (NK) cell, a B cell, a tumor-infiltrating lymphocyte (TIL), an innate lymphoid cell, a mast cell, an eosinophil, a basophil, a neutrophil, a myeloid cell, a macrophage, a monocyte, a dendritic cell, an ESC- derived cell, and an iPSC-derived cell.
  • the immunomodulatory cell is a Natural Killer (NK) cell.
  • NK Natural Killer
  • the cell is autologous.
  • the cell is allogeneic.
  • compositions comprising the isolated cell as described herein and a pharmaceutically acceptable carrier.
  • Also provided herein are methods of preventing, attenuating, or inhibiting a cell- mediated immune response induced by a tumor-targeting chimeric receptor expressed of the surface of an immunomodulatory cell comprising: engineering the immunomodulatory cell to express the chimeric inhibitory receptor of any one of claims 1-75 on the surface of the immunomodulatory cell, wherein upon binding of a cognate antigen to the chimeric inhibitory receptor, the intracellular signaling domain prevents, attenuates, or inhibits activation of the tumor-targeting chimeric receptor.
  • Also provided herein are methods of preventing, attenuating, or inhibiting activation of a tumor-targeting chimeric receptor expressed on the surface of an immunomodulatory cell comprising: contacting the isolated cell as described herein or the composition as described herein with a cognate antigen of the chimeric inhibitory receptor under conditions suitable for the chimeric inhibitory receptor to bind the cognate antigen, wherein upon binding of the antigen to the chimeric inhibitory receptor, the intracellular signaling domain prevents, attenuates, or inhibits activation of the tumor-targeting chimeric receptor.
  • the tumor-targeting chimeric receptor is a chimeric antigen receptor (CAR) or an engineered T cell receptor.
  • CAR chimeric antigen receptor
  • the CAR binds one or more antigens expressed on the surface of a tumor cell.
  • FIG. 1A shows an exemplary diagram of a T cell co-expressing an anti-CD 19- SLAP iCAR and an anti-CD20-CD28AHI ⁇ aCAR contacting a target cell expressing CD19 and CD20.
  • FIG. IB shows negative control cells with no expression of either CAR construct.
  • FIG. 1C shows anti-CD20-CD28AHI ⁇ aCAR expression in transduced T cells.
  • FIG. ID shows hh ⁇ 20-EO28L2O3z aCAR and anti-CD 19-SLAP iCAR expression in transduced T cells.
  • FIG. 2A shows TNF-a production by T cells is reduced by co-expression of an anti-CD20 aCAR and an anti -CD 19 iCAR as compared to an anti-CD20 aCAR alone.
  • FIG. 2B shows IFN-g production by T cells is reduced by co-expression of an anti-CD20 aCAR and an anti-CD 19 iCAR as compared to an anti-CD20 aCAR alone.
  • FIG. 2C shows IL-2 production by T cells is reduced by co-expression of an anti-CD20 aCAR and an anti -CD 19 iCAR as compared to an anti-CD20 aCAR alone.
  • FIG. 3 shows expression profiles of an anti-FLT3 aCAR and various iCAR formats with an anti-EMCN binding domain, including co-expression, following transduction of NK cells as assessed by flow cytometry. Between 1 and 3 biological replicates per condition (indicated as separate points).
  • inhibitory chimeric receptor or “inhibitory chimeric antigen receptor” or “chimeric inhibitory receptor” as used herein refers to a polypeptide or a set of polypeptides, which when expressed in an immune effector cell, provides the cell with specificity for a target cell, and with inhibitory intracellular signal generation.
  • Inhibitory chimeric receptors typically include an extracellular protein binding domain (e.g ., antibody fragment as an antigen-binding domain), a spacer domain, a transmembrane domain, and one or more intracellular signaling/co-signaling domains.
  • An inhibitory chimeric receptor may also be called an “iCAR.”
  • tumor targeting chimeric receptor refers to activating chimeric receptors, tumor-targeting chimeric antigen receptors (CARs), or engineered T cell receptors.
  • a tumor targeting chimeric receptor may also be called an “aCAR.”
  • chimeric antigen receptor or alternatively a “CAR” as used herein refers to a polypeptide or a set of polypeptides, which when expressed in an immune effector cell, provides the cell with specificity for a target cell, and with intracellular signal generation.
  • CARs typically include an extracellular protein binding domain (e.g., antibody fragment as an antigen-binding domain), a spacer domain, a transmembrane domain, and one or more intracellular signaling/co-signaling domains.
  • a CAR comprises at least an extracellular antigen binding domain, a transmembrane domain and a cytoplasmic signaling domain (also referred to herein as "an intracellular signaling domain") comprising a functional signaling domain derived from a inhibitory molecule or a stimulatory molecule and/or costimulatory molecule.
  • the set of polypeptides that comprise the inhibitory chimeric receptor or tumor targeting chimeric receptor are contiguous with each other.
  • the inhibitory chimeric receptor or tumor targeting chimeric receptor further comprises a spacer domain between the extracellular antigen binding domain and the transmembrane domain.
  • an inhibitory chimeric receptor comprises a chimeric fusion protein comprising an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from an inhibitory molecule or a stimulatory molecule.
  • an inhibitory chimeric receptor comprises a chimeric fusion protein comprising an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising a functional inhibitory domain derived from an inhibitory molecule.
  • a tumor targeting chimeric receptor comprises a chimeric fusion protein comprising an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a costimulatory molecule and a functional signaling domain derived from a stimulatory molecule.
  • intracellular signaling domain refers to a functional domain of the inhibitory chimeric receptor or the tumor targeting chimeric receptor located inside the cell.
  • the intracellular signaling domain is an inhibitory signaling domain.
  • an inhibitory signaling domain represses receptor signaling while an activation signaling domain transmits a signal (e.g ., proliferative/survival signal) to the cell.
  • transmembrane domain refers to a domain that spans a cellular membrane.
  • a transmembrane domain comprises a hydrophobic alpha helix.
  • extracellular protein binding domain refers to a molecular binding domain which is typically an ectodomain of a cell receptor or the antigen binding domains of an antibody and is located outside the cell, exposed to the extracellular space.
  • An extracellular antigen binding domain can include any molecule (e.g., protein or peptide) capable of binding to another protein or peptide.
  • an extracellular protein or antigen binding domain comprises an antibody, an antigen-binding fragment thereof, F(ab), F(ab’), a single chain variable fragment (scFv), or a single-domain antibody (sdAb).
  • an extracellular protein or antigen binding domain binds to a cell-surface ligand (e.g, an antigen, such as a cancer antigen or a protein expressed on the surface of a cell).
  • tumor refers to tumor cells and the associated tumor microenvironment (TME).
  • TEE tumor microenvironment
  • tumor refers to a tumor cell or tumor mass.
  • tumor refers to the tumor microenvironment.
  • the term “not expressed” refers to expression that is at least 2-fold lower than the level of expression in non-tumor cells that would result in activation of the tumor-targeting chimeric antigen receptor. In some embodiments, the expression is at least 2-fold, at least 3- fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9- fold, or at least 10-fold or more lower than the level of expression in non-tumor cells that would result in activation of the tumor-targeting chimeric antigen receptor.
  • the term “ameliorating” refers to any therapeutically beneficial result in the treatment of a disease state, e.g, a cancer disease state, including prophylaxis, lessening in the severity or progression, remission, or cure thereof.
  • a disease state e.g, a cancer disease state
  • prophylaxis e.g., a cancer disease state
  • in situ refers to processes that occur in a living cell growing separate from a living organism, e.g. , growing in tissue culture.
  • in vivo refers to processes that occur in a living organism.
  • mammal as used herein includes both humans and non-humans and include but is not limited to humans, non-human primates, canines, felines, murines, bovines, equines, and porcines.
  • percent “identity,” in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection.
  • sequence comparison algorithms e.g., BLASTP and BLASTN or other algorithms available to persons of skill
  • the percent “identity” can exist over a region of the sequence being compared, e.g, over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
  • sequence comparison typically one sequence acts as a reference sequence to which test sequences are compared.
  • test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
  • sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
  • Optimal alignment of sequences for comparison can be conducted, e.g, by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al., infra).
  • the term “sufficient amount” means an amount sufficient to produce a desired effect, e.g., an amount sufficient to modulate protein aggregation in a cell.
  • the term “therapeutically effective amount” is an amount that is effective to ameliorate a symptom of a disease.
  • a therapeutically effective amount can be a “prophylactically effective amount” as prophylaxis can be considered therapy.
  • chimeric inhibitory receptors comprising (i) an extracellular protein binding domain; (ii) a transmembrane domain, wherein the transmembrane domain is operably linked to the extracellular protein binding domain; and (iii) one or more intracellular signaling domains, wherein the one or more intracellular signaling domains are operably linked to the transmembrane domain, and wherein at least one of the one or more intracellular signaling domains is capable of preventing, attenuating, or inhibiting activation of a tumor-targeting chimeric receptor expressed on an immunomodulatory cell.
  • an inhibitory or tumor targeting chimeric receptor is designed for a T cell, or NK cell, and is a chimera of an intracellular signaling domain and an antigen recognizing domain (e.g ., a single chain fragment (scFv) of an antibody) (Enblad etal., Human Gene Therapy. 2015; 26(8):498-505).
  • a T cell that expresses a chimeric antigen receptor (CAR) is known in the art as a CAR T cell.
  • An activating or tumor targeting CAR generally induces T cell signaling pathways upon binding to its cognate ligand via an intracellular signaling domain that results in activation of the T cell and an immune response.
  • An inhibitory chimeric receptor generally, is an artificial immune cell receptor engineered to recognize and bind to proteins expressed by cells. Inhibitory chimeric receptors generally recognize proteins that are not expressed on tumor cells, while activating or tumor targeting chimeric receptors (e.g., aCARs) generally recognize proteins that are expressed on tumor cells. Chimeric receptors in general typically include an antibody fragment as an extracellular protein binding domain, a spacer or hinge domains, a hydrophobic alpha helix transmembrane domain, and one or more intracellular signaling/co-signaling domains.
  • An inhibitory chimeric receptor generally follows the structure of activating CARs (aCARs) but uses an inhibitory domain for the intracellular signaling domain, instead of an activation signaling domain derived from a T-cell receptor (TCR).
  • the intracellular signaling/co-signaling domain are inhibitory domains that reduce or inhibit signaling by other receptor proteins in the same cell.
  • An inhibitory chimeric receptor cell can contain an antigen-specific inhibitory receptor, for example, to block nonspecific immunoactivation, which may result from extra-tumor target expression.
  • an inhibitory chimeric receptor blocks T cell responses in T cells activated by either their endogenous T cell receptor or an activating or tumor-targeting CAR.
  • an immunomodulatory cell can express both an inhibitory chimeric receptor that recognizes a non-tumor protein target and a tumor-targeting chimeric receptor that recognizes a tumor protein.
  • an immunomodulatory cell contacts a tumor cell, only the tumor-targeting receptor recognizes and binds its cognate ligand and is activated, resulting in induction of cell signaling pathways and immune cell activation.
  • the inhibitory chimeric receptor binds to its cognate ligand and represses or inhibits any signaling induced by the activation of the tumor-targeting chimeric receptor.
  • the immunomodulatory cell can be constructed so that immune signaling only occurs when the cell contacts tumor cells.
  • the protein bound by the inhibitory chimeric receptor is not expressed on the target tumor.
  • the expression is at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9- fold, or at least 10-fold or more lower than the level of expression in non-tumor cells that would result in activation of the tumor-targeting chimeric antigen receptor.
  • the protein bound by the inhibitory chimeric receptor is expressed on a non-tumor cell.
  • the protein bound by the inhibitory chimeric receptor is expressed on a non-tumor cell derived from a tissue selected from the group consisting of brain, neuronal tissue, endocrine, endothelial, bone, bone marrow, immune system, muscle, lung, liver, gallbladder, pancreas, gastrointestinal tract, kidney, urinary bladder, male reproductive organs, female reproductive organs, adipose, soft tissue, and skin.
  • a tissue selected from the group consisting of brain, neuronal tissue, endocrine, endothelial, bone, bone marrow, immune system, muscle, lung, liver, gallbladder, pancreas, gastrointestinal tract, kidney, urinary bladder, male reproductive organs, female reproductive organs, adipose, soft tissue, and skin.
  • the inhibitory chimeric receptors of the present disclosure comprise intracellular signaling domains that are capable of preventing, attenuating, or inhibiting activation of a tumor-targeting chimeric receptor expressed on an immunomodulatory cell.
  • the chimeric inhibitory receptor comprises one or more intracellular signaling domains.
  • the intracellular signaling domain comprises one or more modifications.
  • the one or more modifications modulate sensitivity of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • the one or more modifications increase sensitivity of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • the one or more modifications reduce sensitivity of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor. In some embodiments, the one or more modifications modulate potency of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor. In some embodiments, the one or more modifications increase potency of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor. In some embodiments, the one or more modifications reduce potency of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • the one or more modifications modulate basal prevention, attenuation, or inhibition of activation of the tumor-targeting chimeric receptor expressed on an immunomodulatory cell relative to the otherwise identical, unmodified receptor. In some embodiments, the one or more modifications reduce basal prevention, attenuation, or inhibition relative to the otherwise identical, unmodified receptor. In some embodiments, the one or more modifications increase basal prevention, attenuation, or inhibition relative to the otherwise identical, unmodified receptor.
  • the inhibitory intracellular signaling domain is derived from a protein selected from the group consisting of: SLAP1, SLAP2, LAIR1, GRB-2, Dok- 1, Dok-2, CD200R, SIRPalpha (SIRPa), HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
  • the inhibitory chimeric receptor described herein comprises an inhibitory intracellular signaling domain.
  • the inhibitory intracellular signaling domain is a SLAP1 domain.
  • the SLAP1 domain comprises amino acid residues 8-276 of the full length SLAP1 protein. In some embodiments, the SLAP1 domain comprises amino acid residues 8-247 of the full length SLAP1 protein. In some embodiments, the SLAP1 domain comprises amino acid residues 8- 261 of the full length SLAP1 protein.
  • the inhibitory intracellular signaling domain is a SLAP2 domain. In some embodiments, the inhibitory intracellular signaling domain is a Dok-2 domain. In some embodiments, the inhibitory intracellular signaling domain is a Dok-1 domain. In some embodiments, the inhibitory intracellular signaling domain is a GRB2 domain. In some embodiments, the inhibitory intracellular signaling domain is a CD200R domain. In some embodiments, the inhibitory intracellular signaling domain is a SIRPa domain.
  • Src-like adaptor proteins 1 and 2 are adaptor proteins involved in intracellular signaling pathways and are expressed in lymphocytes. Both SLAP1 and SLAP2 contain common SH2 and SH3 domains. SH2 domains allow proteins to bind to phosphorylated tyrosine epitopes. SLAP1 and SLAP2 function as negative regulators of T cell receptor (TCR) signaling, likely by associating with the E3 ubiquitin ligase c-Cbl, which promotes the ubiquitination and degradation of the TCR z-chain, resulting in decreased TCR signaling.
  • TCR T cell receptor
  • Docking protein 2 (Dok-2) is part of a negative signaling complex in T cells. Docking protein 1 (Dok-1) is part of the negative regulation of the insulin receptor signaling pathway.
  • Growth factor receptor-bound protein 2 (GRB2) is an adaptor protein involved in signal transduction and contains one SH2 domain and two SH3 domains.
  • Signal-regulator protein alpha (SIRPa) is an inhibitory receptor that contains four immunoreceptor tyrosine- based inhibition motifs (ITIMs).
  • Cell surface transmembrane glycoprotein CD200 receptor 1 (CD200R) is involved in signaling pathways that regulate the expression of pro-inflammatory molecules and associates with Dok-1 and Dok-2.
  • Exemplary inhibitory intracellular signaling domain amino acid sequences are shown in Table 1.
  • Exemplary inhibitory intracellular signaling domain nucleic acid sequences are shown in Table 2.
  • one of the one or more intracellular signaling domains is derived from a protein selected from the group consisting of: SLAP1, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRPa, HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
  • the transmembrane domain is derived from the same protein as one of the one or more intracellular signaling domains.
  • the transmembrane domain is derived from a first protein and one of the one or more the intracellular signaling domains is derived from a second protein that is distinct from the first protein.
  • one of the one or more intracellular signaling domains is derived from SLAP1.
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • one of the one or more intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domain is derived from SLAP2.
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • RK SLP SP SL S S S VQGQGP VTME AERSK AT A V ALGSFP AGGP AEL SLRLGEPLTI V SED GD WWT VL SE V S GREYNIP S VH V AK V SHGWL YEGL SREK AEELLLLPGNPGGAFLIRE SQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELA DDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFSEAATGEESLLSE GLRE SL SF YISLNDE A V SLDD A (SEQ ID NO: 6).
  • one of the one or more intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domain is derived from KIR2DL1.
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to HRW C SNKKNAAVMDQES AGNRT AN SED SDEQDPQE VT YT QLNHC VFTQRKITRP S QRPKTPPTDIIVYTELPNAESRSKVVSCP (SEQ ID NO: 60).
  • one of the one or more intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domain is derived from KLRG-1.
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • one of the one or more intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domain is derived from LAIRl .
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • one of the one or more intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domain is derived from LIR2. [00229] In some embodiments, one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • one of the one or more intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domain is derived from LIR3.
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • one of the one or more intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domain is derived from LIR5.
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • one of the one or more intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domain is derived from SIGLEC-2.
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • one of the one or more intracellular signaling domain comprises the amino acid sequence of
  • one of the one or more intracellular signaling domain is derived from SIGLEC-10.
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • KILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSP E SKKN QKKQ Y QLP SFPEPK S S T Q APE S QES QEELH Y ATLNFPGVRPRPE ARMPKGT Q ADYAEVKFQ (SEQ ID NO: 67).
  • one of the one or more intracellular signaling domain comprises the amino acid sequence of
  • KILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSP E SKKN QKKQ Y QLP SFPEPK S S T Q APE S QES QEELH Y ATLNFPGVRPRPE ARMPKGT Q ADYAEVKFQ (SEQ ID NO: 67).
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 2.
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 4.
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about
  • one of the one or more intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 8.
  • the transmembrane domain and one of the one or more intracellular signaling domain are derived from the same protein. In some embodiments, the transmembrane domain is derived from a first protein and one of the one or more intracellular signaling domain is derived from a second protein that is distinct from the first protein.
  • the inhibitory chimeric receptor comprises an enzymatic inhibitory domain.
  • the enzymatic inhibitory domain is also capable of preventing, attenuating, or inhibiting activation of a chimeric receptor when expressed on an immunomodulatory cell relative to an otherwise identical chimeric inhibitory receptor lacking the enzymatic inhibitory domain.
  • the enzymatic inhibitory domain comprises an enzyme catalytic domain.
  • the enzyme catalytic domain is derived from an enzyme selected from the group consisting of: CSK, SHP-1, PTEN, CD45, CD148, PTP- MEG1, PTP-PEST, c-CBL, CBL-b, PTPN22, LAR, PTPH1, SHIP-1, and RasGAP.
  • the enzymatic inhibitory domain comprises one or more modifications that modulate basal prevention, attenuation, or inhibition relative to an otherwise identical enzymatic inhibitory domain lacking the one or more modifications.
  • the one or more modifications reduce basal prevention, attenuation, or inhibition relative to an otherwise identical enzymatic inhibitory domain lacking the one or more modifications.
  • the one or more modifications increase basal prevention, attenuation, or inhibition relative to an otherwise identical enzymatic inhibitory domain lacking the one or more modifications.
  • a cell disclosed herein can further comprise at least one tumor-targeting chimeric receptor or T cell receptor comprising an activating intracellular domain or a co-stimulatory intracellular domain.
  • the cell comprises at least one inhibitory chimeric receptor and at least one tumor-targeting chimeric receptor.
  • the cell can comprise at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 or more tumor-targeting CARs and at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 or more inhibitory chimeric receptors.
  • the activating signaling domain is a CD3-zeta protein, which includes three immunoreceptor tyrosine-based activation motifs (IT AMs).
  • Other examples of activating signaling domains include CD28, 4-1BB, and 0X40.
  • a cell receptor comprises more than one activating signaling domain, each referred to as a co-stimulatory domain.
  • the tumor-targeting chimeric receptor is a chimeric antigen receptor (CAR) or an engineered T cell receptor.
  • the CAR binds one or more proteins expressed on the surface of a tumor cell.
  • the tumor-targeting chimeric receptor prior to binding of the protein to the chimeric inhibitory receptor, is capable of activating the cell.
  • the inhibitory chimeric receptors can contain transmembrane domains that link the protein binding domain to the intracellular domain. Different transmembrane domains result in different receptor stability. Suitable transmembrane domains include, but are not limited to, CD8, CD28, CD3zeta, CD4, 4-IBB, 0X40, ICOS, 2B4, CD25, CD7, LAX, LAT, LAIR1, GRB-2, Dok-1, Dok-2, SLAPl, SLAP2, CD200R, SIRPalpha, HAVR, GITR, PD- Ll, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
  • the transmembrane domain is derived from a protein selected from the group consisting of: CD8, CD28, CD3zeta, CD4, 4-IBB, 0X40, ICOS,
  • a transmembrane domain of a cell receptor is an LAX transmembrane domain. In some embodiments, a transmembrane domain of a cell receptor is a CD28 transmembrane domain.
  • a transmembrane domain of a cell receptor is a CD25 transmembrane domain. In some embodiments, a transmembrane domain of a cell receptor is a CD7 transmembrane domain. In some embodiments, a transmembrane domain of a cell receptor is an LAT transmembrane domain. In some embodiments, a transmembrane domain of a cell receptor is a SIRPa transmembrane domain. [00254] In some embodiments, the transmembrane domain and the intracellular signaling domain are derived from the same protein.
  • the transmembrane domain is derived from a first protein and the intracellular signaling domain is derived from a second protein that is distinct from the first protein, wherein the chimeric inhibitory receptor comprises a transmembrane domain is derived from CD28.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO:20).
  • the transmembrane domain comprises the amino acid sequence of FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 20).
  • the transmembrane domain and the intracellular signaling domain are derived from the same protein.
  • the transmembrane domain is derived from a first protein and the intracellular signaling domain is derived from a second protein that is distinct from the first protein, wherein the chimeric inhibitory receptor comprises a transmembrane domain is derived from KIR2DL1.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to ILIGTSVVIILFILLFFLL (SEQ ID NO:76).
  • the transmembrane domain comprises the amino acid sequence of ILIGTSVVIILFILLFFLL (SEQ ID NO: 76).
  • the transmembrane domain and the intracellular signaling domain are derived from the same protein.
  • the transmembrane domain is derived from a first protein and the intracellular signaling domain is derived from a second protein that is distinct from the first protein, wherein the chimeric inhibitory receptor comprises a transmembrane domain is derived from KLRG-1.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about
  • the transmembrane domain comprises the amino acid sequence of VAIALGLLTAVLLSVLLYQWI (SEQ ID NO: 78).
  • the transmembrane domain and the intracellular signaling domain are derived from the same protein.
  • the transmembrane domain is derived from a first protein and the intracellular signaling domain is derived from a second protein that is distinct from the first protein, wherein the chimeric inhibitory receptor comprises a transmembrane domain is derived from LAIR1.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to ILIGV S VVFLF CLLLLVLF CL (SEQ ID NO: 79).
  • the transmembrane domain comprises the amino acid sequence of ILIGV S VVFLF CLLLLVLF CL (SEQ ID NO: 79).
  • the transmembrane domain and the intracellular signaling domain are derived from the same protein.
  • the transmembrane domain is derived from a first protein and the intracellular signaling domain is derived from a second protein that is distinct from the first protein, wherein the chimeric inhibitory receptor comprises a transmembrane domain is derived from LIR2.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VIGIL V A VVLLLLLLLLLFLI (SEQ ID NO: 80).
  • the transmembrane domain comprises the amino acid sequence of VIGIL V A VVLLLLLLLLLFLI (SEQ ID NO: 80).
  • the transmembrane domain and the intracellular signaling domain are derived from the same protein.
  • the transmembrane domain is derived from a first protein and the intracellular signaling domain is derived from a second protein that is distinct from the first protein, wherein the chimeric inhibitory receptor comprises a transmembrane domain is derived from LIR3.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about
  • the transmembrane domain comprises the amino acid sequence of VLIGV S VAFVLLLFLLLFLLL (SEQ ID NO: 81).
  • the transmembrane domain and the intracellular signaling domain are derived from the same protein.
  • the transmembrane domain is derived from a first protein and the intracellular signaling domain is derived from a second protein that is distinct from the first protein, wherein the chimeric inhibitory receptor comprises a transmembrane domain is derived from LIR5.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VLIGVL V V SILLL SLLLFLLL (SEQ ID NO: 82).
  • the transmembrane domain comprises the amino acid sequence of VLIGVL VVSILLLSLLLFLLL (SEQ ID NO: 82).
  • the transmembrane domain and the intracellular signaling domain are derived from the same protein.
  • the transmembrane domain is derived from a first protein and the intracellular signaling domain is derived from a second protein that is distinct from the first protein, wherein the chimeric inhibitory receptor comprises a transmembrane domain is derived from SIGLEC-2.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VAVGLGSCLAILILAICGL (SEQ ID NO: 83).
  • the transmembrane domain comprises the amino acid sequence of VAVGLGSCLAILILAICGL (SEQ ID NO: 83).
  • the transmembrane domain and the intracellular signaling domain are derived from the same protein.
  • the transmembrane domain is derived from a first protein and the intracellular signaling domain is derived from a second protein that is distinct from the first protein, wherein the chimeric inhibitory receptor comprises a transmembrane domain is derived from SIGLEC-10.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to GAFLGIGITALLFLCLALIIM (SEQ ID NO: 84).
  • the transmembrane domain comprises the amino acid sequence of GAFLGIGITALLFLCLALIIM (SEQ ID NO: 84).
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 16.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 17.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 18.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 19.
  • the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO:21.
  • transmembrane domain amino acid sequences are shown in Table 3.
  • Exemplary transmembrane domain nucleic acid sequences are shown in Table 4.
  • the transmembrane domain is physically linked to the extracellular protein binding domain.
  • the intracellular signaling domain is physically linked to the transmembrane domain.
  • the transmembrane domain is physically linked to the extracellular protein binding domain and the intracellular signaling domain is physically linked to the transmembrane domain.
  • the one or more intracellular signaling domains are two intracellular signaling domains.
  • the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from KIR2DL1 and a second intracellular signaling domain derived from LIR2.
  • the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from KIR2DL1 and a second intracellular signaling domain derived from LIR3. In some embodiments, the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from KIR2DL1 and a second intracellular signaling domain derived from LIR5. In some embodiments, the first intracellular signaling domain further comprises a transmembrane domain derived from KIR2DL1.
  • the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from LIR2 and a second intracellular signaling domain derived from KIR2DL1.
  • the first intracellular signaling domain further comprises a transmembrane domain derived from LIR2.
  • the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from LIR3 and a second intracellular signaling domain derived from KIR2DL1.
  • the first intracellular signaling domain further comprises a transmembrane domain derived from LIR3.
  • the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from LIR5 and a second intracellular signaling domain derived from KIR2DL1.
  • the first intracellular signaling domain further comprises a transmembrane domain derived from LIR5.
  • inhibitory chimeric receptors described herein further comprise extracellular protein binding domains.
  • immune cells expressing an inhibitory chimeric receptor are genetically modified to recognize multiple targets or antigens, which permits the recognition of unique target or protein expression patterns on tumor cells.
  • the protein is not expressed on the target tumor.
  • the expression in non-tumor cells is at least 2-fold, at least 3-fold, at least 4- fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, or at least 10- fold or more lower than the level of expression that would result in activation of the tumor targeting chimeric antigen receptor.
  • the protein is expressed on a non-tumor cell.
  • the protein is expressed on a non-tumor cell derived from a tissue selected from the group consisting of brain, neuronal tissue, endocrine, endothelial, bone, bone marrow, immune system, muscle, lung, liver, gallbladder, pancreas, gastrointestinal tract, kidney, urinary bladder, male reproductive organs, female reproductive organs, adipose, soft tissue, and skin.
  • the extracellular protein binding domain comprises a ligand-binding domain.
  • the ligand-binding domain can be a domain from a receptor, wherein the receptor is selected from the group consisting of a T cell receptor (TCR), a B cell receptor (BCR), a cytokine receptor, an RTK receptor, a serine/threonine kinase receptor, a hormone receptor, an immunoglobulin superfamily receptor, and a TNFR-superfamily receptor.
  • TCR T cell receptor
  • BCR B cell receptor
  • cytokine receptor cytokine receptor
  • RTK receptor a serine/threonine kinase receptor
  • a hormone receptor a hormone receptor
  • an immunoglobulin superfamily receptor an immunoglobulin superfamily receptor
  • TNFR-superfamily receptor TNFR-superfamily receptor
  • an extracellular protein binding domain of a inhibitory chimeric receptor of the disclosure comprises an antigen binding domain, such as a single chain Fv (scFv) specific for a tumor antigen.
  • an extracellular protein binding domain comprises an antibody, an antigen-binding fragment thereof, F(ab), F(ab’), a single chain variable fragment (scFv), or a single-domain antibody (sdAb).
  • the term "single-chain” refers to a molecule comprising amino acid monomers linearly linked by peptide bonds.
  • the C-terminus of the Fab light chain is connected to the N-terminus of the Fab heavy chain in the single-chain Fab molecule.
  • an scFv has a variable domain of light chain (VL) connected from its C-terminus to the N-terminal end of a variable domain of heavy chain (VH) by a polypeptide chain.
  • VL variable domain of light chain
  • VH variable domain of heavy chain
  • the scFv comprises of polypeptide chain where in the C-terminal end of the VH is connected to the N-terminal end of VL by a polypeptide chain.
  • the “Fab fragment” (also referred to as fragment antigen-binding) contains the constant domain (CL) of the light chain and the first constant domain (CHI) of the heavy chain along with the variable domains VL and VH on the light and heavy chains respectively.
  • the variable domains comprise the complementarity determining loops (CDR, also referred to as hypervariable region) that are involved in antigen-binding.
  • CDR complementarity determining loops
  • Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHI domain including one or more cysteines from the antibody hinge region.
  • “F(ab’)2” fragments contain two Fab’ fragments joined, near the hinge region, by disulfide bonds. F(ab’)2 fragments may be generated, for example, by recombinant methods or by pepsin digestion of an intact antibody. The F(ab’) fragments can be dissociated, for example, by treatment with B-mercaptoethanol
  • Fv fragments comprise a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain.
  • Single-chain Fv or “sFv” or “scFv” includes the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain.
  • the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen-binding.
  • single domain antibody refers to a molecule in which one variable domain of an antibody specifically binds to an antigen without the presence of the other variable domain.
  • Single domain antibodies, and fragments thereof, are described in Arabi Ghahroudi et al. , FEBS Letters, 1998, 414:521-526 and Muyldermans el al., Trends in Biochem. Sci., 2001, 26:230-245, each of which is incorporated by reference in its entirety.
  • Single domain antibodies are also known as sdAbs or nanobodies. Sdabs are fairly stable and easy to express as fusion partner with the Fc chain of an antibody (Harmsen MM, De Haard HJ (2007). "Properties, production, and applications of camelid single-domain antibody fragments". Appl. Microbiol Biotechnol. 77(1): 13-22).
  • an “antibody fragment” comprises a portion of an intact antibody, such as the antigen-binding or variable region of an intact antibody.
  • Antibody fragments include, for example, Fv fragments, Fab fragments, F(ab’)2 fragments, Fab’ fragments, scFv (sFv) fragments, and scFv-Fc fragments.
  • the antigen-binding domain comprises an antibody, an antigen-binding fragment of an antibody, a F(ab) fragment, a F(ab') fragment, a single chain variable fragment (scFv), or a single-domain antibody (sdAb).
  • the antigen-binding domain comprises a single chain variable fragment (scFv).
  • each scFv comprises a heavy chain variable domain (VH) and a light chain variable domain (VL).
  • VH and VL are separated by a peptide linker.
  • the extracellular protein binding domain comprises a ligand-binding domain.
  • the ligand-binding domain can be a domain from a receptor, wherein the receptor is selected from the group consisting of TCR, BCR, a cytokine receptor, RTK receptors, serine/threonine kinase receptors, hormone receptors, immunoglobulin superfamily receptors, and TNFR-superfamily of receptors.
  • an extracellular protein binding domain binds to a target protein comprising CD20 or CD 19.
  • binding domain depends upon the type and number of ligands that define the surface of a target cell.
  • the extracellular protein binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with non-disease states, such as “self’ or normal tissue, or the extracellular protein binding domain may be chosen to recognize a ligand that acts as a cell surface marker on targets associated with a particular disease state, such as cancer or an autoimmune disease.
  • an inhibitory chimeric receptor binding domain may be selected from a non-disease state cell surface marker, while a tumor-targeting chimeric receptor binding domain may be selected from a disease state cell surface marker.
  • examples of cell surface markers that may act as ligands for the extracellular protein binding domain in the inhibitory chimeric receptor of the present disclosure include those associated with normal tissue and examples of cell surface markers that may act as ligands for the protein binding domain in a tumor targeting chimeric receptor include those associated with cancer cells and/or other forms of diseased cells.
  • an inhibitory chimeric receptor is engineered to target a non-tumor protein of interest by way of engineering a desired protein binding domain that specifically binds to a protein on a non-tumor cell encoded by an engineered nucleic acid.
  • An extracellular protein binding domain e.g ., an scFv
  • a molecule is said to exhibit specific binding if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular target protein than it does with alternative targets.
  • An extracellular protein binding domain e.g., an scFv
  • An extracellular protein binding domain that specifically binds to a first target protein may or may not specifically bind to a second target protein. As such, specific binding does not necessarily require (although it can include) exclusive binding.
  • an extracellular protein binding domain is an antigen-binding domain.
  • the extracellular protein binding domain has a high binding affinity.
  • the extracellular protein binding domain has a low binding affinity.
  • the inhibitory chimeric receptor comprises a peptide linker.
  • a linker is generally used to link two peptides of a protein binding domain, such as the peptides of an scFv or sdAb. Any appropriate linker known in the art may be used, including glycerin-serine based linkers.
  • the heavy chain variable domain (VH) and light chain variable domain (VL) of an scFv are separated by a peptide linker.
  • the scFv comprises the structure VH-L-VL or VL-L-VH, wherein VH is the heavy chain variable domain, L is the peptide linker, and VL is the light chain variable domain.
  • the peptide linker comprises an amino acid sequence selected from the group consisting of GGS (SEQ ID NO: 23), GGSGGS (SEQ ID NO: 24), GGSGGSGGS (SEQ ID NO: 25), GGS GGS GGS GGS GGS (SEQ ID NO: 26),
  • GGGGS GGGGS GGGGS GGGGS (SEQ ID NO: 37), and
  • TTTPAPRPPTPAPTIALQPLSLRPEACRPAAGGAVHTRGLDFACDQTTPGERSSLPAFY PGTSGSCSGCGSLSLP SEQ ID NO: 94.
  • linker amino acid sequences are shown in Table 5.
  • An exemplary linker nucleic acid sequence is shown in Table 6.
  • Chimer receptors can also contain spacer or hinge domains in the polypeptide.
  • a spacer domain or a hinge domain is located between an extracellular domain (e.g. , comprising the protein binding domain) and a transmembrane domain of an inhibitory chimeric receptor or tumor-targeting chimeric receptor, or between a intracellular signaling domain and a transmembrane domain of the inhibitory chimeric receptor or tumor targeting chimeric receptor.
  • a spacer or hinge domain is any oligopeptide or polypeptide that functions to link the transmembrane domain to the extracellular domain and/or the intracellular signaling domain in the polypeptide chain.
  • Spacer or hinge domains provide flexibility to the inhibitory chimeric receptor or tumor-targeting chimeric receptor, or domains thereof, or prevent steric hindrance of the inhibitory chimeric receptor or tumor targeting chimeric receptor, or domains thereof.
  • a spacer domain or hinge domain may comprise up to 300 amino acids (e.g, 10 to 100 amino acids, or 5 to 20 amino acids).
  • one or more spacer domain(s) may be included in other regions of an inhibitory chimeric receptor or tumor-targeting chimeric receptor.
  • Exemplary spacer or hinge domain amino acid sequences are shown in Table 7.
  • Exemplary spacer or hinge domain nucleic acid sequences are shown in Table 8.
  • the chimeric inhibitory receptor further comprises a spacer region between the protein binding domain and the transmembrane domain.
  • the spacer region is derived from a protein selected from the group consisting of: CD8a, CD4, CD7, CD28, IgGl, IgG4, FcyRIIIa, LNGFR, and PDGFR.
  • the spacer region comprises an amino acid sequence selected from the group consisting of:
  • a AIEVM YPPP YLDNEK SN GTIIH VKGKHLCP SPLFPGP SKP (SEQ ID NO: 39),
  • ESKYGPPCPSCP (SEQ ID NO: 40), ESKYGPPAPSAP (SEQ ID NO: 41), ESKYGPPCPPCP (SEQ ID NO: 42), EPK S CDKTHT CP (SEQ ID NO: 43), AAAFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI YIW APL AGTCGVLLL SL VITL Y CNHRN (SEQ ID NO: 44),
  • TTTPAPRPPTPAPTIALQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 45), ACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCT EC V GLQ SM S APC VE ADD A V CRC A Y GY Y QDETT GRCE ACRV CE AGS GL VF S C QDKQ NT V CEECPDGT Y SDEAD AEC (SEQ ID NO: 46),
  • ACPTGLYTHSGECCKACNLGEGVAQPCGANQTVC (SEQ ID NO: 47), and AVGQDTQEVIVVPHSLPFKV (SEQ ID NO: 48).
  • the spacer region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about
  • the spacer region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about
  • the spacer region comprises an amino acid sequence that is at least about
  • the spacer region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 41.
  • the spacer region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about
  • the spacer region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about
  • the spacer region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about
  • the spacer region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about
  • the spacer region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about
  • the spacer region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about
  • the spacer region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about
  • the spacer region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about
  • the spacer region modulates sensitivity of the chimeric inhibitory receptor. In some embodiments, the spacer region increases sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region. In some embodiments, the spacer region reduces sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region. In some embodiments, the spacer region modulates potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region. In some embodiments, the spacer region increases potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • the spacer region reduces potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region. In some embodiments, the spacer region modulates basal prevention, attenuation, or inhibition of activation of the tumor-targeting chimeric receptor expressed on the immunomodulatory cell relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region. In some embodiments, the spacer region reduces basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region. In some embodiments, the spacer region increases basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • the chimeric inhibitory receptor further comprises an intracellular spacer region positioned between the transmembrane domain and the intracellular signaling domain and operably linked to each of the transmembrane domain and the intracellular signaling domain. In some embodiments, the chimeric inhibitory receptor further comprises an intracellular spacer region positioned between the transmembrane domain and the intracellular signaling domain and physically linked to each of the transmembrane domain and the intracellular signaling domain.
  • the intracellular spacer region modulates sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region. In some embodiments, the intracellular spacer region increases sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region. In some embodiments, the intracellular spacer region reduces sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region. In some embodiments, the intracellular spacer region modulates potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • the intracellular spacer region increases potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region. In some embodiments, the intracellular spacer region reduces potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region. In some embodiments, the intracellular spacer region modulates basal prevention, attenuation, or inhibition of activation of the tumor-targeting chimeric receptor expressed on the immunomodulatory cell when expressed on an immunomodulatory cell relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • the intracellular spacer region reduces basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region. In some embodiments, the intracellular spacer region increases basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • Polynucleotides encoding inhibitory chimeric receptors [00311] In another aspect, presented herein are a polynucleotide or set of polynucleotides encoding an inhibitory chimeric receptor, and a vector comprising such a polynucleotide. When the inhibitory chimeric receptor is a multichain receptor, a set of polynucleotides is used.
  • the set of polynucleotides can be cloned into a single vector or a plurality of vectors.
  • the polynucleotide comprises a sequence encoding an inhibitory chimeric receptor, wherein the sequence encoding an extracellular protein binding domain is contiguous with and in the same reading frame as a sequence encoding an intracellular signaling domain and a transmembrane domain.
  • the polynucleotide can be codon optimized for expression in a mammalian cell.
  • the entire sequence of the polynucleotide has been codon optimized for expression in a mammalian cell.
  • Codon optimization refers to the discovery that the frequency of occurrence of synonymous codons (i.e., codons that code for the same amino acid) in coding DNA is biased in different species. Such codon degeneracy allows an identical polypeptide to be encoded by a variety of nucleic acid sequences.
  • a variety of codon optimization methods is known in the art, and include, e.g ., methods disclosed in at least US Patent Numbers 5,786,464 and 6,114,148.
  • the polynucleotide encoding an inhibitory chimeric receptor can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the polynucleotide, by deriving it from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques.
  • the polynucleotide can be produced synthetically, rather than cloned.
  • the polynucleotide can be cloned into a vector.
  • an expression vector known in the art is used. Accordingly, the present disclosure includes retroviral and lentiviral vector constructs expressing an inhibitory chimeric receptor that can be directly transduced into a cell.
  • the present disclosure also includes an RNA construct that can be directly transfected into a cell.
  • a method for generating mRNA for use in transfection involves in vitro transcription (IVT) of a template with specially designed primers, followed by polyA addition, to produce a construct containing 3’ and 5’ untranslated sequence (“UTR”) (e.g, a 3’ and/or 5’ UTR described herein), a 5’ cap (e.g, a 5’ cap described herein) and/or Internal Ribosome Entry Site (IRES) (e.g, an IRES described herein), the nucleic acid to be expressed, and a polyA tail.
  • RNA so produced can efficiently transfect different kinds of cells.
  • an RNA inhibitory chimeric receptor vector is transduced into a cell, e.g ., a T cell or a NK cell, by electroporation.
  • the present disclosure provides inhibitory chimeric receptor- modified cells.
  • the cells can be stem cells, progenitor cells, and/or immune cells modified to express an inhibitory chimeric receptor described herein.
  • a cell line derived from an immune cell is used.
  • Non-limiting examples of cells include mesenchymal stem cells (MSCs), natural killer (NK) cells, NKT cells, innate lymphoid cells, mast cells, eosinophils, basophils, macrophages, neutrophils, mesenchymal stem cells, dendritic cells, T cells (e.g, CD8+ T cells, CD4+ T cells, gamma-delta T cells, and T regulatory cells (CD4+, FOXP3+, CD25+)) and B cells.
  • the cell a stem cell, such as pluripotent stem cell, embryonic stem cell, adult stem cell, bone-marrow stem cell, umbilical cord stem cells, or other stem cell.
  • the cells can be modified to express an inhibitory chimeric receptor provided herein. Accordingly, the present disclosure provides a cell (e.g, a population of cells) engineered to express an inhibitory chimeric receptor, wherein the inhibitory chimeric receptor comprises a protein binding domain, a transmembrane domain, and an inhibitory intracellular signaling domain.
  • a cell e.g, a population of cells
  • the inhibitory chimeric receptor comprises a protein binding domain, a transmembrane domain, and an inhibitory intracellular signaling domain.
  • the immunomodulatory cell is selected from the group consisting of: a T cell, a CD8+ T cell, a CD4+ T cell, a gamma-delta T cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a viral-specific T cell, a Natural Killer T (NKT) cell, a Natural Killer (NK) cell, a B cell, a tumor-infiltrating lymphocyte (TIL), an innate lymphoid cell, a mast cell, an eosinophil, a basophil, a neutrophil, a myeloid cell, a macrophage, a monocyte, a dendritic cell, an ESC-derived cell, and an iPSC-derived cell.
  • CTL cytotoxic T lymphocyte
  • TTL cytotoxic T lymphocyte
  • TTL cytotoxic T lymphocyte
  • NKT Natural Killer T
  • NK Natural Killer
  • NK Natural Killer
  • B cell a tumor-infiltrating lymph
  • the immunomodulatory cell is a CD8+ T cell. In some embodiments, the immunomodulatory cell is a CD4+ T cell. In some embodiments, the immunomodulatory cell is a Natural Killer T (NKT) cell. In some embodiments, the immunomodulatory cell is a Natural Killer (NK) cell.
  • NKT Natural Killer T
  • NK Natural Killer
  • the cell is autologous. In some embodiments, the cell is allogeneic.
  • an immunomodulatory cell comprises a chimeric inhibitory receptor, wherein the chimeric inhibitory receptor comprises: an extracellular protein binding domain; a transmembrane domain, wherein the transmembrane domain is operably linked to the extracellular protein binding domain; and an intracellular signaling domain, wherein the intracellular signaling domain is operably linked to the transmembrane domain, and wherein upon binding of the protein to the chimeric inhibitory receptor, the chimeric inhibitory receptor prevents, attenuates, or inhibits activation of a tumor-targeting chimeric receptor expressed on the surface of the cell.
  • the cell further comprises a tumor-targeting chimeric receptor expressed on the surface of the cell.
  • the chimeric inhibitory receptor is recombinantly expressed.
  • the tumor-targeting chimeric receptor prior to binding of the protein to the chimeric inhibitory receptor, is capable of activating the cell.
  • the chimeric inhibitory receptor upon binding of the protein to the chimeric inhibitory receptor, suppresses cytokine production from the activated cell.
  • the chimeric inhibitory receptor upon binding of the protein to the chimeric inhibitory receptor, suppresses a cell-mediated immune response to a target cell, wherein the immune response is induced by activation of the immunomodulatory cell.
  • the target cell is a tumor cell. In some embodiments, the target cell is a non tumor cell.
  • the cells can be modified to express an inhibitory chimeric receptor provided herein.
  • the cells can also be modified to express an inhibitory chimeric receptor (e.g. , an iCAR) and a tumor-targeting CAR (e.g, an aCAR). If a cell is modified to express at least one inhibitory chimeric receptor and at least one tumor-targeting CAR, the cells can express multiple inhibitory and/or tumor-targeting chimeric receptor proteins and/or polynucleotides.
  • the cell expresses at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 or more inhibitory chimeric receptor polynucleotide and/or polypeptide. In some embodiments, the cell contains at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 or more tumor-targeting chimeric receptor polynucleotide and/or polypeptide.
  • the present disclosure provides a method of preparing a modified immune cells comprising an inhibitory chimeric receptor for experimental or therapeutic use.
  • Ex vivo procedures for making therapeutic inhibitory chimeric receptor-modified cells are well known in the art. For example, cells are isolated from a mammal ( e.g ., a human) and genetically modified (i.e., transduced or transfected in vitro) with a vector expressing a inhibitory chimeric receptor disclosed herein. The inhibitory chimeric receptor- modified cell can be administered to a mammalian recipient to provide a therapeutic benefit.
  • the mammalian recipient may be a human and the inhibitory chimeric receptor-modified cell can be autologous with respect to the recipient.
  • the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
  • the procedure for ex vivo expansion of hematopoietic stem and progenitor cells is described in U.S. Pat. No. 5,199,942, incorporated herein by reference, can be applied to the cells of the present disclosure. Other suitable methods are known in the art; therefore the present disclosure is not limited to any particular method of ex vivo expansion of the cells.
  • ex vivo culture and expansion of immune effector cells comprises: (1) collecting CD34+ hematopoietic stem and progenitor cells from a mammal from peripheral blood harvest or bone marrow explants; and (2) expanding such cells ex vivo.
  • immune effector cells e.g., T cells, NK cells
  • other factors such as flt3-L, IL-1, IL-3 and c-kit ligand, can be used for culturing and expansion of the cells.
  • the methods comprise culturing the population of cells (e.g. in cell culture media) to a desired cell density (e.g, a cell density sufficient for a particular cell-based therapy).
  • a desired cell density e.g, a cell density sufficient for a particular cell-based therapy.
  • the population of cells are cultured in the absence of an agent that represses activity of the repressible protease or in the presence of an agent that represses activity of the repressible protease.
  • the population of cells is cultured for a period of time that results in the production of an expanded cell population that comprises at least 2-fold the number of cells of the starting population. In some embodiments, the population of cells is cultured for a period of time that results in the production of an expanded cell population that comprises at least 4-fold the number of cells of the starting population. In some embodiments, the population of cells is cultured for a period of time that results in the production of an expanded cell population that comprises at least 16-fold the number of cells of the starting population.
  • compositions comprising chimeric receptors or genetically modified immunoresponsive cells that express such chimeric receptors can be provided systemically or directly to a subject for the treatment of a proliferative disorder, such as a cancer.
  • the present disclosure provides a method of preparing a modified immune cells comprising at least one inhibitory chimeric receptor (e.g ., inhibitory chimeric receptor (iCAR)-modified cells) for experimental or therapeutic use.
  • the modified immune cells further comprise at least one tumor-targeting chimeric receptor (e.g., iCAR and aCAR-modified cells).
  • methods of use encompass methods of preventing, attenuating, or inhibiting a cell-mediated immune response induced by a chimeric receptor expressed of the surface of an immunomodulatory cell, comprising: engineering the immunomodulatory cell to express the chimeric inhibitory receptor described herein on the surface of the immunomodulatory cell, wherein upon binding of a cognate protein to the chimeric inhibitory receptor, the intracellular signaling domain prevents, attenuates, or inhibits activation of the chimeric receptor.
  • methods of use encompass methods of preventing, attenuating, or inhibiting activation of a chimeric receptor expressed on the surface of an immunomodulatory cell, comprising: contacting an isolated cell or a composition as described herein with a cognate protein of the chimeric inhibitory receptor under conditions suitable for the chimeric inhibitory receptor to bind the cognate protein, wherein upon binding of the protein to the chimeric inhibitory receptor, the intracellular signaling domain prevents, attenuates, or inhibits activation of the chimeric receptor.
  • the inhibitory chimeric receptor is used to prevent, attenuate, inhibit, or suppress an immune response initiated by a tumor targeting chimeric receptor (e.g, an activating CAR).
  • a tumor targeting chimeric receptor e.g, an activating CAR
  • an immunomodulator cell expresses an inhibitory chimeric antigen that recognizes an antigen target 1 (e.g, a non-tumor antigen) and a tumor-targeting chimeric receptor that recognizes an antigen target 2 (e.g, a tumor target).
  • an antigen target 1 e.g, a non-tumor antigen
  • a tumor-targeting chimeric receptor that recognizes an antigen target 2
  • the inhibitory and tumor targeting chimeric receptors may or may not bind to their cognate antigen.
  • both the inhibitory chimeric receptor and the tumor-targeting receptor can be activated.
  • the activation of the inhibitory chimeric receptor results in the prevention, attenuation, or inhibition of the tumor targeting chimeric receptor signaling and the immunomodulatory cell is not activated.
  • the target cell is a non-tumor cell that expresses only antigen target 1
  • only the inhibitory chimeric receptor can be activated.
  • the inhibitory chimeric receptor cannot be activated while the tumor-targeting chimeric receptor can be activated, resulting in signal transduction that results in activation of the immunomodulatory cell.
  • Attenuation of an immune response initiated by a tumor targeting chimeric receptor can be a decrease or reduction in the activation of the tumor targeting chimeric receptor, a decrease or reduction in the signal transduction of a tumor targeting chimeric receptor, or a decrease or reduction in the activation of the immunomodulatory cell.
  • the inhibitory chimeric receptor can attenuate activation of the tumor targeting chimeric receptor, signal transduction by the tumor targeting chimeric receptor, or activation of the immunomodulatory cell by the tumor targeting chimeric receptor 1-fold, 2-fold, 3 -fold, 4- fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold or more as compared to the activation of the tumor targeting chimeric receptor, signal transduction, or activation of the immunomodulatory cell as compared to an immunomodulatory cell lacking an inhibitory chimeric receptor.
  • attenuation refers to a decrease or reduction of the activity of a tumor targeting chimeric receptor after it has been activated.
  • Prevention of an immune response initiated by a tumor targeting chimeric receptor can be an inhibition or reduction in the activation of the tumor targeting chimeric receptor, an inhibition or reduction in the signal transduction of a tumor targeting chimeric receptor, or an inhibition or reduction in the activation of the immunomodulatory cell.
  • the inhibitory chimeric receptor can prevent activation of the tumor targeting chimeric receptor, signal transduction by the tumor targeting chimeric receptor, or activation of the immunomodulatory cell by the tumor targeting chimeric receptor by about 1-fold, 2-fold, 3- fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold or more as compared to the activation of the tumor targeting chimeric receptor, signal transduction, or activation of the immunomodulatory cell as compared to an immunomodulatory cell lacking an inhibitory chimeric receptor.
  • prevention refers to a blockage of the activity of a tumor targeting chimeric receptor before it has been activated.
  • Inhibition of an immune response initiated by a tumor targeting chimeric receptor can be an inhibition or reduction in the activation of the tumor targeting chimeric receptor, an inhibition or reduction in the signal transduction of a tumor targeting chimeric receptor, or an inhibition or reduction in the activation of the immunomodulatory cell.
  • the inhibitory chimeric receptor can inhibit activation of the tumor targeting chimeric receptor, signal transduction by the tumor targeting chimeric receptor, or activation of the immunomodulatory cell by the tumor targeting chimeric receptor by about 1-fold, 2-fold, 3- fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold or more as compared to the activation of the tumor targeting chimeric receptor, signal transduction, or activation of the immunomodulatory cell as compared to an immunomodulatory cell lacking an inhibitory chimeric receptor.
  • inhibition refers to a decrease or reduction of the activity of a tumor targeting chimeric receptor before or after it has been activated.
  • Suppression of an immune response initiated by a tumor targeting chimeric receptor can be an inhibition or reduction in the activation of the tumor targeting chimeric receptor, an inhibition or reduction in the signal transduction of a tumor targeting chimeric receptor, or an inhibition or reduction in the activation of the immunomodulatory cell.
  • the inhibitory chimeric receptor can suppress activation of the tumor targeting chimeric receptor, signal transduction by the tumor targeting chimeric receptor, or activation of the immunomodulatory cell by the tumor targeting chimeric receptor by about 1-fold, 2-fold, 3- fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold or more as compared to the activation of the tumor targeting chimeric receptor, signal transduction, or activation of the immunomodulatory cell as compared to an immunomodulatory cell lacking an inhibitory chimeric receptor.
  • suppression refers to a decrease or reduction of the activity of a tumor targeting chimeric receptor before or after it has been activated.
  • the immune response can be cytokine or chemokine production and secretion from an activated immunomodulatory cell.
  • the immune response can be a cell-mediated immune response to a target cell.
  • the chimeric inhibitory receptor is capable of suppressing cytokine production from an activated immunomodulatory cell. In some embodiments, the chimeric inhibitory receptor is capable of suppressing a cell-mediated immune response to a target cell, wherein the immune response is induced by activation of the immunomodulatory cell.
  • the present disclosure provides a type of cell therapy where immune cells are genetically modified to express an inhibitory chimeric receptor provided herein and the modified immune cells are administered to a subject in need thereof.
  • the methods comprise delivering cells of the expanded population of cells to a subject in need of a cell-based therapy to treat a condition or disorder.
  • the subject is a human subject.
  • the condition or disorder is an autoimmune condition.
  • the condition or disorder is an immune related condition.
  • the condition or disorder is a cancer (e.g ., a primary cancer or a metastatic cancer).
  • the cancer is a solid cancer.
  • the cancer is a liquid cancer, such as a myeloid disorder.
  • the inhibitory chimeric receptor or immunoresponsive cell can be formulated in pharmaceutical compositions.
  • Pharmaceutical compositions of the present disclosure can comprise an inhibitory chimeric receptor (e.g., an iCAR) or immunoresponsive cell (e.g, a plurality of inhibitory chimeric receptor-expressing cells), as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
  • Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
  • the precise nature of the carrier or other material can depend on the route of administration, e.g. oral, intravenous, cutaneous or subcutaneous, nasal, intramuscular, intraperitoneal routes.
  • the composition is directly injected into an organ of interest (e.g, an organ affected by a disorder).
  • the composition may be provided indirectly to the organ of interest, for example, by administration into the circulatory system (e.g, the tumor vasculature).
  • Expansion and differentiation agents can be provided prior to, during, or after administration of the composition to increase production of T cells, NK cells, or CTL cells in vitro or in vivo.
  • the compositions are pharmaceutical compositions comprising genetically modified cells, such as immunoresponsive cells or their progenitors and a pharmaceutically acceptable carrier. Administration can be autologous or heterologous.
  • immunoresponsive cells, or progenitors can be obtained from one subject, and administered to the same subject or a different, compatible subject.
  • immunoresponsive cells of the present disclosure or their progeny may be derived from peripheral blood cells (e.g, in vivo, ex vivo, or in vitro derived) and may be administered via localized injection, including catheter administration, systemic injection, localized injection, intravenous injection, or parenteral administration.
  • a therapeutic composition of the present disclosure e.g, a pharmaceutical composition containing a genetically modified cell of the present disclosure
  • it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion).
  • compositions of the present disclosure relate to formulations of compositions comprising chimeric receptors of the present disclosure or genetically modified cells (e.g ., immunoresponsive cells of the present disclosure) expressing such chimeric receptors.
  • compositions of the present disclosure comprising genetically modified cells may be provided as sterile liquid preparations, including without limitation isotonic aqueous solutions, suspensions, emulsions, dispersions, and viscous compositions, which may be buffered to a selected pH.
  • Liquid preparations are typically easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions may be more convenient to administer, especially by injection.
  • viscous compositions can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues.
  • Liquid or viscous compositions can comprise carriers, which can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol, etc.) and suitable mixtures thereof.
  • compositions for oral administration can be in tablet, capsule, powder or liquid form.
  • a tablet can include a solid carrier such as gelatin or an adjuvant.
  • Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol can be included.
  • the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
  • compositions of the present disclosure can be isotonic, i.e., having the same osmotic pressure as blood and lacrimal fluid.
  • the desired isotonicity may be achieved using, for example, sodium chloride, dextrose, boric acid, sodium tartrate, propylene glycol, or other inorganic or organic solutes.
  • compositions of the present disclosure may further include various additives that may enhance the stability and sterility of the compositions.
  • additives include, without limitation, antimicrobial preservatives, antioxidants, chelating agents, and buffers.
  • microbial contamination may be prevented by the inclusions of any of various antibacterial and antifungal agents, including without limitation parabens, chlorobutanol, phenol, sorbic acid, and the like.
  • Prolonged absorption of an injectable pharmaceutical formulation of the ;present disclosure can be brought about by the use of suitable agents that delay absorption, such as aluminum monostearate and gelatin.
  • sterile injectable solutions can be prepared by incorporating genetically modified cells of the present disclosure in a sufficient amount of the appropriate solvent with various amounts of any other ingredients, as desired.
  • Such compositions may be in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like.
  • the compositions can also be lyophilized.
  • the compositions can contain auxiliary substances such as wetting, dispersing agents, pH buffering agents, and antimicrobials depending upon the route of administration and the preparation desired.
  • the components of the formulations of the present disclosure are selected to be chemically inert and to not affect the viability or efficacy of the genetically modified cells of the present disclosure.
  • the quantity of cells needed to achieve optimal efficacy is the quantity of cells needed to achieve optimal efficacy.
  • the quantity of cells to be administered will vary for the subject being treated.
  • the quantity of genetically modified cells that are administered to a subject in need thereof may range from 1 x 10 4 cells to 1 x 10 10 cells.
  • the precise quantity of cells that would be considered an effective dose may be based on factors individual to each subject, including their size, age, sex, weight, and condition of the particular subject. Dosages can be readily ascertained by those skilled in the art based on the present disclosure and the knowledge in the art.
  • administration is preferably in a “therapeutically effective amount” or
  • prophylactically effective amount (as the case can be, although prophylaxis can be considered therapy), this being sufficient to show benefit to the individual.
  • the actual amount administered, and rate and time-course of administration, will depend on the nature and severity of protein aggregation disease being treated. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Remington's Pharmaceutical Sciences, 16th edition, Osol, A. (ed), 1980.
  • a composition can be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
  • kits for the treatment and/or prevention of a cancer or other diseases e.g ., immune-related or autoimmune disorders.
  • the kit includes a therapeutic or prophylactic composition comprising an effective amount of one or more chimeric receptors of the present disclosure, isolated nucleic acids of the present disclosure, vectors of the present disclosure, and/or cells of the present disclosure (e.g., immunoresponsive cells).
  • the kit comprises a sterile container.
  • such containers can be boxes, ampules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art.
  • the container may be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.
  • therapeutic or prophylactic composition is provided together with instructions for administering the therapeutic or prophylactic composition to a subject having or at risk of developing a cancer or immune-related disorder.
  • the instructions may include information about the use of the composition for the treatment and/or prevention of the disorder.
  • the instructions include, without limitation, a description of the therapeutic or prophylactic composition, a dosage schedule, an administration schedule for treatment or prevention of the disorder or a symptom thereof, precautions, warnings, indications, counter-indications, over-dosage information, adverse reactions, animal pharmacology, clinical studies, and/or references.
  • the instructions can be printed directly on the container (when present), or as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container.
  • Embodiment 1 A chimeric inhibitory receptor comprising: -an extracellular protein binding domain;
  • transmembrane domain operably linked to the extracellular protein binding domain
  • intracellular signaling domains wherein the one or more intracellular signaling domains are operably linked to the transmembrane domain, and wherein at least one of the one or more intracellular signaling domains is capable of preventing, attenuating, or inhibiting activation of a tumor-targeting chimeric receptor expressed on an immunomodulatory cell.
  • Embodiment 2 The chimeric inhibitory receptor of embodiment 1, wherein the one or more intracellular signaling domain are each derived from a protein selected from the group consisting of: SLAP1, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRPa, HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
  • a protein selected from the group consisting of: SLAP1, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRPa, HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
  • Embodiment 3 The chimeric inhibitory receptor of any one of embodiments 1 or 2, wherein the transmembrane domain is derived from the same protein as one of the one or more intracellular signaling domains.
  • Embodiment 4 The chimeric inhibitory receptor of embodiment 3, wherein the transmembrane domain further comprises at least a portion of an extracellular domain of the same protein.
  • Embodiment 5 The chimeric inhibitory receptor of any one of embodiments 1 or 2, wherein the transmembrane domain is derived from a first protein and the one or more intracellular signaling domains are derived from proteins that are distinct from the first protein.
  • Embodiment 6 The chimeric inhibitory receptor of any one of embodiments 1-5, wherein one of the one or more intracellular signaling domains is derived from SLAP1.
  • Embodiment 7 The chimeric inhibitory receptor of embodiment 6, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • Embodiment 8 The chimeric inhibitory receptor of embodiment 6, wherein the intracellular signaling domain comprises the amino acid sequence of PAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTG RESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVR HRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAA P AVRAS S SP VTLRQKTVDWRRV SRLQEDPEGTENPLGVDESLF S YGLRESIAS YLSLT SEDNT SFDRKKK SISLM Y GGSKRK S SFF SPP YFED (SEQ ID NO: 4), or PAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTG RESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFM
  • Embodiment 9 The chimeric inhibitory receptor of any one of embodiments 1-5, wherein one of the one or more intracellular signaling domains is derived from SLAP2.
  • Embodiment 10 The chimeric inhibitory receptor of embodiment 9, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • RKSLP SP SL S S S VQGQGP VTMEAERSK AT AVALGSFP AGGP AEL SLRLGEPLTIV SED GD WWT VL SE V S GREYNIP S VH V AK V SHGWL YEGL SREK AEELLLLPGNPGGAFLIRE SQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELA DDICCLLKEPC VLQRAGPLPGKDIPLP VT V QRTPLNWKELD S SLLF SEAAT GEESLLSE GLRESLSFYISLNDEAVSLDDA (SEQ ID NO: 6).
  • Embodiment 11 The chimeric inhibitory receptor of embodiment 9, wherein the intracellular signaling domain comprises the amino acid sequence of RKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSED GD WWT VL SE V S GREYNIP S VH V AK V SHGWL YEGL SREK AEELLLLPGNPGGAFLIRE SQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELA DDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFSEAATGEESLLSE GLRE SL SF YISLNDE A V SLDD A (SEQ ID NO: 6).
  • Embodiment 12 The chimeric inhibitory receptor of any one of embodiments 1-5, wherein one of the one or more intracellular signaling domains is derived from KIR2DL1.
  • Embodiment 13 The chimeric inhibitory receptor of embodiment 12, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • Embodiment 14 The chimeric inhibitory receptor of embodiment 12, wherein the intracellular signaling domain comprises the amino acid sequence of HRW C SNKKNAAVMDQES AGNRT AN SED SDEQDPQEVT YT QLNHC VFTQRKITRP S QRPKTPPTDIIVYTELPNAESRSKVVSCP (SEQ ID NO: 60).
  • Embodiment 15 The chimeric inhibitory receptor of any one of embodiments 1-5, wherein one of the one or more intracellular signaling domains is derived from KLRG-1.
  • Embodiment 16 The chimeric inhibitory receptor of embodiment 15, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • Embodiment 17 The chimeric inhibitory receptor of embodiment 15, wherein the intracellular signaling domain comprises the amino acid sequence of MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLGSG (SEQ ID NO: 61).
  • Embodiment 18 The chimeric inhibitory receptor of any one of embodiments 1-5, wherein one of the one or more intracellular signaling domains is derived from LAIR1.
  • Embodiment 19 The chimeric inhibitory receptor of embodiment 18, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • Embodiment 20 The chimeric inhibitory receptor of embodiment 18, wherein the intracellular signaling domain comprises the amino acid sequence of HRQN QIKQ GPPRSKDEEQKPQQRPDL A VD VLERT ADK AT VN GLPEKDRETDT SAL A AGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH (SEQ ID NO:
  • Embodiment 21 The chimeric inhibitory receptor of any one of embodiments 1-5, wherein one of the one or more intracellular signaling domains is derived from LIR2.
  • Embodiment 22 The chimeric inhibitory receptor of embodiment 21, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • Embodiment 23 The chimeric inhibitory receptor of embodiment 21, wherein the intracellular signaling domain comprises the amino acid sequence of LRHRRQGKHWT S T QRK ADF QHP AGA V GPEPTDRGLQ WRS SP A AD AQEENL Y A A VK DTQPEDGVEMDTRAAASE APQD VT Y AQLHSLTLRRK ATEPPP SQEREPP AEP SIY ATL AIH (SEQ ID NO: 63).
  • Embodiment 24 The chimeric inhibitory receptor of any one of embodiments 1-5, wherein one of the one or more intracellular signaling domains is derived from LIR3.
  • Embodiment 25 The chimeric inhibitory receptor of embodiment 24, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • Embodiment 26 The chimeric inhibitory receptor of embodiment 24, wherein the intracellular signaling domain comprises the amino acid sequence of RRQRHSKHRT SDQRKTDF QRP AGAAETEPKDRGLLRRS SP AAD VQEENL Y AAVKDT Q SEDRVELD SQ SPHDEDPQ AVT Y AP VKHS SPRREMASPP S SL SGEFLDTKDRQ VEED RQMDTEAAASEASQD VT Y AQLHSLTLRRK ATEPPP SQEGEPP AEP SIY ATL AIH (SEQ ID NO: 64).
  • Embodiment 27 The chimeric inhibitory receptor of any one of embodiments 1-5, wherein one of the one or more intracellular signaling domains is derived from LIR5.
  • Embodiment 28 The chimeric inhibitory receptor of embodiment 27, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • Embodiment 29 The chimeric inhibitory receptor of embodiment 27, wherein the intracellular signaling domain comprises the amino acid sequence of
  • Embodiment 30 The chimeric inhibitory receptor of any one of embodiments 1-5, wherein one of the one or more intracellular signaling domains is derived from SIGLEC-2.
  • Embodiment 31 The chimeric inhibitory receptor of embodiment 30, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • Embodiment 32 The chimeric inhibitory receptor of embodiment 30, wherein the intracellular signaling domain comprises the amino acid sequence of KLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISY TTLRFPEMNIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGI HY SELIQF GVGERPQ AQENVD Y VILKH (SEQ ID NO: 66).
  • Embodiment 33 The chimeric inhibitory receptor of any one of embodiments 1-5, wherein one of the one or more intracellular signaling domains is derived from SIGLEC-10.
  • Embodiment 34 The chimeric inhibitory receptor of embodiment 33, wherein the intracellular signaling domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to
  • KILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSP E SKKN QKKQ Y QLP SFPEPK S S T Q APE S QES QEELH Y ATLNFPGVRPRPE ARMPKGT Q ADYAEVKFQ (SEQ ID NO: 67).
  • Embodiment 35 The chimeric inhibitory receptor of embodiment 33, wherein the intracellular signaling domain comprises the amino acid sequence of KILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSP E SKKN QKKQ Y QLP SFPEPK S S T Q APE S QES QEELH Y ATLNFPGVRPRPE ARMPKGT Q ADYAEVKFQ (SEQ ID NO: 67).
  • Embodiment 36 The chimeric inhibitory receptor of any one of embodiments 1-35, wherein the transmembrane domain is derived from a protein selected from the group consisting of: CD8, CD28, O ⁇ 3z, CD4, 4-ffiB, 0X40, ICOS, 2B4, CD25, CD7, LAX, LAT, LAIR1, GRB-2, Dok-1, Dok-2, SLAPl, SLAP2, CD200R, SIRPa, HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
  • a protein selected from the group consisting of: CD8, CD28, O ⁇ 3z, CD4, 4-ffiB, 0X40, ICOS, 2B4, CD25, CD7, LAX, LAT, LAIR1, GRB-2, Dok-1, Dok-2,
  • Embodiment 37 The chimeric inhibitory receptor of any one of embodiments 1-36, wherein the chimeric inhibitory receptor comprises a transmembrane domain derived from CD28.
  • Embodiment 38 The chimeric inhibitory receptor of embodiment 37, wherein the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to FWVLVVVGGVLACY SLLVTVAFIIFWV (SEQ ID NO: 20).
  • Embodiment 39 The chimeric inhibitory receptor of embodiment 37, wherein the transmembrane domain comprises the amino acid sequence of FWVLVVVGGVLACY SLLVTVAFIIFWV (SEQ ID NO: 20).
  • Embodiment 40 The chimeric inhibitory receptor of any one of embodiments 1-36, wherein the chimeric inhibitory receptor comprises a transmembrane domain derived from KLR2DLL
  • Embodiment 41 The chimeric inhibitory receptor of embodiment 40, wherein the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to ILIGTSVVIILFILLFFLL (SEQ ID NO: 76).
  • Embodiment 42 The chimeric inhibitory receptor of embodiment 40, wherein the transmembrane domain comprises the amino acid sequence of ILIGTSVVIILFILLFFLL (SEQ ID NO: 76).
  • Embodiment 43 The chimeric inhibitory receptor of any one of embodiments 1-36, wherein the chimeric inhibitory receptor comprises a transmembrane domain derived from KLRG-1.
  • Embodiment 44 The chimeric inhibitory receptor of embodiment 43, wherein the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VAIALGLLTAVLLSVLLYQWI (SEQ ID NO: 78).
  • Embodiment 45 The chimeric inhibitory receptor of embodiment 43, wherein the transmembrane domain comprises the amino acid sequence of VAIALGLLTAVLLSVLLYQWI (SEQ ID NO: 78).
  • Embodiment 46 The chimeric inhibitory receptor of any one of embodiments 1-36, wherein the chimeric inhibitory receptor comprises a transmembrane domain derived from LAIR1.
  • Embodiment 47 The chimeric inhibitory receptor of embodiment 46, wherein the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to ILIGV S V VFLF CLLLL VLF CL (SEQ ID NO: 79).
  • Embodiment 48 The chimeric inhibitory receptor of embodiment 46, wherein the transmembrane domain comprises the amino acid sequence of ILIGV S VVFLF CLLLL VLF CL (SEQ ID NO: 79).
  • Embodiment 49 The chimeric inhibitory receptor of any one of embodiments 1-36, wherein the chimeric inhibitory receptor comprises a transmembrane domain derived from LIR2
  • Embodiment 50 The chimeric inhibitory receptor of embodiment 49, wherein the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VIGILVAVVLLLLLLLLLFLI (SEQ ID NO: 80).
  • Embodiment 51 The chimeric inhibitory receptor of embodiment 49, wherein the transmembrane domain comprises the amino acid sequence of VIGIL V A VVLLLLLLLLLFLI (SEQ ID NO: 80).
  • Embodiment 52 The chimeric inhibitory receptor of any one of embodiments 1-36, wherein the chimeric inhibitory receptor comprises a transmembrane domain derived from LIR3.
  • Embodiment 53 The chimeric inhibitory receptor of embodiment 52, wherein the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VLIGV S VAFVLLLFLLLFLLL (SEQ ID NO: 81).
  • Embodiment 54 The chimeric inhibitory receptor of embodiment 52, wherein the transmembrane domain comprises the amino acid sequence of VLIGV S VAFVLLLFLLLFLLL (SEQ ID NO: 81).
  • Embodiment 55 The chimeric inhibitory receptor of any one of embodiments 1-36, wherein the chimeric inhibitory receptor comprises a transmembrane domain derived from LIR5.
  • Embodiment 56 The chimeric inhibitory receptor of embodiment 55, wherein the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VLIGVL V V S ILLL SLLLFLLL (SEQ ID NO: 82).
  • Embodiment 57 The chimeric inhibitory receptor of embodiment 55, wherein the transmembrane domain comprises the amino acid sequence of VLIGVL VVSILLLSLLLFLLL (SEQ ID NO: 82).
  • Embodiment 58 The chimeric inhibitory receptor of any one of embodiments 1-36, wherein the chimeric inhibitory receptor comprises a transmembrane domain derived from SIGLEC-2.
  • Embodiment 59 The chimeric inhibitory receptor of embodiment 58, wherein the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to VAVGLGSCLAILILAICGL (SEQ ID NO: 83).
  • Embodiment 60 The chimeric inhibitory receptor of embodiment 58, wherein the transmembrane domain comprises the amino acid sequence of VAVGLGSCLAILILAICGL (SEQ ID NO: 83).
  • Embodiment 61 The chimeric inhibitory receptor of any one of embodiments 1-36, wherein the chimeric inhibitory receptor comprises a transmembrane domain derived from SIGLEC-10.
  • Embodiment 62 The chimeric inhibitory receptor of embodiment 61, wherein the transmembrane domain comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to GAFLGIGIT ALLFLCL ALUM (SEQ ID NO: 84).
  • Embodiment 63 The chimeric inhibitory receptor of embodiment 61, wherein the transmembrane domain comprises the amino acid sequence of GAFLGIGIT ALLFLCL ALUM (SEQ ID NO: 84).
  • Embodiment 64 The chimeric inhibitory receptor of any one of embodiments 1-63, wherein the one or more intracellular signaling domains are two intracellular signaling domains.
  • Embodiment 65 The chimeric inhibitory receptor of embodiment 64, wherein the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from KIR2DL1 and a second intracellular signaling domain derived from LIR2.
  • Embodiment 66 The chimeric inhibitory receptor of embodiment 64, wherein the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from KIR2DL1 and a second intracellular signaling domain derived from LIR3.
  • Embodiment 67 The chimeric inhibitory receptor of embodiment 64, wherein the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from KIR2DL1 and a second intracellular signaling domain derived from LIR5.
  • Embodiment 68 The chimeric inhibitory receptor of any one of embodiments 65-67, wherein the first intracellular signaling domain further comprises a transmembrane domain derived from KIR2DL1.
  • Embodiment 69 The chimeric inhibitory receptor of embodiment 64, wherein the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from LIR2 and a second intracellular signaling domain derived from KIR2DL1.
  • Embodiment 70 The chimeric inhibitory receptor of embodiment 69, wherein the first intracellular signaling domain further comprises a transmembrane domain derived from LIR2
  • Embodiment 71 The chimeric inhibitory receptor of embodiment 64, wherein the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from LIR3 and a second intracellular signaling domain derived from KIR2DL1.
  • Embodiment 72 The chimeric inhibitory receptor of embodiment 71, wherein the first intracellular signaling domain further comprises a transmembrane domain derived from LIR3.
  • Embodiment 73 The chimeric inhibitory receptor of embodiment 64, wherein the chimeric inhibitory receptor comprises a first intracellular signaling domain derived from LIR5 and a second intracellular signaling domain derived from KIR2DL1.
  • Embodiment 74 The chimeric inhibitory receptor of embodiment 73, wherein the first intracellular signaling domain further comprises a transmembrane domain derived from LIR5.
  • Embodiment 75 The chimeric inhibitory receptor of any one of embodiments 1-74, wherein the protein is not expressed on the target tumor.
  • Embodiment 76 The chimeric inhibitory receptor of any one of embodiments 1-75, wherein the protein is expressed on a non -turn or cell.
  • Embodiment 77 The chimeric inhibitory receptor of embodiment 76, wherein the protein is expressed on a non-tumor cell derived from a tissue selected from the group consisting of brain, neuronal tissue, endocrine, endothelial, bone, bone marrow, immune system, muscle, lung, liver, gallbladder, pancreas, gastrointestinal tract, kidney, urinary bladder, male reproductive organs, female reproductive organs, adipose, soft tissue, and skin.
  • a tissue selected from the group consisting of brain, neuronal tissue, endocrine, endothelial, bone, bone marrow, immune system, muscle, lung, liver, gallbladder, pancreas, gastrointestinal tract, kidney, urinary bladder, male reproductive organs, female reproductive organs, adipose, soft tissue, and skin.
  • Embodiment 78 The chimeric inhibitory receptor of any one of embodiments 1-77, wherein the extracellular protein binding domain comprises a ligand-binding domain.
  • Embodiment 79 The chimeric inhibitory receptor of any one of embodiments 1-77, wherein the extracellular protein binding domain comprises a receptor-binding domain.
  • Embodiment 80 The chimeric inhibitory receptor of any one of embodiments 1-77, wherein the extracellular protein binding domain comprises an antigen-binding domain.
  • Embodiment 81 The chimeric inhibitory receptor of embodiment 80, wherein the antigen-binding domain comprises an antibody, an antigen-binding fragment of an antibody, a F(ab) fragment, a F(ab') fragment, a single chain variable fragment (scFv), or a single domain antibody (sdAb).
  • the antigen-binding domain comprises an antibody, an antigen-binding fragment of an antibody, a F(ab) fragment, a F(ab') fragment, a single chain variable fragment (scFv), or a single domain antibody (sdAb).
  • Embodiment 82 The chimeric inhibitory receptor of embodiment 80, wherein the antigen-binding domain comprises a single chain variable fragment (scFv).
  • scFv single chain variable fragment
  • Embodiment 83 The chimeric inhibitory receptor of embodiment 82, wherein each scFv comprises a heavy chain variable domain (VH) and a light chain variable domain (VL).
  • Embodiment 84 The chimeric inhibitory receptor of embodiment 83, wherein the VH and VL are separated by a peptide linker.
  • Embodiment 85 The chimeric inhibitory receptor of embodiment 84, wherein the peptide linker comprises an amino acid sequence selected from the group consisting of: GGS (SEQ ID NO: 23), GGS GGS (SEQ ID NO: 24), GGS GGS GGS (SEQ ID NO: 25),
  • Embodiment 86 The chimeric inhibitory receptor of any one of embodiments 83-85, wherein the scFv comprises the structure VH-L-VL or VL-L-VH, wherein VH is the heavy chain variable domain, L is the peptide linker, and VL is the light chain variable domain.
  • Embodiment 87 The chimeric inhibitory receptor of any one of embodiments 1-86, wherein the transmembrane domain is physically linked to the extracellular protein binding domain.
  • Embodiment 88 The chimeric inhibitory receptor of any one of embodiments 1-87, wherein one of the one or more intracellular signaling domains is physically linked to the transmembrane domain.
  • Embodiment 89 The chimeric inhibitory receptor of any one of embodiments 1-88, wherein the transmembrane domain is physically linked to the extracellular protein binding domain and one of the one or more intracellular signaling domains is physically linked to the transmembrane domain.
  • Embodiment 90 The chimeric inhibitory receptor of any one of embodiments 1-89, wherein the extracellular protein binding domain has a high binding affinity.
  • Embodiment 91 The chimeric inhibitory receptor of any one of embodiments 1-89, wherein extracellular protein binding domain has a low binding affinity.
  • Embodiment 92 The chimeric inhibitory receptor of any one of embodiments 1-91, wherein the chimeric inhibitory receptor is capable of suppressing cytokine production from an activated immunomodulatory cell.
  • Embodiment 93 The chimeric inhibitory receptor of any one of embodiments 1-92, wherein the chimeric inhibitory receptor is capable of suppressing a cell-mediated immune response to a target cell, wherein the immune response is induced by activation of the immunomodulatory cell.
  • Embodiment 94 The chimeric inhibitory receptor of any one of embodiments 1-93, wherein the target cell is a tumor cell.
  • Embodiment 95 The chimeric inhibitory receptor of any one of embodiments 1-94, wherein the one or more intracellular signaling domains comprise one or more modifications.
  • Embodiment 96 The chimeric inhibitory receptor of embodiment 95, wherein the one or more modifications modulate sensitivity of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • Embodiment 97 The chimeric inhibitory receptor of embodiment 95, wherein the one or more modifications increase sensitivity of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • Embodiment 98 The chimeric inhibitory receptor of embodiment 95, wherein the one or more modifications reduce sensitivity of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • Embodiment 99 The chimeric inhibitory receptor of any one embodiments 95-98, wherein the one or more modifications modulate potency of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • Embodiment 100 The chimeric inhibitory receptor of embodiment 99, wherein the one or more modifications increase potency of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • Embodiment 101 The chimeric inhibitory receptor of embodiment 99, wherein the one or more modifications reduce potency of the chimeric inhibitory receptor relative to the otherwise identical, unmodified receptor.
  • Embodiment 102 The chimeric inhibitory receptor of any one of embodiments 95-101, wherein the one or more modifications modulate basal prevention, attenuation, or inhibition of activation of the tumor-targeting chimeric receptor when expressed on an immunomodulatory cell relative to the otherwise identical, unmodified receptor.
  • Embodiment 103 The chimeric inhibitory receptor of embodiment 102, wherein the one or more modifications reduce basal prevention, attenuation, or inhibition relative to the otherwise identical, unmodified receptor.
  • Embodiment 104 The chimeric inhibitory receptor of embodiment 102, wherein the one or more modifications increase basal prevention, attenuation, or inhibition relative to the otherwise identical, unmodified receptor.
  • Embodiment 105 The chimeric inhibitory receptor of any one of embodiments 1-104, wherein the chimeric inhibitory receptor further comprises a spacer region positioned between the extracellular protein binding domain and the transmembrane domain and operably linked to each of the extracellular protein binding domain and the transmembrane domain.
  • Embodiment 106 The chimeric inhibitory receptor of any one of embodiments 1-104, wherein the chimeric inhibitory receptor further comprises a spacer region positioned between the extracellular protein binding domain and the transmembrane domain and physically linked to each of the extracellular protein binding and the transmembrane domain.
  • Embodiment 107 The chimeric inhibitory receptor of embodiment 105, wherein the spacer region is derived from a protein selected from the group consisting of: CD8a, CD4, CD7, CD28, IgGl, IgG4, FcyRIIIa, LNGFR, and PDGFR.
  • Embodiment 108 The chimeric inhibitory receptor of embodiment 105, wherein the spacer region comprises an amino acid sequence selected from the group consisting of:
  • a A AIEVM YPPP YLDNEK SN GTIIH VKGKHLCP SPLFPGP SKP (SEQ ID NO: 39), ESKYGPPCPSCP (SEQ ID NO: 40), ESKYGPPAPSAP (SEQ ID NO: 41), ESKYGPPCPPCP (SEQ ID NO: 42), EPK S CDKTHT CP (SEQ ID NO: 43), AAAFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI YIW APL AGTCGVLLL SL VITL Y CNHRN (SEQ ID NO: 44),
  • ACPTGLYTHSGECCKACNLGEGVAQPCGANQTVC (SEQ ID NO: 47), and AVGQDTQEVIVVPHSLPFKV (SEQ ID NO: 48).
  • Embodiment 109 The chimeric inhibitory receptor of any one of embodiments 105-108, wherein the spacer region modulates sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • Embodiment 110 The chimeric inhibitory receptor of embodiment 109, wherein the spacer region increases sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • Embodiment 111 The chimeric inhibitory receptor of embodiment 109, wherein the spacer region reduces sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • Embodiment 112 The chimeric inhibitory receptor of any one of embodiments 105-111, wherein the spacer region modulates potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • Embodiment 113 The chimeric inhibitory receptor of embodiment 112, wherein the spacer region increases potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • Embodiment 114 The chimeric inhibitory receptor of embodiment 112, wherein the spacer region reduces potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • Embodiment 115 The chimeric inhibitory receptor of any one of embodiments 105-114, wherein the spacer region modulates basal prevention, attenuation, or inhibition of activation of the tumor-targeting chimeric receptor when expressed on an immunomodulatory cell relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • Embodiment 116 The chimeric inhibitory receptor of embodiment 115, wherein the spacer region reduces basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • Embodiment 117 The chimeric inhibitory receptor of embodiment 115, wherein the spacer region increases basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the spacer region.
  • Embodiment 118 The chimeric inhibitory receptor of any one of embodiments 1-117, wherein the chimeric inhibitory receptor further comprises an intracellular spacer region positioned between the transmembrane domain and one of the one or more intracellular signaling domains and operably linked to each of the transmembrane domain and one of the one or more intracellular signaling domains.
  • Embodiment 119 The chimeric inhibitory receptor of any one of embodiments 1-117, wherein the chimeric inhibitory receptor further comprises an intracellular spacer region positioned between the transmembrane domain and one of the one or more intracellular signaling domains and physically linked to each of the transmembrane domain and one of the one or more intracellular signaling domains.
  • Embodiment 120 The chimeric inhibitory receptor of embodiment 118, wherein the intracellular spacer region modulates sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • Embodiment 121 The chimeric inhibitory receptor of embodiment 120, wherein the intracellular spacer region increases sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • Embodiment 122 The chimeric inhibitory receptor of embodiment 120, wherein the intracellular spacer region reduces sensitivity of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • Embodiment 123 The chimeric inhibitory receptor of any one of embodiments 118-122, wherein the intracellular spacer region modulates potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • Embodiment 124 The chimeric inhibitory receptor of embodiment 123, wherein the intracellular spacer region increases potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • Embodiment 125 The chimeric inhibitory receptor of embodiment 123, wherein the intracellular spacer region reduces potency of the chimeric inhibitory receptor relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • Embodiment 126 The chimeric inhibitory receptor of any one of embodiments 118-125, herein the intracellular spacer region modulates basal prevention, attenuation, or inhibition of activation of the tumor-targeting chimeric receptor when expressed on an immunomodulatory cell relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • Embodiment 127 The chimeric inhibitory receptor of embodiment 126, wherein the intracellular spacer region reduces basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • Embodiment 128 The chimeric inhibitory receptor of embodiment 126, wherein the intracellular spacer region increases basal prevention, attenuation, or inhibition relative to an otherwise identical chimeric inhibitory receptor lacking the intracellular spacer region.
  • Embodiment 129 The chimeric inhibitory receptor of any one of embodiments 1-128, wherein the inhibitory chimeric receptor further comprises an enzymatic inhibitory domain.
  • Embodiment 130 The chimeric inhibitory receptor of embodiment 129, wherein the enzymatic inhibitory domain is capable of preventing, attenuating, or inhibiting activation of a tumor-targeting chimeric receptor when expressed on an immunomodulatory cell relative to an otherwise identical chimeric inhibitory receptor lacking the enzymatic inhibitory domain.
  • Embodiment 131 The chimeric inhibitory receptor of embodiment 129 or embodiment 130, wherein the enzymatic inhibitory domain comprises an enzyme catalytic domain.
  • Embodiment 132 The chimeric inhibitory receptor of embodiment 131, wherein the enzyme catalytic domain is derived from an enzyme selected from the group consisting of: CSK, SHP-1, PTEN, CD45, CD148, PTP-MEG1, PTP-PEST, c-CBL, CBL-b, PTPN22,
  • Embodiment 133 The chimeric inhibitory receptor of any one of embodiments 129-132, wherein the enzymatic inhibitory domain comprises one or more modifications that modulate basal prevention, attenuation, or inhibition.
  • Embodiment 134 The chimeric inhibitory receptor of embodiment 133, wherein the one or more modifications reduce basal prevention, attenuation, or inhibition relative to an otherwise identical enzymatic inhibitory domain lacking the one or more modifications.
  • Embodiment 135 The chimeric inhibitory receptor of embodiment 133, wherein the one or more modifications increase basal prevention, attenuation, or inhibition relative to an otherwise identical enzymatic inhibitory domain lacking the one or more modifications.
  • Embodiment 136 The chimeric inhibitory receptor of any one of embodiments 1-135, wherein the tumor-targeting chimeric receptor is a chimeric antigen receptor (CAR) or an engineered T cell receptor (TCR).
  • CAR chimeric antigen receptor
  • TCR engineered T cell receptor
  • Embodiment 137 The chimeric inhibitory receptor of any one of embodiments 1-136, wherein the immunomodulatory cell is selected from the group consisting of: a T cell, a CD8+ T cell, a CD4+ T cell, a gamma-delta T cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a viral-specific T cell, a Natural Killer T (NKT) cell, a Natural Killer (NK) cell, a B cell, a tumor-infiltrating lymphocyte (TIL), an innate lymphoid cell, a mast cell, an eosinophil, a basophil, a neutrophil, a myeloid cell, a macrophage, a monocyte, a dendritic cell, an ESC-derived cell, and an iPSC-derived cell.
  • the immunomodulatory cell is selected from the group consisting of: a T cell, a CD8+ T cell, a CD4+ T cell, a gam
  • Embodiment 138 The chimeric inhibitory receptor of any one of embodiments 1-136, wherein the immunomodulatory cell is a Natural Killer (NK) cell.
  • NK Natural Killer
  • Embodiment 139 A composition comprising the chimeric inhibitory receptor of any one of embodiments 1-138 and a pharmaceutically acceptable carrier.
  • Embodiment 140 An engineered nucleic acid encoding the chimeric inhibitory receptor of any one of embodiments 1-138.
  • Embodiment 141 An expression vector comprising the engineered nucleic acid of embodiment 140.
  • Embodiment 142 A composition comprising the engineered nucleic acid of embodiment 140 or the expression vector of embodiment 141, and a pharmaceutically acceptable carrier
  • Embodiment 143 An isolated immunomodulatory cell comprising the chimeric inhibitory receptor of any one of embodiments 1-138.
  • Embodiment 144 The isolated cell of embodiment 143, wherein the cell further comprises a tumor-targeting chimeric receptor expressed on the surface of the cell.
  • Embodiment 145 The isolated cell of embodiment 144, wherein upon binding of the protein to the chimeric inhibitory receptor, the chimeric inhibitory receptor prevents, attenuates, or inhibits activation of the tumor-targeting chimeric receptor relative to an otherwise identical cell lacking a chimeric inhibitory receptor.
  • Embodiment 146 An isolated immunomodulatory cell comprising a chimeric inhibitory receptor, wherein the chimeric inhibitory receptor comprises:
  • transmembrane domain operably linked to the extracellular protein binding domain
  • intracellular signaling domains wherein the one or more intracellular signaling domains are operably linked to the transmembrane domain, and wherein the one or more intracellular signaling domain are each derived from a protein selected from the group consisting of: SLAPl, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRPa, HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10; and wherein upon binding of the protein to the chimeric inhibitory receptor, the chimeric inhibitory receptor prevents, attenuates, or inhibits activation of a tumor-targeting chimeric receptor expressed on the surface of the cell.
  • a protein selected from the group consisting of: SLAPl, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SI
  • Embodiment 147 The isolated cell of embodiment 146, wherein the cell further comprises a tumor-targeting chimeric receptor expressed on the surface of the cell.
  • Embodiment 148 An isolated cell comprising:
  • a chimeric inhibitory receptor wherein and the chimeric inhibitory receptor comprises:
  • transmembrane domain operably linked to the extracellular protein binding domain
  • intracellular signaling domains wherein the one or more intracellular signaling domains are operably linked to the transmembrane domain, and wherein the one or more intracellular signaling domain are each derived from a protein selected from the group consisting of: SLAP1, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRPa, HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10; and
  • a tumor-targeting chimeric receptor expressed on the surface of the cell, wherein upon binding of the protein to the chimeric inhibitory receptor, the chimeric inhibitory receptor prevents, attenuates, or inhibits activation of the tumor-targeting chimeric receptor.
  • Embodiment 149 The isolated cell of any one of embodiments 143-148, wherein the chimeric inhibitory receptor is recombinantly expressed.
  • Embodiment 150 The isolated cell of any one of embodiments 143-149, wherein the chimeric inhibitory receptor is expressed from a vector or a selected locus from the genome of the cell.
  • Embodiment 151 The isolated cell of any one of embodiments 143-150, wherein the tumor-targeting chimeric receptor is a chimeric antigen receptor (CAR) or an engineered T cell receptor.
  • CAR chimeric antigen receptor
  • Embodiment 152 The cell of any one of embodiments 143-151, wherein prior to binding of the protein to the chimeric inhibitory receptor, the tumor-targeting chimeric receptor is capable of activating the cell.
  • Embodiment 153 The cell of any one of embodiments 143-152, wherein upon binding of the protein to the chimeric inhibitory receptor, the chimeric inhibitory receptor suppresses cytokine production from the activated cell.
  • Embodiment 154 The cell of any one of embodiments 143-153, wherein upon binding of the protein to the chimeric inhibitory receptor, the chimeric inhibitory receptor suppresses a cell-mediated immune response to a target cell, wherein the immune response is induced by activation of the immunomodulatory cell.
  • Embodiment 155 The cell of any one of embodiments 143-154, wherein the transmembrane domain is physically linked to the extracellular protein binding domain.
  • Embodiment 156 The cell of any one of embodiments 143-154, wherein the intracellular signaling domain is physically linked to the transmembrane domain.
  • Embodiment 157 The cell of any one of embodiments 143-154, wherein the transmembrane domain is physically linked to the extracellular protein binding domain and one of the one or more intracellular signaling domains is physically linked to the transmembrane domain.
  • Embodiment 158 The isolated cell of any one of embodiments 143-154, wherein the target cell is a tumor cell.
  • Embodiment 159 The isolated cell of any one of embodiments 143-158, wherein the cell is selected from the group consisting of: a T cell, a CD8+ T cell, a CD4+ T cell, a gamma- delta T cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a viral-specific T cell, a Natural Killer T (NKT) cell, a Natural Killer (NK) cell, a B cell, a tumor-infiltrating lymphocyte (TIL), an innate lymphoid cell, a mast cell, an eosinophil, a basophil, a neutrophil, a myeloid cell, a macrophage, a monocyte, a dendritic cell, an ESC-derived cell, and an iPSC-derived cell.
  • a T cell a CD8+ T cell, a CD4+ T cell, a gamma- delta T cell, a cytotoxic T lymphocyte (CTL), a
  • Embodiment 160 The isolated cell of any one of embodiments 143-158, wherein the cell is a Natural Killer (NK) cell.
  • NK Natural Killer
  • Embodiment 161 The isolated cell of any one of embodiments 143-160, wherein the cell is autologous.
  • Embodiment 162 The isolated cell of any one of embodiments 143-160, wherein the cell is allogeneic.
  • Embodiment 163 A composition comprising the isolated cell of any one of embodiments 143-162 and a pharmaceutically acceptable carrier.
  • Embodiment 164 A method of preventing, attenuating, or inhibiting a cell-mediated immune response induced by a tumor-targeting chimeric receptor expressed of the surface of an immunomodulatory cell, comprising: engineering the immunomodulatory cell to express the chimeric inhibitory receptor of any one of embodiments 1-138 on the surface of the immunomodulatory cell, wherein upon binding of a cognate antigen to the chimeric inhibitory receptor, the intracellular signaling domain prevents, attenuates, or inhibits activation of the tumor targeting chimeric receptor.
  • Embodiment 165 A method of preventing, attenuating, or inhibiting activation of a tumor-targeting chimeric receptor expressed on the surface of an immunomodulatory cell, comprising: contacting the isolated cell of any one of embodiments 143-162 or the composition of embodiment 163 with a cognate antigen of the chimeric inhibitory receptor under conditions suitable for the chimeric inhibitory receptor to bind the cognate antigen, wherein upon binding of the antigen to the chimeric inhibitory receptor, the intracellular signaling domain prevents, attenuates, or inhibits activation of the tumor-targeting chimeric receptor.
  • Embodiment 166 The method of embodiment 164 or embodiment 165, wherein the tumor-targeting chimeric receptor is a chimeric antigen receptor (CAR) or an engineered T cell receptor.
  • CAR chimeric antigen receptor
  • Embodiment 167 The method of embodiment 166, wherein the CAR binds one or more antigens expressed on the surface of a tumor cell.
  • Example 1 Inhibitory chimeric receptor with a SLAP signaling domain reduces T cell activation
  • An inhibitory chimeric receptor (iCAR) with a SLAP1 (Src-like adaptor protein- 1) intracellular signaling domain was synthesized.
  • the inhibitory chimeric receptor comprised an 3 ⁇ 4GK secretion signal, an anti-CD 19 scFv with a FLAG tag, a CD8 hinge domain, a CD28 transmembrane domain, and a SLAPl intracellular signaling domain.
  • the FLAG tag was fused to the N-terminus of the scFv (after the signal sequence) in the iCAR.
  • a tumor targeting CAR (an activating CAR, aCAR) was also constructed with a CD8 secretion signal, an anti-CD20 scFv with a Myc tag, a CD8 hinge domain, a CD28 transmembrane domain, and CD28 and CD3z intracellular signaling domains.
  • the Myc tag was fused to the C- terminus of the scFv in the hinge region in the aCAR.
  • An exemplary diagram of a T cell co expressing an anti-CD 19-SLAP iCAR and an anti-CD20-CD28AT ⁇ aCAR contacting a target cell expressing CD 19 and CD20 is shown in FIG. 1A.
  • Table 9 provides the full sequences of the inhibitory chimeric receptor and tumor targeting chimeric receptor synthesized.
  • lxlO 6 purified CD4+/CD8+ T-cells were thawed and stimulated with 3xl0 6 Dynabeads, then cultured in 1 mL Optimizer CTS T-cell expansion media (Gibco) with 0.2 ug/mL IL-2.
  • T cells were singly or co-transduced on day 2 with lentivirus (100K each, as quantified by GoStix (Tekara)) encoding constitutive expression of the anti-CD20 activating CAR (aCAR) or the anti-CD 19 inhibitory CAR (iCAR).
  • T-cells were counted and distributed into a 96-well plate for co culture assays. Each well contained 5xl0 5 Raji target cells stained with cell trace violet dye (Invitrogen) and 5xl0 5 aCAR expressing T cells. Co-cultures were incubated (37 °C, 5%
  • FIG. 1A An exemplary diagram of a T cell co-expressing an anti-CD20-SLAP iCAR and an anti -CD 19 aCAR contacting a target cell expressing CD 19 and CD20 is shown in FIG. 1A.
  • the cells transduced with the anti-CD 19- SLAP iCAR and anti-CD20 aCAR showed high levels of surface expression in primary T cells.
  • T cells transduced with only the aCAR showed high aCAR expression and no iCAR expression (FIG. 1C), while T cells co-transduced with both the aCAR and iCAR showed high levels of expression of both CAR proteins (FIG. ID).
  • the negative control cells showed no expression of either construct (FIG. IB).
  • the anti-CD 19- SLAP iCAR suppressed the T cell cytokine production induced by the anti-CD20 aCAR (aCD20-28z) after co-culture with Raji cells expressing CD19 and CD20.
  • Co-culture of the Raji cells with anti-CD20 aCAR T cells induced TNF-a, IFN-g, and IL-2 production (FIG. 2A, 2B, and 2C, respectively).
  • T cells expressing both the anti-CD20 aCAR and the anti-CD19 SLAP iCAR had significantly reduced TNF-a, IFN-g, and IL-2 production after co-culture with the Raji target cells (**p>0.01, *** p>0.001).
  • binding of the iCAR to its cognate ligand on the target cell successfully reduced the aCAR- induced cytokine production.
  • an anti-CD 19-SLAP fusion (iCAR) was expressed at high levels in lentivirus transduced CD4+ and CD8+ T-cells without subsequent enrichment. Importantly, high levels of co-expression of iCAR and aCAR were observed after co-transduction.
  • the CD 19- SLAP iCAR suppressed T-cell activation responses (production of the cytokines TNF-a, IFN-g, and IL-2) when the iCAR and aCAR target different cell surface ligands (CD 19 and CD20, respectively).
  • Example 2 Inhibitory chimeric receptors with KIR2DL1, KLRGl, LAIR, LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC-10 signaling domains reduce T cell activation
  • Inhibitory chimeric receptors with KIR2DL1, KLRGl, LAIR, LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC-10 intracellular signaling domains are synthesized.
  • the inhibitory chimeric receptors each comprise a CD8 signal, a pelB signal (excluding SIGLEC- 2 and SIGLEC-10, which only comprise a CD8 signal), an anti-HER2 scFv with a V5 tag, a CD8 hinge domain, and a transmembrane domain and intracellular signaling domain pairing as illustrated in Table 10.
  • the V5 tag is fused to the C-terminus of the scFv in the iCAR.
  • a tumor-targeting CAR (an activating CAR, aCAR) is also constructed with a CD8 secretion signal, an anti-CD20 scFv with a Myc tag, a CD8 hinge domain, a CD28 transmembrane domain, and CD28 and CD3z intracellular signaling domains.
  • the Myc tag is fused to the C- terminus of the scFv in the hinge region in the aCAR.
  • Table 10 provides the transmembrane domain and intracellular signaling domain pairings of this study.
  • Table 11 provides the full sequences of the inhibitory chimeric receptors and tumor-targeting chimeric receptor.
  • lxlO 6 purified CD4+/CD8+ T-cells are thawed and stimulated with 3xl0 6 Dynabeads, then cultured in 1 mL Optimizer CTS T-cell expansion media (Gibco) with 0.2 ug/mL IL-2.
  • T cells are singly or co-transduced on day 2 with lentivirus (100K each, as quantified by GoStix (Tekara)) encoding constitutive expression of the anti-CD20 activating CAR (aCAR) or the anti-HER2 inhibitory CAR (iCAR).
  • the Dynabeads are removed by magnet.
  • the T-cells are counted and passaged (0.5xl0 6 cells/mL).
  • An aliquot of these cells is stained with PE conjugated anti- MYC and BV421 conjugated anti-V5 antibodies (corresponding to the aCAR and the iCAR, respectively), and their transgene expression quantified using an LX CytoFlex Flow Cytometry machine.
  • cells are passaged every two days (0.5xl0 6 cells/mL).
  • the T-cells are counted and distributed into a 96-well plate for co culture assays.
  • Two populations of Raji cells are tested: a parental line, which endogenously expresses CD20+, and an exogenous HER overexpressing Raji line (CD20+Her2+).
  • Each well contained 5xl0 4 Raji target cells stained with cell trace violet dye (Invitrogen) and 5xl0 4 aCAR expressing T cells.
  • Co-cultures are incubated (37 °C, 5% CO2) for 18 hrs.
  • the anti-HER2 iCARs having KIR2DL1, KLRG1, LAIR, LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC-10 derived inhibitory intracellular signaling domains suppress the T cell cytokine production induced by the anti-CD20 aCAR (aCD20-28z) after co-culture with Raji cells expressing HER2 and CD20. Co-culture of the Raji cells with anti-CD20 aCAR T cells induced TNF-a, IFN-g, and IL-2 production.
  • T cells expressing both the anti- CD20 aCAR and the anti-HER2 iCARs having KIR2DL1, KLRG1, LAIR, LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC-10 derived inhibitory intracellular signaling domains have significantly reduced TNF-a, IFN-g, and IL-2 production after co-culture with the Raji target cells.
  • binding of the iCAR to its cognate ligand on the target cell successfully reduces the aCAR-induced cytokine production.
  • Anti-HER2 iCARs having KIR2DL1, KLRG1, LAIR, LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC-10 derived inhibitory intracellular signaling domains are expressed at high levels in lentivirus transduced CD4+ and CD8+ T-cells without subsequent enrichment. High levels of co-expression of iCAR and aCAR are observed after co-transduction.
  • the anti-HER2 iCARs having KIR2DL1, KLRG1, LAIR, LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC-10 derived inhibitory intracellular signaling domains suppress T-cell activation responses (production of the cytokines TNF-a, IFN-g, and IL-2) when the iCAR and aCAR target different cell surface ligands (HER2 and CD20, respectively).
  • Example 3 Inhibitory chimeric receptors with KIR2DL1, KLRGl, LAIR, LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC-10 signaling domains reduce NK cell activation
  • Inhibitory chimeric receptors with KIR2DL1, KLRGl, LAIR, LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC-10 intracellular signaling domains are synthesized as described in Example 2 above.
  • NK cells are expanded for 10 days with mitomycin C-treated K562 feeder cells, followed by transduction with 7.5 xlO 5 pg of each lentivirus for aCAR and iCAR constructs. Sequences for the constructs to be assessed are shown in Table 11 above. After 4 days, puromycin is added to cells for selection.
  • cytotoxicity assays are performed by co-incubating engineered NK cells and target cells: parental Raji cells (WT) or Raji cells engineered to overexpress Her2 antigens.
  • Engineered NK cells are incubated either with (1) each target cell type separately at a ratio of 25,000 NK cells to 50,000 Raji cells in triplicate; or (2) as a mixture of 25,000 Raji Her2 only and 25,000 dual antigen Her2+ Raji cells co-incubated with 25,000 NK cells of the indicated type in a 1 : 1 : 1 ratio (dual antigen targets were stained with different membrane dyes, allowing them to be distinguished by flow).
  • cells are stained with viability dyes and counted via flow cytometry. The target cell reduction is quantified as 100% x (1- No. Targets / No. Targets (NV)).
  • the anti-HER2 iCARs having KIR2DL1, KLRG1, LAIR, LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC-10 derived inhibitory intracellular signaling domains suppress the NK cell-mediated cytotoxicity of the anti-CD20 aCAR (aCD20-28z) after co-culture with Raji cells expressing HER2 and CD20.
  • Co-culture of the Raji target cells with anti-CD20 aCAR K cells induced cytotoxicity of parental target cells.
  • NK cells expressing both the anti-CD20 aCAR and the anti-HER2 iCARs having KIR2DL1, KLRG1, LAIR
  • LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC-10 derived inhibitory intracellular signaling domains have reduced cytotoxicity after co-culture with the Raji target cells.
  • binding of the iCAR to its cognate ligand on the target cell successfully reduces aCAR-induced cytotoxicity.
  • Anti-HER2 iCARs having KIR2DL1, KLRG1, LAIR, LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC-10 derived inhibitory intracellular signaling domains are expressed at high levels in lentivirus transduced NK cell without subsequent enrichment. High levels of co-expression of iCAR and aCAR are observed after co-transduction.
  • the anti- HER2 iCARs having KIR2DL1, KLRG1, LAIR, LIR2, LIR3, LIR5, SIGLEC-2, or SIGLEC- 10 derived inhibitory intracellular signaling domains suppress NK cell activity (NK cell- mediated cytotoxicity) when the iCAR and aCAR target different cell surface ligands (HER2 and CD20, respectively).
  • iCAR and aCAR constructs were packaged into lentiviral particles and used to transduce primary NK cells after 10 d expansion with K562 feeder cells with 500 U/mL IL-2 and 20 ng/uL IL-15. Virus amounts were set by p24 titer (750,000 pg per transduction). iCAR constructs contained puroR cassettes, so puromycin was added to NK cell cultures from day 4 to 7 post transduction, at which time expression was assessed by flow cytometry and NK cells were transferred to a microwell plate for killing assays with 12,500 NK cells and 50,000 total tumor cells.
  • NK cells were cultured with (1) tumor cells expressing aCAR antigen FLT3 only, (2) tumor cells expressing both aCAR antigen FLT3 and iCAR antigen EMCN, or (3) both tumor cell types mixed. After 16-18 hrs, cultures were analyzed by flow cytometry and remaining live targets cells of each type were counted.
  • aCAR-mediated killing (basal subtracted) of a given NK cell type was quantified by first calculating total killing (reduction of targets compared to a target-only condition), and then subtracting total killing by control (iCAR-only) NK cells.
  • iCAR-mediated protection was quantified as the change in aCAR-mediated killing between targets with or without iCAR antigen.
  • Killing assay supernatant was analyzed for TNFa secretion, and aCAR and iCAR performance metrics were calculated analogously to killing.
  • iCARs were stained with aV5-Alexafluor 647 and aCARs with aFLAG-BV-421. Cells were assigned to 4 quadrants based on iCAR+/- and aCAR+/- expression states, allowing us to assess “%aCAR+iCAR+” and “% not aCAR+iCAR-” (aCAR+iCAR- are ungated and potentially toxic CAR-NK cells and are to be avoided).
  • MFI median fluorescence intensity
  • the anti-EMCN iCAR constructs assessed used the formats shown in Table 12 with reference to the intracellular domain.
  • the anti-FLT3 aCAR construct assessed is also shown in Table 12.
  • NK cells were engineered to express activating chimeric receptors (aCARS) and inhibitory chimeric receptors (iCARs) having various inhibitory domain formats derived from different inhibitory receptors.
  • aCARS activating chimeric receptors
  • iCARs inhibitory chimeric receptors
  • NK cells were virally transduced with aCAR only or in combination with iCARs having the various inhibitory domains indicated.
  • Engineered NK cells were assessed for CAR expression. As shown in FIG. 3, among aCAR+iCAR+ NK cells (top panel), anti-FLT3 aCAR expression was generally greater than 10-fold above background and anti-EMCN iCAR expression was generally greater than 100-fold. LIR family constructs demonstrated notably high expression relative to other constructs.
  • the profile of CAR expressing populations was also assessed (bottom panel) and demonstrated the total population contained fewer than 5% aCAR+iCAR- cells and had varying percentages of aCAR+iCAR+ populations for the various iCAR formats, with KLRG1, LIR2, LIR3, LIR5, and SIGLEC-2 formats having consistently greater than 50% of cells being aCAR+iCAR+.
  • LIR family iCARs notably generally demonstrated a greater proportion of aCAR+iCAR+ cells relative to other constructs.
  • NK cells expressing LIR2, LIR3, LIR5, KIR2DL1, LAIRl, and SIGLEC-2 anti-EMCN iCAR formats demonstrated consistent aCAR-mediated performance in killing (top panels) and iCAR-mediated protection in both killing (top panels) and cytokine reduction (bottom panel), with SIGLEC-10 and KLRG1 constructs varying more in their performance.
  • NK cells were successfully engineered to co-express aCARs and iCARs, successfully kill target cells and produce cytokines in the absence of an iCAR ligand in an aCAR ligand dependent manner, and various iCAR formats successfully reduced NK-mediated killing and cytokine production in an iCAR ligand dependent manner.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Zoology (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Cell Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Oncology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2021/018847 2020-02-20 2021-02-19 Inhibitory chimeric receptor architectures Ceased WO2021168298A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
EP21756389.9A EP4107174A4 (en) 2020-02-20 2021-02-19 ARCHITECTURES OF INHIBITORY CHIMERIC RECEPTORS
JP2022549811A JP2023515471A (ja) 2020-02-20 2021-02-19 抑制性キメラ受容体構造物
CN202180021605.7A CN115298209A (zh) 2020-02-20 2021-02-19 抑制性嵌合受体构造体
US17/820,804 US20230272037A1 (en) 2020-02-20 2022-08-18 Inhibitory chimeric receptor architectures

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202062979310P 2020-02-20 2020-02-20
US62/979,310 2020-02-20
US202063127843P 2020-12-18 2020-12-18
US63/127,843 2020-12-18

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/820,804 Continuation US20230272037A1 (en) 2020-02-20 2022-08-18 Inhibitory chimeric receptor architectures

Publications (2)

Publication Number Publication Date
WO2021168298A1 true WO2021168298A1 (en) 2021-08-26
WO2021168298A9 WO2021168298A9 (en) 2022-09-22

Family

ID=77392276

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/018847 Ceased WO2021168298A1 (en) 2020-02-20 2021-02-19 Inhibitory chimeric receptor architectures

Country Status (6)

Country Link
US (1) US20230272037A1 (https=)
EP (1) EP4107174A4 (https=)
JP (1) JP2023515471A (https=)
CN (1) CN115298209A (https=)
TW (1) TW202146436A (https=)
WO (1) WO2021168298A1 (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022082059A1 (en) * 2020-10-16 2022-04-21 Senti Biosciences, Inc. Chimeric receptors and methods of use thereof
WO2024026199A3 (en) * 2022-07-26 2024-04-11 Senti Biosciences, Inc. Inhibitory chimeric receptor architectures
EP4511403A4 (en) * 2022-04-20 2026-04-15 Senti Biosciences Inc DOMAINS OF BINDING TO AN ANTIGEN AND THEIR METHODS OF USE
US12611458B2 (en) 2023-04-14 2026-04-28 Senti Biosciences, Inc. Chimeric receptors and methods of use thereof

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016075612A1 (en) * 2014-11-12 2016-05-19 Rinat Neuroscience Corp. Inhibitory chimeric antigen receptors
US20180346541A1 (en) * 2015-11-23 2018-12-06 Trustees Of Boston University Methods and compositions relating to chimeric antigen receptors
WO2019068007A1 (en) * 2017-09-28 2019-04-04 Immpact-Bio Ltd. UNIVERSAL PLATFORM FOR PREPARING AN INHIBITORY CHIMERIC ANTIGEN RECEPTOR (ICAR)
US20200016204A1 (en) * 2013-11-21 2020-01-16 Ucl Business Plc Cell
WO2020065406A2 (en) * 2018-09-28 2020-04-02 Immpact-Bio Ltd. Methods for identifying activating antigen receptor (acar)/inhibitory chimeric antigen receptor (icar) pairs for use in cancer therapies
WO2021035093A1 (en) * 2019-08-20 2021-02-25 Senti Biosciences, Inc. Chimeric inhibitory receptor

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2978186A1 (en) * 2015-03-05 2016-09-09 Fred Hutchinson Cancer Research Center Immunomodulatory fusion proteins and uses thereof
EP3962527A4 (en) * 2019-04-30 2023-11-01 Senti Biosciences, Inc. CHIMERIC RECEPTORS AND METHODS OF USE THEREOF

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20200016204A1 (en) * 2013-11-21 2020-01-16 Ucl Business Plc Cell
WO2016075612A1 (en) * 2014-11-12 2016-05-19 Rinat Neuroscience Corp. Inhibitory chimeric antigen receptors
US20180346541A1 (en) * 2015-11-23 2018-12-06 Trustees Of Boston University Methods and compositions relating to chimeric antigen receptors
WO2019068007A1 (en) * 2017-09-28 2019-04-04 Immpact-Bio Ltd. UNIVERSAL PLATFORM FOR PREPARING AN INHIBITORY CHIMERIC ANTIGEN RECEPTOR (ICAR)
WO2020065406A2 (en) * 2018-09-28 2020-04-02 Immpact-Bio Ltd. Methods for identifying activating antigen receptor (acar)/inhibitory chimeric antigen receptor (icar) pairs for use in cancer therapies
WO2021035093A1 (en) * 2019-08-20 2021-02-25 Senti Biosciences, Inc. Chimeric inhibitory receptor

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP4107174A4 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022082059A1 (en) * 2020-10-16 2022-04-21 Senti Biosciences, Inc. Chimeric receptors and methods of use thereof
EP4228682A4 (en) * 2020-10-16 2024-11-13 Senti Biosciences, Inc. Chimeric receptors and methods of use thereof
EP4511403A4 (en) * 2022-04-20 2026-04-15 Senti Biosciences Inc DOMAINS OF BINDING TO AN ANTIGEN AND THEIR METHODS OF USE
WO2024026199A3 (en) * 2022-07-26 2024-04-11 Senti Biosciences, Inc. Inhibitory chimeric receptor architectures
US12611458B2 (en) 2023-04-14 2026-04-28 Senti Biosciences, Inc. Chimeric receptors and methods of use thereof

Also Published As

Publication number Publication date
EP4107174A1 (en) 2022-12-28
WO2021168298A9 (en) 2022-09-22
CN115298209A (zh) 2022-11-04
TW202146436A (zh) 2021-12-16
EP4107174A4 (en) 2024-10-30
US20230272037A1 (en) 2023-08-31
JP2023515471A (ja) 2023-04-13

Similar Documents

Publication Publication Date Title
US20250026840A1 (en) Chimeric antigen receptors against axl or ror2 and methods of use thereof
US20230235051A1 (en) Inhibitory chimeric receptor architectures
US20220289842A1 (en) Chimeric inhibitory receptor
US20230272037A1 (en) Inhibitory chimeric receptor architectures
JP2022513116A (ja) Nk細胞のための人工hla陽性フィーダー細胞株及びその使用
WO2017219937A1 (zh) 一种高效稳定表达抑制性抗体的car-t细胞及其用途
JP2018532407A (ja) 受容体
US11512139B2 (en) Chimeric antigen receptor with cytokine receptor activating or blocking domain
CN117460741A (zh) 调控细胞生理活动的嵌合多肽
EP3703713A1 (en) Vectors
WO2025130934A1 (zh) 表达膜结合型il-15融合蛋白的工程化til及其应用
US11701387B2 (en) Chimeric antigen receptor specific for BDCA2 antigen
TW202241937A (zh) 用於追踪基因工程細胞的肽標記
US20230310606A1 (en) Chimeric myd88 receptors for redirecting immunosuppressive signaling and related compositions and methods
US20230072955A1 (en) Chimeric antigen receptors to her2 and methods of use thereof
US20240191259A1 (en) Compositions and methods for delivery of therapeutic agents to acceptor cells
US20250339534A1 (en) Inhibitory chimeric receptor architectures
US20240109978A1 (en) Chimeric antigen receptor (car) spacer modifications enhance car t cell functionality
US20250059569A1 (en) Compositions and methods for delivery of therapeutic agents to acceptor cells

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21756389

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2022549811

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021756389

Country of ref document: EP

Effective date: 20220920