WO2021133776A1 - Methods for treating or preventing allergic asthma by administering an il-33 antagonist and/or an il-4r antagonist - Google Patents

Methods for treating or preventing allergic asthma by administering an il-33 antagonist and/or an il-4r antagonist Download PDF

Info

Publication number
WO2021133776A1
WO2021133776A1 PCT/US2020/066559 US2020066559W WO2021133776A1 WO 2021133776 A1 WO2021133776 A1 WO 2021133776A1 US 2020066559 W US2020066559 W US 2020066559W WO 2021133776 A1 WO2021133776 A1 WO 2021133776A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
antigen
seq
subject
binding fragment
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/066559
Other languages
English (en)
French (fr)
Inventor
Helene Goulaouic
El-Bdaoui Haddad
Sara HAMON
Sivan HAREL
Georgios KALLIOLIAS
Marcella RUDDY
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sanofi Biotechnology SAS
Regeneron Pharmaceuticals Inc
Original Assignee
Sanofi Biotechnology SAS
Regeneron Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020227025216A priority Critical patent/KR20220119446A/ko
Priority to US17/786,226 priority patent/US20230340101A1/en
Priority to JP2022538719A priority patent/JP2023508360A/ja
Priority to EP20842863.1A priority patent/EP4081544A1/en
Priority to AU2020415382A priority patent/AU2020415382A1/en
Priority to CA3162507A priority patent/CA3162507A1/en
Priority to CN202080096917.XA priority patent/CN115151568A/zh
Priority to MX2022007958A priority patent/MX2022007958A/es
Application filed by Sanofi Biotechnology SAS, Regeneron Pharmaceuticals Inc filed Critical Sanofi Biotechnology SAS
Priority to BR112022011388A priority patent/BR112022011388A2/pt
Publication of WO2021133776A1 publication Critical patent/WO2021133776A1/en
Priority to IL294066A priority patent/IL294066A/en
Anticipated expiration legal-status Critical
Priority to JP2025283256A priority patent/JP2026068738A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244Interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the invention relates to the treatment and/or prevention of allergic asthma and related conditions. More specifically, the invention relates to the administration of an interleukin-33 (IL-33) antagonist to treat or prevent allergic asthma in a patient in need thereof. The invention also relates to the administration of an interleukin-4 (IL-4R) antagonist to treat or prevent allergic asthma in a patient in need thereof. Finally, the invention relates to the administration of an IL-33 (IL-33) antagonist and an interleukin-4 receptor (IL-4R) antagonist to treat or prevent allergic asthma in a patient in need thereof.
  • IL-33 interleukin-33
  • IL-4R interleukin-4 receptor
  • Asthma is a chronic inflammatory disease of the airways characterized by airway hyper- responsiveness, acute and chronic bronchoconstriction, airway edema, and mucus plugging.
  • the inflammation component of asthma is thought to involve many cell types, including mast cells, eosinophils, T lymphocytes, neutrophils, and epithelial cells, and their biological products.
  • Patients with asthma most often present with symptoms of wheezing, shortness of breath, cough, and chest tightness.
  • controller therapy and bronchodilator therapy are used to provide long-term control.
  • Inhaled corticosteroids are considered the “gold standard” in controlling asthma symptoms, and inhaled beta2-agonists are the most effective bronchodilators currently available.
  • Type 2-high asthma is the most prevalent type of persistent asthma (Fahy (2015) Nat. Rev. Immunol. 15:57-65). It includes the overlapping phenotypes allergic asthma (characterized by increased expression of specific immunoglobulin E (IgE) to aeroallergens) and eosinophilic asthma (characterized by blood and/or airway/tissue eosinophilia) (Fahy, Supra; Campo et al. (2013) J. Investig. Allergol. Clin. Immunol. 23:76-88; Wenzel (2012) Clin Exp Allergy 42:650- 8).
  • IgE immunoglobulin E
  • eosinophilic asthma characterized by blood and/or airway/tissue eosinophilia
  • Allergic asthma is the most common type of asthma. Allergic sensitization is a strong risk factor for asthma inception and severity in children and in adults (Gough et al. (2015) Pediatr. Allergy Immunol. 26:431-437). Current allergic asthma therapies that address symptoms and the ongoing inflammatory process of the disease do not affect the underlying, dysregulated immune response and, therefore, are very limited in controlling allergic asthma progression (Dhami et al. (2017) Eur. J. Allergy Clin. Immunol. 72(12):1825-1848)).
  • a method for treating allergic asthma in a subj ect in need thereof comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided for use to treat allergic asthma in a subject in need thereof.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the antibody or antigen-binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 10.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the antibody or antigen-binding fragment thereof comprises REGN3500.
  • the antibody or antigen-binding fragment thereof is administered intravenously at a dose of 10 mg/kg. In certain exemplary embodiments, the antibody or antigen binding fragment thereof is administered subcutaneously at a dose of about 0.1 mg to about 600 mg, about 100 mg to about 400 mg, or about 300 mg. In certain exemplary embodiments, the antibody or antigen binding fragment thereof is administered subcutaneously at an initial dose of about 600 mg or about 300 mg. In certain exemplary embodiments, the antibody or antigen binding fragment thereof is administered subcutaneously in one or more secondary doses of about 300 mg.
  • a method for treating allergic asthma in a subject in need thereof comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-4R (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen-binding fragment thereof that specifically binds interleukin-4R (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided for use to treat allergic asthma in a subject in need thereof.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the antibody or antigen-binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 27 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 28.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the antibody or antigen-binding fragment thereof comprises dupilumab.
  • the antibody or antigen binding fragment thereof is administered at a dose of about 0.1 mg to about 600 mg, about 100 mg to about 400 mg, or about 300 mg. In certain exemplary embodiments, the antibody or antigen binding fragment thereof is administered at an initial dose of about 600 mg. In certain exemplary embodiments, the antibody or antigen binding fragment thereof is administered in one or more secondary doses of about 300 mg.
  • the antibody or antigen-binding fragment thereof is administered every week (qlw), every other week (q2w), every three weeks (q3w), or every four weeks (q4w). In certain exemplary embodiments, the antibody or antigen-binding fragment thereof is administered every other week (q2w).
  • the antibody or antigen-binding fragment thereof is administered subcutaneously. In certain exemplary embodiments, the antibody or antigen binding fragment thereof is administered subcutaneously using an autoinjector, a needle and syringe, or a pen delivery device.
  • a method for treating allergic asthma in a subject in need thereof comprising administering to the subject an initial dose of about 600 mg of an antibody or antigen-binding fragment thereof that specifically binds interleukin-4R (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, and one or more subsequent doses of about 300 mg of the antibody or antigen-binding fragment thereof, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the antibody or antigen-binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 27 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 28.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • a method for treating allergic asthma in a subject in need thereof comprising administering to the subject a first antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, and a second antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the first antibody or antigen-binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 10.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the first antibody or antigen-binding fragment thereof comprises REGN3500.
  • the second antibody or antigen binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 27 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 28.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the second antibody or antigen-binding fragment thereof comprises dupilumab.
  • the second antibody or antigen binding fragment thereof is administered at a dose of about 0.1 mg to about 600 mg, about 100 mg to about 400 mg, or about 300 mg. In certain exemplary embodiments, the second antibody or antigen binding fragment thereof is administered at an initial dose of about 600 mg. In certain exemplary embodiments, the second antibody or antigen binding fragment thereof is administered in one or more subsequent doses of about 300 mg of the antibody or antigen binding fragment thereof. [0021] In certain exemplary embodiments, the second antibody or antigen-binding fragment thereof is administered every week (qlw), every other week (q2w), once every three weeks (q3w), or once every four weeks (q4w). In certain exemplary embodiments, the second antibody or antigen-binding fragment thereof is administered every other week (q2w).
  • the second antibody or antigen-binding fragment thereof is administered subcutaneously.
  • the antibody or antigen-binding fragment thereof is administered subcutaneously using an autoinjector, a needle and syringe, or a pen delivery device.
  • the first antibody or antigen-binding fragment thereof is administered intravenously at a dose of 10 mg/kg. In certain exemplary embodiments, the first antibody or antigen binding fragment thereof is administered subcutaneously at a dose of about 0.1 mg to about 600 mg, about 100 mg to about 400 mg, or about 300 mg. In certain exemplary embodiments, the first antibody or antigen binding fragment thereof is administered subcutaneously at an initial dose of about 600 mg or about 300 mg. In certain exemplary embodiments, the first antibody or antigen binding fragment thereof is administered subcutaneously in one or more secondary doses of about 300 mg.
  • a method for treating allergic asthma in a subject in need thereof comprising administering to the subject a first antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, wherein the first antibody or antigen-binding fragment thereof is administered at a single dose of 10 mg/kg, and a second antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, wherein the second antibody or antigen-binding fragment thereof is administered at an initial dose of 600 mg and one or more subsequent doses
  • HCDR heavy chain complement
  • HCDR heavy chain complementar
  • the allergic asthma is mild allergic asthma. In certain exemplary embodiments, the allergic asthma is mild persistent allergic asthma.
  • the subject is allergic to house dust mite allergen (HDM).
  • the subject is a non-smoker.
  • the subject is clinically stable and requires short-acting inhaled b2 agonist (SABA) use on a per needed basis to control asthma symptoms.
  • SABA short-acting inhaled b2 agonist
  • loss of asthma control is reduced in the subject.
  • an asthma symptom selected from the group consisting of cough, wheezing, and short-acting inhaled b2 agonist use is reduced in the subject.
  • one or more asthma-associated parameter(s) are improved in the subject.
  • the asthma-associated parameter is selected from the group consisting of forced expiratory volume in 1 second (FEV1), peak expiratory flow (PEF), forced vital capacity (FVC), forced expiratory flow (FEF) 25%-75%, and reduction of the frequency or the dosage of short-acting inhaled b2 agonist use in the subject.
  • pre-bronchodilator FEV1 is improved in the subject.
  • blood eosinophil levels are reduced in the subject.
  • one or both of asthma control questionnaire 5- question version (ACQ-5) score and asthma quality of life questionnaire with standardized activities (AQLQ) score are improved in the subject.
  • the frequency or the dosage of SABA use in the subject is reduced.
  • BAC-induced lung inflammation is reduced in the subject.
  • level of a type 2 cytokine is decreased in the subject.
  • the type 2 cytokine is selected from the group consisting of IL-13 and IL-5.
  • the level of the type 2 cytokine is measured by determining an mRNA level of one or more type 2 mediator genes, and wherein the mRNA level is decreased by at least about 50%, 60%, 70%, 80%, or 90%.
  • a level of a cytokine or chemokine selected from the group consisting of tumor necrosis factor-alpha (TNFa), TARC, pulmonary and activation-regulated chemokine (PARC), CCL1, CCL26, FCER2, SIGLEC8, CCL17, and eotaxin-3 is decreased in the subject.
  • TNFa tumor necrosis factor-alpha
  • PARC pulmonary and activation-regulated chemokine
  • CCL1, CCL26, FCER2, SIGLEC8, CCL17, and eotaxin-3 is decreased in the subject.
  • early allergen response EAR
  • late allergen response LAR
  • FEV1 is improved in the subject by at least 20%, 30%, 40%, 50%, 60%, or 70%.
  • FeNO levels are reduced in the subject.
  • serum levels of sST2, IL-33, calcitonin, or matrix metalloproteinase- 12 (MMP12) are reduced in the subject.
  • serum levels of CCL26, CCL17, or SIGLEC8 are reduced in the subject.
  • serum levels of ASAP1-IT1, AX747757, BC042385, PABPC1P2, AB209315, AX748268, TCEAL5, CCL13, CLC, CACNG8, GPR82, GATA1, PRSS33, FFAR3, LGALS12, ASB2, PTGDR2, IL-13, IL-5, PTGDS, or RD3 are reduced in the subject.
  • a method for reducing a cytokine level or a chemokine level in a subject having allergic asthma comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen- binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided for use to reduce a cytokine level or a chemokine level in a subject having allergic asthma.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the cytokine is one or both of IL-13 and IL-5.
  • the cytokine or chemokine is selected from the group consisting of TNFa, TARC, PARC, CCL1, CCL26, FCER2, SIGLEC8, CCL17 and eotaxin-3.
  • serum levels of sST2, IL-33, calcitonin or MMP12 are reduced in the subject.
  • serum levels of CCL26, CCL17 or SIGLEC8 are reduced in the subject.
  • the anti-IL-33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 10.
  • the anti-IL-33 antibody or antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO; 18 and a light chain comprising the amino acid sequence of SEQ ID NO: 20.
  • the method further comprises administering to the subject an antibody or antigen-binding fragment thereof that specifically binds IL-4R, wherein the antibody or antigen-binding fragment thereof comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • a method for reducing expression of one or more allergic asthma signature genes in a subject having allergic asthma comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL- 33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided to reduce expression of one or more allergic asthma signature genes in a subject having allergic asthma.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the one or more allergic asthma signature genes are selected from the group consisting of BC042385, AB209315, LOC100607117, BC035084, LOC145474, AX747853, TIMP1, NT5DC2, LOC541471, AREG, PTPN7, RUNDC3, XXYLT1, FAM159A, PTGDS, TESC, ITGB2-AS1, D0574721, CLDN9, LOC100132052, AGAP7, NBEAL2, NTNG2, FLJ45445, KCNH3, POU51P3, OUG1, KIF21B, HSPA7, GAPT, BX6485Q2, PRR52, P1K3R6, LTC4S, CLEC11A, TRABD2A, DLGAP3, VDR, DKFZp686M11215, SIGLEC12, BC016361, BC052769, and RHOH.
  • the one or more allergic asthma signature genes are selected from the group consisting of ASAP1-IT1, AX747757, BC042385, PABPC1P2, AB209315, AX748268, TCEAL5, CCL17, CCL13, CCL26, CLC, CACNG8, GPR82, GATA1, PRSS33, FFAR3, LGALS12, ASB2, PTGDR2, SIGLEC8, IL13, IL5, PTGDS and RD3.
  • the anti-IL-33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 10.
  • the anti-IL-33 antibody or antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO; 18 and a light chain comprising the amino acid sequence of SEQ ID NO: 20.
  • the method further comprises administering to the subject an antibody or antigen-binding fragment thereof that specifically binds IL-4R, wherein the antibody or antigen-binding fragment thereof comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • a method for reducing expression of any combination of type 2 inflammatory cytokine and type 2 chemokine signature genes in a subject having allergic asthma comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided to reduce expression of any combination of type 2 inflammatory cytokine and type 2 chemokine signature genes in a subject having allergic asthma.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the type 2 inflammatory cytokine and chemokine signature genes are selected from the group consisting of IL-5, CCL1, IL-13, GATA2, CCL26, FCER2, CACNG8, CLC, GATA1, LGALS12, SIGLEC8, GGT5, CCL17 and MMP10.
  • the one or more type 2 inflammatory cytokine and chemokine signature genes are selected from the group consisting of IL-5, CCL1, IL-13, CCL26, FCER2, SIGLEC8, GGT5 and CCL17.
  • the anti-IL-33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 10.
  • the anti-IL-33 antibody or antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO; 18 and a light chain comprising the amino acid sequence of SEQ ID NO: 20.
  • the method further comprises administering to the subject an antibody or antigen-binding fragment thereof that specifically binds IL-4R, wherein the antibody or antigen-binding fragment thereof comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • a method for reducing expression of one or more eosinophil signature genes in a subject having allergic asthma comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided for use to reduce expression of one or more eosinophil signature genes in a subject having allergic asthma.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the one or more one or more eosinophil signature genes are selected from the group consisting of IL1RL1, AD ARBI, SIGLEC8, ASB2, VSTM1, SYNE1, CLC, PTPN7 and HDC.
  • the anti-IL-33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 10.
  • the anti-IL-33 antibody or antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO; 18 and a light chain comprising the amino acid sequence of SEQ ID NO: 20.
  • the method further comprises administering to the subject an antibody or antigen-binding fragment thereof that specifically binds IL-4R, wherein the antibody or antigen-binding fragment thereof comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • a method for reducing expression of one or more type 2 inflammatory signature genes in a subject having allergic asthma comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL- 33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen-binding fragment thereof that specifically binds interleukin-33 (IL-33) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16, is provided for use to reduce expression of one or more type 2 inflammatory signature genes in a subject having allergic asthma.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the one or more type 2 inflammatory signature genes are selected from the group consisting of IL-4, IL-13, CCL26, CCL13, CCL17. CCL11, POSTN, IL-5 and IL-9.
  • the anti-IL-33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 10.
  • the anti-IL-33 antibody or antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO; 18 and a light chain comprising the amino acid sequence of SEQ ID NO: 20.
  • the method further comprises administering to the subject an antibody or antigen-binding fragment thereof that specifically binds IL-4R, wherein the antibody or antigen-binding fragment thereof comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • a method for reducing a cytokine level or a chemokine level in a subject having allergic asthma comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided for use to reduce a cytokine level or a chemokine level in a subject having allergic asthma.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the cytokine is one or both of IL-13 and IL-5.
  • the cytokine or chemokine is selected from the group consisting of TNFa, TARC, PARC, CCL1, CCL26, FCER2, SIGLEC8, CCL17 and eotaxin-3.
  • serum levels of sST2, IL-33, calcitonin or MMP12 are reduced in the subject.
  • serum levels of CCL26, CCL17 or SIGLEC8 are reduced in the subject.
  • the antibody or antigen binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 27 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 28.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the antibody or antigen-binding fragment thereof comprises dupilumab.
  • the method further comprises administering to the subject an antibody or antigen-binding fragment thereof that specifically binds IL-33, wherein the antibody or antigen-binding fragment thereof comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • a method for reducing expression of one or more allergic asthma signature genes in a subject having allergic asthma comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided for use to reduce expression of one or more allergic asthma signature genes in a subject having allergic asthma.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the one or more allergic asthma signature genes are selected from the group consisting of BC042385, AB209315, LOC100607117, BC035084, LOC145474, AX747853, TIMP1, NT5DC2, LOC541471, AREG, PTPN7, RUNDC3, XXYLT1, FAM159A, PTGDS, TESC, ITGB2-AS1, D0574721, CLDN9, LOC100132052, AGAP7, NBEAL2, NTNG2, FLJ45445, KCNH3, POU51P3, OUG1, KIF21B, HSPA7, GAPT, BX6485Q2, PRR52, P1K3R6, LTC4S, CLEC11A, TRABD2A, DLGAP3, VDR, DKFZp686M11215, SIGLEC12, BC016361, BC052769, and RHOH.
  • the one or more allergic asthma signature genes are selected from the group consisting of ASAP1-IT1, AX747757, BC042385, PABPC1P2, AB209315, AX748268, TCEAL5, CCL17, CCL13, CCL26, CLC, CACNG8, GPR82, GATA1, PRSS33, FFAR3, LGALS12, ASB2, PTGDR2, SIGLEC8, IL13, IL5, PTGDS and RD3.
  • the antibody or antigen binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 27 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 28.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the antibody or antigen-binding fragment thereof comprises dupilumab.
  • the method further comprises administering to the subject an antibody or antigen-binding fragment thereof that specifically binds IL-33, wherein the antibody or antigen-binding fragment thereof comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • a method for reducing expression of any combination of type 2 inflammatory cytokine and type 2 chemokine signature genes in a subject having allergic asthma comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided for use to reduce any combination of type 2 inflammatory cytokine and type 2 chemokine signature genes in a subject having allergic asthma.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the type 2 inflammatory cytokine and chemokine signature genes are selected from the group consisting of IL-5, CCL1, IL-13, GATA2, CCL26, FCER2, CACNG8, CLC, GATA1, LGALS12, SIGLEC8, GGT5, CCL17 and MMP10.
  • the one or more type 2 inflammatory cytokine and chemokine signature genes are selected from the group consisting of IL-5, CCL1, IL-13, CCL26, FCER2, SIGLEC8, GGT5 and CCL17.
  • the antibody or antigen binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 27 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 28.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the antibody or antigen-binding fragment thereof comprises dupilumab.
  • the method further comprises administering to the subject an antibody or antigen-binding fragment thereof that specifically binds IL-33, wherein the antibody or antigen-binding fragment thereof comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • a method for reducing expression of one or more eosinophil signature genes in a subject having allergic asthma comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL- 4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL- 4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided for use to reduce expression of one or more eosinophil signature genes in a subject having allergic asthma.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the one or more one or more eosinophil signature genes are selected from the group consisting of ILIRLI, AD ARBI, SIGLEC8, ASB2, VSTM1, SYNE1, CLC, PTPN7 and HDC.
  • the antibody or antigen binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 27 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 28.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the antibody or antigen-binding fragment thereof comprises dupilumab.
  • the method further comprises administering to the subject an antibody or antigen-binding fragment thereof that specifically binds IL-33, wherein the antibody or antigen-binding fragment thereof comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • a method for reducing expression of one or more type 2 inflammatory signature genes in a subject having allergic asthma comprising administering to the subject an antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • an antibody or antigen-binding fragment thereof that specifically binds interleukin-4 receptor (IL-4R) and comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 21, 22 and 23, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 24, 25 and 26, is provided for use to reduce expression of one or more type 2 inflammatory signature genes in a subject having allergic asthma.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • the one or more type 2 inflammatory signature genes are selected from the group consisting of IL-4, IL-13, CCL26, CCL13, CCL17. CCL11, POSTN, IL-5 and IL-9.
  • the antibody or antigen binding fragment thereof comprises a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 27 and a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 28.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the antibody or antigen-binding fragment thereof comprises dupilumab.
  • the method further comprises administering to the subject an antibody or antigen-binding fragment thereof that specifically binds IL-33, wherein the antibody or antigen-binding fragment thereof comprises three heavy chain complementarity determining region (HCDR) sequences comprising SEQ ID NOs: 4, 6 and 8, and three light chain complementarity determining region (LCDR) sequences comprising SEQ ID NOs: 12, 14 and 16.
  • HCDR heavy chain complementarity determining region
  • LCDR light chain complementarity determining region
  • FIG. 1 depicts a diagram of the 8-week study designed to assess the effect of treatment on bronchial allergen challenge (BAC)-induced airway inflammation.
  • the flow chart depicts the following events: induced sputum collection at baseline (just before BAC) and post-BAC (8 and 24 hours after BAC), at screening (before treatment), and at week 4 and week 8 after treatment initiation.
  • the BAC -induced change in sputum inflammatory signature is evaluated by comparing the sputum signature at baseline and post-BAC at screening (screening change), at week 4 (week 4 change) and at week 8 (week 8 change) after treatment initiation.
  • the effect of treatment in sputum inflammatory signature is evaluated by assessing the difference between the BAC-induced screening change and the BAC-induced week 4 change (screening to week 4 change) and the difference between the BAC-induced screening change and the BAC-induced week 8 change (screening to week 8 change).
  • FIG. 2 depicts a diagram of part 1 of the study. Eligible patients (up to 32 in total) are randomized 1 : 1 : 1 : 1 to receive REGN3500, dupilumab, REGN3500 plus dupilumab combination, or placebo.
  • FIG. 3 depicts a diagram of part 2 of the study. Approximately 6 patients receive fluticasone propionate inhaled 500 ⁇ g (2 puffs of 250 ⁇ g) per dose, twice per day for 4 days (total 8 doses), starting on day 1.
  • FIG. 4 depicts a diagram of the mechanism of action of IL-33 as an initiator and amplifier of innate and adaptive immunity. As depicted in FIG. 4, IL-33 is released following tissue damage.
  • FIG. 5 presents data showing that treatment with anti-IL-33 reduces inflammation in a chronic house dust mite (HDM) model of lung inflammation.
  • HDM chronic house dust mite
  • FIG. 5 shows that treatment with anti-IL-33 suppresses pro-inflammatory cytokines and chemokines.
  • Data is presented showing levels of lung eosinophils and lung neutrophils in the HDM model with and without anti- IL-33 treatment.
  • a heat map of a lung cytokine gene panel is presented showing levels of hIL-4, IL-5, IL-lb, TNFa, IFNg, GROa, and MCP-1. Alveolar SMA testing data is presented as well.
  • FIG. 6 depicts a diagram of the mechanism of action of anti-IL33 in reducing Type 1 and Type 2 Inflammation. As demonstrated in this figure, IL-33 drives persistent and exacerbating lung inflammation and remodeling. Anti-IL-33 reduces multiple components of chronic HDM-driven lung inflammation.
  • FIG. 7 depicts a schematic of the study of Example 1, described herein. This figure shows the steps of bronchial allergen challenge in mild asthmatics. Subjects are treated with placebo, placebo and REGN3500, dupilumab and placebo, or dupilumab and REGN3500. The effect of the respective treatments is determined by RNA sequencing of sputum cells following patient inhalation of hypertonic saline expectorate sputum.
  • FIG. 8 depicts the expression of various signature genes related to type 2 inflammation before allergen challenge, 8 hours after the allergen challenge, and 24 hours after the allergen challenge.
  • the top genes induced by the bronchial allergen challenge at screening are enriched for type 2 inflammation, and the particular genes of interest include, but are not limited to, IL-4, IL-5, IL-13, IL-9, IL1RL1 (IL-33 receptor), Eot-3 (CCL26), TARC (CCL17), and FCER2.
  • the list was derived by sorting on mean relative change greater than 10- fold, FDR less than 0.05.
  • the allergen challenge signal was reproducible, but the magnitude differed among groups.
  • Top genes identified included MMP10, WNT5A, COIB, CD1A, CCL1, CCL17, PPP1R14A, IL-9, IL-5, IL-13, FCER2, CCL26, K3AA1755, GGT5, SIGLEC8, LGALS12, GATA1, CLC, CACNG8, BC015656, AKX05132, FFAR3, CACH1, IL1RL1, HPH4, CC5AML, GATA2, TALI, HDC, NTRX1, IL-4.
  • FIG. 9 depicts the top type 2 inflammatory cytokine and chemokine signature genes induced by allergen challenge at 8 or 24 hours (FC greater than or equal to 12 or p(adj) less than or equal to 0.05) and suppressed by REGN3500.
  • REGN3500 suppressed type 2 inflammatory cytokines and chemokines including IL-5, IL-13, TARC, and Eotaxin-3.
  • FIG. 10 depicts an eosinophil gene signature utilized to evaluate treatment effects on sputum eosinophil levels.
  • a set of 10 genes showed high correlation to eosinophil counts in sputum at both pre- and post-allergen challenge.
  • This gene set includes ADARB1, ASB2, CLC, GLOD5, HDC, IL1RL1, PTPN7, SIGLEC8, SYNE1, and VSTM1.
  • An mRNA signature improved statistical performance to detect treatment effect size (fluticasone), over sputum % eosinophils.
  • Genes were not exclusive to eosinophils, e.g., SIGLEC8 (expressed in eosinophils, basophils and mast cells), HDC (expressed in mast cells), and VSTM1 (expressed in myeloid cells).
  • FIG. 11 depicts the effects of REGN3500 on eosinophil signature genes in sputum, showing a suppression of eosinophil signature genes.
  • FIG. 11 also shows that REGN3500 did not have an effect on neutrophil signature genes. Data is presented for the genes AD ARB 1 , ASB2, CLC, HDC, IL1RL1, PTPN7, SIGLEC8, SYNE1, and VSTM1.
  • FIG. 12 depicts the effects of REGN3500 on a type 2 inflammatory signature genes in sputum, showing a suppression of type 2 inflammatory signature genes.
  • FIG. 12 also shows that type 1 inflammatory signature genes were not induced by the allergen challenge. Data is presented for IL4, IL13, CCL26, CCL13, CCL17, CCL11, POSTN, IL5, and IL9.
  • FIG. 13A-FIG. 13B depict data showing the mechanism of action of increase IL-33 levels in driving a self-perpetuating amplification loop that primes tissues for exacerbations.
  • FIG. 13A - FIG. 13B includes data obtained in the HDM model. Increased IL-33 levels drove a self- perpetuating amplification loop that primed tissues for exacerbations.
  • FIG. 14 depicts eosinophil gene signature scores across treatment arms.
  • the arms include placebo, fluticasone, dupilumab, REGN3500, and the combination therapy of dupilumab and REGN3500.
  • Results are presented pre- and post-bronchial allergen challenge. These results show that both dupilumab and REGN3500 were able to reduce eosinophil gene signature scores post bronchial allergen challenge.
  • the combination treatment of dupilumab and REGN3500 was the most effective treatment in reducing eosinophil gene signature scores post bronchial allergen challenge.
  • FIG. 15 depicts Type 2 signature scores across the treatment arms.
  • the arms include placebo, fluticasone, dupilumab, REGN3500, and the combination therapy of dupilumab and REGN3500. Results are presented pre- and post-bronchial allergen challenge. These results show a lower decrease of Type 2 signature scores in the REGN3500 treatment arm than the fluticasone treatment arm.
  • FIG. 16 depicts allergic asthma signature genes affected by REGN3500 (at 8 and/or 24 hours). Results are presented at screening and at treatment, which occurred post-bronchial allergen challenge. Genes tested included, from top to bottom, BC042385, AB209315, LOC100607117, BC035084, LOC145474, AX747853, TIMP1, NT5DC2, LOC541471, AREG, PTPN7, RUNDC3, XXYLT1, FAM159A, PTGDS, TESC, ITGB2-AS1, D0574721, CLDN9, LOC100132052, AGAP7, NBEAL2, NTNG2, FLJ45445, KCNH3, POU51P3, OUG1, KIF21B, HSPA7, GAPT, BX6485Q2, PRR52, P1K3R6, LTC4S, CLEC11A, TRABD2A, DLGAP3, VDR, DKFZp686M11215, SIGLEC12, BC01
  • FIG. 17 depicts the top allergic asthma signature genes induced by the bronchial allergen challenge at 24 hours and suppressed by REGN3500. Results are presented at screening and at treatment, which occurred post-bronchial allergen challenge.
  • the genes depicted include, from top to bottom, ASAP 1 -IT 1, AX747757, BC042385, PABPC1P2, AB209315, AX748268, TCEAL5, CCL17, CCL13, CCL26, CLC, CACNG8, GPR82, GATA1, PRSS33, FFAR3, LGALS12, ASB2, PTGDR2, SIGLEC8, IL13, IL5, PTGDS, and RD3.
  • the term “about,” when used in reference to a particular recited numerical value, means that the value may vary from the recited value by no more than 1%.
  • the expression “about 100” includes 99 and 101 and all values in between (e.g., 99.1, 99.2, 99.3, 99.4, etc.).
  • the terms “treat,” “treating,” or the like mean to alleviate symptoms, eliminate the causation of symptoms either on a temporary or permanent basis, or to prevent or slow the appearance of symptoms of the named disorder or condition.
  • the invention includes methods for reducing the incidence of allergic asthma exacerbations in a subject in need thereof comprising administering a pharmaceutical composition comprising an interleukin-33 (IL-33) antagonist. Also provided is an interleukin-33 (IL-33) antagonist for use to reduce the incidence of allergic asthma exacerbations in a subject in need thereof. The invention also includes methods for reducing the incidence of allergic asthma exacerbations in a subject in need thereof comprising administering a pharmaceutical composition comprising an interleukin-4 receptor (IL-4R) antagonist. Also provided is an interleukin-4 receptor (IL-4R) antagonist for use to reduce the incidence of allergic asthma exacerbations in a subject in need thereof.
  • IL-33 interleukin-33
  • IL-4R interleukin-4 receptor
  • the methods featured in the invention further comprise administering to a subject in need thereof a first therapeutic composition comprising an interleukin-33 (IL-33) antagonist, and a second therapeutic composition comprising an interleukin-4 receptor (IL-4R) antagonist.
  • an interleukin-33 (IL-33) antagonist and an interleukin-4 receptor (IL-4R) antagonist for use to reduce the incidence of allergic asthma exacerbations in a subject in need thereof.
  • the IL-33 antagonist is an antibody or antigen- binding fragment thereof that specifically binds IL-33.
  • Exemplary anti-IL-33 antibodies that can be used in the context of the methods or uses featured in the invention are described herein.
  • the IL-4R antagonist is an antibody or antigen-binding fragment thereof that specifically binds IL-4R.
  • Exemplary anti-IL-4R antibodies that can be used in the context of the methods or uses featured in the invention are described herein.
  • asthma exacerbation means an increase in the severity and/or frequency and/or duration of one or more symptoms or indicia of asthma.
  • An “asthma exacerbation” also includes any deterioration in the respiratory health of a subject that requires and or is treatable by a therapeutic intervention for asthma (such as, e.g., steroid treatment, inhaled corticosteroid treatment, hospitalization, etc.).
  • a therapeutic intervention for asthma such as, e.g., steroid treatment, inhaled corticosteroid treatment, hospitalization, etc.
  • LOAC loss of asthma control
  • a loss of asthma control (LOAC) event is defined as one or more of the following: (a) 30% or greater reduction from baseline in morning PEF on 2 consecutive days; (b) greater than or equal to 6 additional reliever puffs of salbutamol/albuterol or levosalbutamol/levalbuterol in a 24-hour period (compared to baseline) on 2 consecutive days; (c) an increase in ICS greater than or equal to 4 times the last prescribed ICS dose (or >50% of the prescribed ICS dose at V2 if background therapy withdrawal completed); (d) use of systemic (oral and/or parenteral) steroid treatment; or (e) hospitalization or emergency room visit because of asthma.
  • LOAC loss of asthma control
  • an asthma exacerbation may be categorized as a “severe asthma exacerbation event.”
  • a severe asthma exacerbation event means an incident requiring immediate intervention in the form of treatment with either systemic corticosteroids or with inhaled corticosteroids at four or more times the dose taken prior to the incident.
  • a severe asthma exacerbation event is defined as a deterioration of asthma requiring: use of systemic corticosteroids for greater than or equal to 3 days; or hospitalization or emergency room visit because of asthma, requiring systemic corticosteroids.
  • asthma exacerbation therefore includes and encompasses the more specific subcategory of “severe asthma exacerbations.” Accordingly, methods for reducing the incidence of severe asthma exacerbations in a patient in need thereof are included.
  • a “reduction in the incidence” of an asthma exacerbation means that a subject who has received a pharmaceutical composition comprising an IL-4R antagonist experiences fewer allergic asthma exacerbations (i.e., at least one fewer exacerbation) after treatment than before treatment, or experiences no allergic asthma exacerbations for at least 4 weeks (e.g., 4, 6, 8, 12, 14, or more weeks) following initiation of treatment with the pharmaceutical composition.
  • a “reduction in the incidence” of an asthma exacerbation alternatively means that, following administration of the pharmaceutical composition, the likelihood that a subject experiences an asthma exacerbation is decreased by at least 10% (e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, or more) as compared to a subject who has not received the pharmaceutical composition.
  • the invention includes methods for reducing the incidence of allergic asthma exacerbations in a subject in need thereof comprising administering a pharmaceutical composition comprising an IL-4R antagonist to the subject as well as administering to the subject one or more maintenance doses of an inhaled corticosteroid (ICS) and/or one or more maintenance doses of a second controller, e.g., a long-acting beta-agonist (LABA) or a leukotriene receptor antagonist (LTA).
  • ICS inhaled corticosteroid
  • a second controller e.g., a long-acting beta-agonist (LABA) or a leukotriene receptor antagonist (LTA).
  • a pharmaceutical composition comprising an interleukin-4 receptor (IL- 4R) antagonist for use, in combination with one or more maintenance doses of an inhaled corticosteroid (ICS) and/or one or more maintenance doses of a second controller, e.g., a long- acting beta-agonist (LABA) or a leukotriene receptor antagonist (LTA), to reduce the incidence of allergic asthma exacerbations in a subject in need thereof.
  • ICS inhaled corticosteroid
  • a second controller e.g., a long- acting beta-agonist (LABA) or a leukotriene receptor antagonist (LTA)
  • the invention includes methods for reducing the incidence of allergic asthma exacerbations in a subject in need thereof comprising administering a pharmaceutical composition comprising an IL-33 antagonist to the subject as well as administering to the subject one or more maintenance doses of an inhaled corticosteroid (ICS) and/or one or more maintenance doses of a second controller, e.g., a long-acting beta-agonist (LABA) or a leukotriene receptor antagonist (LTA).
  • ICS inhaled corticosteroid
  • a second controller e.g., a long-acting beta-agonist (LABA) or a leukotriene receptor antagonist (LTA).
  • a pharmaceutical composition comprising an interleukin-33 (IL-33) antagonist for use, in combination with one or more maintenance doses of an inhaled corticosteroid (ICS) and/or one or more maintenance doses of a second controller, e.g., a long-acting beta-agonist (LABA) or a leukotriene receptor antagonist (LTA), to reduce the incidence of allergic asthma exacerbations in a subject in need thereof.
  • ICS inhaled corticosteroid
  • a second controller e.g., a long-acting beta-agonist (LABA) or a leukotriene receptor antagonist (LTA)
  • Suitable ICSs include, but are not limited to, fluticasone (e.g., fluticasone propionate, e.g., FloventTM), budesonide, mometasone (e.g., mometasone furoate, e.g., AsmanexTM), flunisolide (e.g., AerobidTM), dexamethasone acetate/phenobarbital/theophylline (e.g., AzmacortTM), beclomethasone dipropionate HFA (QvarTM), and the like.
  • fluticasone e.g., fluticasone propionate, e.g., FloventTM
  • budesonide e.g., mometasone furoate, e.g., AsmanexTM
  • flunisolide e.g., AerobidTM
  • dexamethasone acetate/phenobarbital/theophylline e.
  • Suitable LABAs include, but are not limited to, salmeterol (e.g., SereventTM), formoterol (e.g., ForadilTM), and the like.
  • Suitable LTAs include, but are not limited to, montelukast (e.g., SingulaireTM), zafirlukast (e.g., AccolateTM), and the like.
  • the invention includes methods for reducing the incidence of allergic asthma exacerbations in a subject in need thereof comprising administering a pharmaceutical composition comprising one or both of an IL-4R antagonist and an IL-33 antagonist to the subject as well as administering to the subject one or more reliever medications to eliminate or reduce one or more asthma-associated symptoms.
  • a pharmaceutical composition comprising one or both of an IL-4R antagonist and an IL-33 antagonist for use, in combination with one or more maintenance doses of an inhaled corticosteroid (ICS) and/or one or more maintenance doses of a second controller, e.g., a long-acting beta-agonist (LABA) or a leukotriene receptor antagonist (LTA), to reduce the incidence of allergic asthma exacerbations in a subject in need thereof.
  • ICS inhaled corticosteroid
  • a second controller e.g., a long-acting beta-agonist (LABA) or a leukotriene receptor antagonist (LTA)
  • the invention includes methods for reducing the incidence of allergic asthma exacerbations in a subject in need thereof comprising administering a pharmaceutical composition comprising one or both of an IL-4R antagonist and an IL-33 antagonist to the subject as well as administering to the subject one or more reliever medications to eliminate or reduce one or more asthma-associated symptoms. Also provided is a pharmaceutical composition comprising one or both of an IL-4R antagonist and an IL-33 antagonist for use, in combination with one or more reliever medications to eliminate or reduce one of more asthma-associated symptoms, to reduce the incidence of allergic asthma exacerbations in a subject in need thereof.
  • Suitable reliever medications include, but are not limited to, quick-acting beta2-adrenergic receptor agonists such as, e.g., albuterol (i.e., salbutamol, e.g., ProventilTM, VentolinTM, XopenexTM and the like), pirbuterol (e.g., MaxairTM), metaproterenol (e.g., AlupentTM) and the like.
  • albuterol i.e., salbutamol, e.g., ProventilTM, VentolinTM, XopenexTM and the like
  • pirbuterol e.g., MaxairTM
  • metaproterenol e.g., AlupentTM
  • the invention also includes methods for improving one or more asthma-associated parameters in a subject in need thereof, wherein the methods comprise administering a pharmaceutical composition comprising an IL-33 antagonist to the subject. Also provided is a pharmaceutical composition comprising an IL-33 antagonist for use in improving one or more asthma associated parameters in a subject in need thereof. The invention additionally includes methods for improving one or more asthma-associated parameters in a subject in need thereof, wherein the methods comprise administering a pharmaceutical composition comprising an IL-4R antagonist to the subject. Also provided is a pharmaceutical composition comprising an IL-4R antagonist for use in improving one or more asthma associated parameters in a subject in need thereof.
  • the invention also includes methods for improving one or more asthma-associated parameters in a subject in need thereof, wherein the methods comprise administering a first pharmaceutical composition comprising an IL-33 antagonist and a second pharmaceutical composition comprising an IL-4R antagonist to the subject. Also provided is a first pharmaceutical composition comprising an IL-33 antagonist and a second pharmaceutical composition comprising an IL-4R antagonist for use in improving one or more asthma associated parameters in a subject in need thereof.
  • a reduction in the incidence of an asthma exacerbation may correlate with an improvement in one or more asthma-associated parameters; however, such a correlation is not necessarily observed in all cases.
  • Examples of “asthma-associated parameters” include: (1) relative percent change from baseline (e.g., at week 12) in forced expiratory volume in 1 second (FEV 1 ); (2) a relative percent change from baseline (e.g., at week 12) as measured by forced expiratory flow at 25-75% of the pulmonary volume (FEF25-75); (3) annualized rate of loss of asthma control events during the treatment period; (4) annualized rate of severe exacerbation events during the treatment period; (5) time to loss of asthma control events during the treatment period; (6) time to severe exacerbation events during the treatment period; (7) time to loss of asthma control events during overall study period; (8) time to severe exacerbation events during overall study period; (9) health care resource utilization; (10) change from baseline at week 12 in: i) morning and evening asthma symptom scores, ii) ACQ-5 score, iii) AQLQ score, iv) morning and evening PEF, v) number of inhalations/day of salbutamol
  • An “improvement in an asthma-associated parameter” means an increase from baseline of one or more of FEV 1 , AM PEF or PM PEF, and/or a decrease from baseline of one or more of daily albuterol/levalbuterol use, ACQ5 score, average nighttime awakenings or SNOT-22 score.
  • the term “baseline,” with regard to an asthma-associated parameter means the numerical value of the asthma-associated parameter for a patient prior to or at the time of administration of a pharmaceutical composition comprising an IL-33 antagonist, the numerical value of the asthma-associated parameter for a patient prior to or at the time of administration of a pharmaceutical composition comprising an IL-4R antagonist, or the numerical value of the asthma-associated parameter for a patient prior to or at the time of administration of a first pharmaceutical composition comprising an IL-33 antagonist and a second pharmaceutical composition comprising an IL-4R antagonist to the subject.
  • an asthma-associated parameter is quantified at baseline and at a time point after administration of the pharmaceutical composition described herein.
  • an asthma-associated parameter may be measured at day 1, day 2, day 3, day 4, day 5, day 6, day 7, day 8, day 9, day 10, day 11, day 12, day 14, or at week 3, week 4, week 5, week 6, week 7, week 8, week 9, week 10, week 11, week 12, week 13, week 14, week 15, week 16, week 17, week 18, week 19, week 20, week 21, week 22, week 23, week 24, or longer, after the initial treatment with the pharmaceutical composition.
  • asthma associated parameters also include altered (i.e., increased or decreased) expression of one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more) allergic asthma “signature genes” compared to baseline expression.
  • baseline means the numerical value of the expression of one or more signature genes for a patient prior to or at the time of administration of a pharmaceutical composition comprising an IL-33 antagonist, the numerical value of the expression of one or more signature genes for a patient prior to or at the time of administration of a pharmaceutical composition comprising an IL-4R antagonist, or the numerical value of the expression of one or more signature genes for a patient prior to or at the time of administration of a first pharmaceutical composition comprising an IL-33 antagonist and a second pharmaceutical composition comprising an IL-4R antagonist to the subject.
  • a patient is selected for treatment with a pharmaceutical composition comprising an IL-33 antagonist, a pharmaceutical composition comprising an IL-4R antagonist, or a first pharmaceutical composition comprising an IL-33 antagonist and a second pharmaceutical composition comprising an IL-4R antagonist based upon increased or decreased expression of one or more signature genes.
  • expression of one or more signature genes is decreased compared to baseline expression levels, e.g., expression is reduced to a level that is about 99%, about 98%, about 97%, about 96%, about 95%, about 94%, about 93%, about 92%, about 91%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, about 10% or about 5% of the baseline expression level, or any ranges between these numbers.
  • expression of one or more signature genes is increased compared to baseline expression levels, e.g., expression is reduced to a level that is about 105%, about 110%, about 120%, about 125%, about 130%, about 135%, about 140%, about 145%, about 150%, about 175%, about 200%, about 225%, about 250%, about 275%, about 300%, about 400%, or about 500% or more of the baseline expression level, or any ranges between these numbers.
  • Suitable signature genes include allergic asthma signature genes, which include, but are not limited to, type 2 inflammatory signature genes, cytokine signature genes, chemokine signature genes, eosinophil signature genes, and the like. [00115] Exemplary allergic asthma signature genes are depicted at FIG. 16 and FIG.
  • 17 and include, but are not limited to, BC042385, AB209315, LOC100607117, BC035084, LOC145474, AX747853, TIMP1, NT5DC2, LOC541471, AREG, PTPN7, RUNDC3, XXYLT1, FAM159A, PTGDS, TESC, ITGB2-AS1, D0574721, CLDN9, LOC100132052, AGAP7, NBEAL2, NTNG2, FLJ45445, KCNH3, POU51P3, OUG1, KIF21B, HSPA7, GAPT, BX6485Q2, PRR52, P1K3R6, LTC4S, CLEC11A, TRABD2A, DLGAP3, VDR, DKFZp686M11215, SIGLEC12, BC016361, BC052769, RHOH, ASAP1-IT1, AX747757, BC042385, PABPC1P2, AB209315, AX748268, T
  • Exemplary type 2 inflammatory signature genes are depicted at FIG. 8 and FIG. 12 and include, but are not limited to, IL-4, IL-5, IL-13, IL-9, IL1RL1 (IL-33 receptor), Eot-3 (CCL26), TARC (CCL17), FCER2, MMP10, WNT5A, COIB, CD1A, CCL1, CCL17, PPP1R14A, IL-9, IL-5, IL-13, FCER2, CCL26, K3AA1755, GGT5, SIGLEC8, LGALS12, GATA1, CLC, CACNG8, BC015656, AKX05132, FFAR3, CACH1, IL1RL1, HPH4, CC5AML, GATA2, TALI, HDC, NTRX1, IL-4, IL4, IL13, CCL26, CCL13, CCL17, CCL11, POSTN, IL5 and IL9.
  • cytokine signature genes and chemokine signature genes are depicted at FIG. 9 and include, but are not limited to, IL-5, IL-13, TARC, Eotaxin-3, CCL1, CCL26, FCER2, SIGLEC8 and CCL17.
  • Exemplary eosinophil signature genes are depicted at FIG. 11 and include, but are not limited to, AD ARBI, ASB2, CLC, HDC, IL1RL1, PTPN7, SIGLEC8, SYNE1 and VSTM1.
  • the level of signature genes may be detected in a biological sample using any suitable means known in the art for detecting protein, RNA (e.g., mRNA) and/or DNA, including but not limited to, Northern blotting, Western blotting, Southern blotting, immunoprecipitation, in situ hybridization, PCR (e.g., RT-PCR), array technologies (e.g., serial analysis of gene expression (SAGE), DNA microarrays, RNA seq, tiling arrays and the like), nuclease assays, and the like.
  • a “biological sample” includes, but is not limited to, cell cultures or extracts thereof; biopsied material obtained from a mammal or extracts thereof; and blood, saliva, urine, feces, semen, tears, or other body fluids or extracts thereof.
  • Exemplary biological samples include sputum and blood.
  • “Directly acquiring” means performing a process (e.g., performing a synthetic or analytical method) to obtain the physical entity or value.
  • “Indirectly acquiring” refers to receiving the physical entity or value from another party or source (e.g., a third-party laboratory that directly acquired the physical entity or value).
  • Directly acquiring a physical entity includes performing a process that includes a physical change in a physical substance, e.g., a starting material.
  • Exemplary changes include making a physical entity from two or more starting materials, shearing or fragmenting a substance, separating or purifying a substance, combining two or more separate entities into a mixture, performing a chemical reaction that includes breaking or forming a covalent or non- covalent bond.
  • Directly acquiring a value includes performing a process that includes a physical change in a sample or another substance, e.g., performing an analytical process which includes a physical change in a substance, e.g., a sample, analyte, or reagent (sometimes referred to herein as “physical analysis”).
  • Information that is acquired indirectly can be provided in the form of a report, e.g., supplied in paper or electronic form, such as from an online database or application (an “App”).
  • the report or information can be provided by, for example, a healthcare institution, such as a hospital or clinic; or a healthcare provider, such as a doctor or nurse.
  • administration or use of an IL-4R antagonist to a patient results in an increase from baseline of forced expiratory volume in 1 second (FEV 1 ).
  • administration or use of an IL-33 antagonist to a patient results in an increase from baseline of forced expiratory volume in 1 second (FEV 1 ).
  • administration or use of an IL-4R antagonist in combination with an IL-33 (IL-33) antagonist to a patient results in an increase from baseline of forced expiratory volume in 1 second (FEV 1 ).
  • Methods for measuring FEV 1 are known in the art.
  • a spirometer that meets the 2005 American Thoracic Society (ATS)/European Respiratory Society (ERS) recommendations can be used to measure FEV 1 in a patient.
  • the ATS/ERS Standardization of Spirometry may be used as a guideline. Spirometry is generally performed between 6 and 10 AM after an albuterol withhold of at least 6 hours. Pulmonary function tests are generally measured in the sitting position, and the highest measure is recorded for FEV 1 (in liters).
  • therapeutic methods or uses that result in an increase of FEV 1 from baseline of at least 0.05L at week 12 following initiation of treatment with a pharmaceutical composition comprising an anti-IL-33 antagonist, a pharmaceutical composition comprising an anti-IL-4R antagonist, or a pharmaceutical composition comprising an IL-33 antagonist and an IL-4R antagonist, are provided.
  • administering causes an increase of FEV 1 from baseline of about 0.05 L, 0.10 L, 0.12 L, 0.14 L, 0.16 L, 0.18 L, 0.20 L, 0.22 L, 0.24 L, 0.26 L, 0.28 L, 0.30 L, 0.32 L, 0.34 L, 0.36 L, 0.38 L, 0.40 L, 0.42 L, 0.44 L, 0.46 L, 0.48 L, 0.50 L, or more at week 12.
  • administration or use of an IL-33 antagonist to a patient results in a decrease in bronchial allergen challenge (BAC)-induced lung inflammation.
  • administration or use of an IL-4R antagonist to a patient results in a decrease in BAC -induced lung inflammation.
  • administration or use of an IL-4R antagonist and an IL-33 antagonist to a patient results in a decrease in BAC-induced lung inflammation.
  • the BAC is a model for testing asthma drugs and has been in use for over 30 years (Diamant et al. Inhaled allergen bronchoprovocation tests. J Allergy Clin Immunol. 2013. 132:1045-1055 el046; Fahy et al.
  • BAC involves patient inhalation of allergen that results in a biphasic airway response, which is characterized by an early (30 minutes to 2 hours post-allergen challenge) and a late (approximately 3 to 8 hours post-allergen challenge) decline in FEVI.
  • This model facilitates the evaluation of allergic inflammatory response via measurement of changes in cell content, cytokine production, and mRNA inflammatory signatures in bronchoalveolar lavage, bronchial biopsies, or induced sputum.
  • Induced sputum samples are used in clinical studies of asthma to assess airway inflammation.
  • Studies comparing sputum from asthmatics with sputum from normal controls have found elevated concentrations of IL-33 and ST2 (Hamzaoui et al. Induced sputum levels of IL-33 and soluble ST2 in young asthmatic children.
  • IL-25 and IL-33 induce Type 2 inflammation in basophils from subjects with allergic asthma. Respir Res. 2016. 17:5.
  • eotaxin, TARC Heijink et al. Effect of ciclesonide treatment on allergen-induced changes in T cell regulation in asthma.
  • Type 2 cytokines such as IL-13 and IL-5 by approximately 10X in the lung.
  • administration or use of an IL-4R antagonist to a patient results in a suppression of BAC-induced upregulation of protein and/or mRNA levels of Type 2 cytokines.
  • administration or use of an IL-33 antagonist to a patient results in a suppression of BAC-induced upregulation of protein and/or mRNA levels of Type 2 cytokines.
  • administration or use of an IL-4R antagonist and an IL-33 antagonist to a patient results in a suppression of BAC-induced upregulation of protein and/or mRNA levels of Type 2 cytokines.
  • administration or use of an IL-4R antagonist to a patient results in a suppression of BAC-induced upregulation of protein and/or mRNA levels of any one of CCL26, CCL17, SIGLEC8, IL-33, ST2, eotaxin, TARC, IL-4, IL-5, IL-13, ASAP1-IT1, AX747757, BC042385, PABPC1P2, AB209315, AX748268, TCEAL5, CCL13, CLC, CACNG8, GPR82, GATA1, PRSS33, FFAR3, LGALS12, ASB2, PTGDR2, PTGDS, or RD3.
  • administration or use of an IL-33 antagonist to a patient results in a suppression of BAC-induced upregulation of protein and/or mRNA levels of any one of CCL26, CCL17, SIGLEC8, IL-33, ST2, eotaxin, TARC, IL-4, IL-5, IL-13, ASAP1-IT1, AX747757, BC042385, PABPC1P2, AB209315, AX748268, TCEAL5, CCL13, CLC, CACNG8, GPR82, GATA1, PRSS33, FFAR3, LGALS12, ASB2, PTGDR2, PTGDS, or RD3. .
  • administration or use of an IL-4R antagonist and an IL-33 antagonist to a patient results in a suppression of BAC-induced upregulation of protein and/or mRNA levels of any one of CCL26, CCL17, SIGLEC8, IL-33, ST2, eotaxin, TARC, IL-4, IL-5, IL-13, ASAP1-IT1, AX747757, BC042385, PABPC1P2, AB209315, AX748268, TCEAL5, CCL13, CLC, CACNG8, GPR82, GATA1, PRSS33, FFAR3, LGALS12, ASB2, PTGDR2, PTGDS, or RD3. .
  • administering results in a suppression of BAC-induced elevation of cytokines and chemokines related to both the IL-33 and the IL4R pathways, including IL-13, IL-5, tumor necrosis factor-alpha (TNFa), TARC, pulmonary and activation-regulated chemokine (PARC), CCL1, CCL26, FCER2, SIGLEC8, CCL17, and eotaxin-3.
  • cytokines and chemokines related to both the IL-33 and the IL4R pathways including IL-13, IL-5, tumor necrosis factor-alpha (TNFa), TARC, pulmonary and activation-regulated chemokine (PARC), CCL1, CCL26, FCER2, SIGLEC8, CCL17, and eotaxin-3.
  • administering results in a suppression of BAC-induced elevation of cytokines and chemokines related to both the IL-33 and the IL4R pathways, including IL-13, IL-5, tumor necrosis factor-alpha (TNFa), TARC, pulmonary and activation-regulated chemokine (PARC), CCL1, CCL26, FCER2, SIGLEC8, CCL17, and eotaxin-3.
  • cytokines and chemokines related to both the IL-33 and the IL4R pathways including IL-13, IL-5, tumor necrosis factor-alpha (TNFa), TARC, pulmonary and activation-regulated chemokine (PARC), CCL1, CCL26, FCER2, SIGLEC8, CCL17, and eotaxin-3.
  • administration or use of an IL-4R antagonist and an IL-33 antagonist to a patient results in a suppression of BAC-induced elevation of cytokines and chemokines related to both the IL-33 and the IL4R pathways, including IL-13, IL-5, tumor necrosis factor-alpha (TNFa), TARC, pulmonary and activation-regulated chemokine (PARC), CCL1, CCL26, FCER2, SIGLEC8, CCL17, and eotaxin-3.
  • TNFa tumor necrosis factor-alpha
  • PARC pulmonary and activation-regulated chemokine
  • CCL1, CCL26 CCL26
  • FCER2 pulmonary and activation-regulated chemokine
  • Cytokines and chemokines related to both the IL-33 and the IL4R pathways including IL-13, IL-5, tumor necrosis factor-alpha (TNFa), TARC, pulmonary and activation-regulated chemokine (PARC), CCL1, CCL26, FCER2, SIGLEC8, CCL17, and eotaxin-3, are expected to be elevated after a BAC.
  • the LAR coincides with the initial influx of inflammatory cells and is generally responsive to steroid.
  • administration or use of an IL-4R antagonist to a patient results in an attenuation of BAC-induced EAR or LAR, for example as measured by FEV1.
  • administration or use of an IL-33 antagonist to a patient results in an attenuation of BAC-induced EAR or LAR, for example as measured by FEV1.
  • administration or use of an IL-4R antagonist and an IL-33 antagonist to a patient results in an attenuation of BAC-induced EAR or LAR, for example as measured by FEV1.
  • Serum levels of sST2, IL-33, calcitonin, and matrix metalloproteinase- 12 may be increased after BAC.
  • administration or use of an IL-4R antagonist to a patient results in a reduction of the increase in serum levels of sST2, IL-33, calcitonin, and matrix metalloproteinase- 12 (MMP12) typically seen after BAC.
  • administration or use of an IL-33 antagonist to a patient results in a reduction of the increase in serum levels of sST2, IL-33, calcitonin, and matrix metalloproteinase- 12 (MMP12) typically seen after BAC.
  • administering results in a reduction of the increase in serum levels of sST2, IL-33, calcitonin, and matrix metalloproteinase- 12 (MMP12) typically seen after BAC.
  • MMP12 matrix metalloproteinase- 12
  • FEF25-75% administration or use of an IL-33 antagonist, an IL- 4R antagonist, or an IL-33 antagonist and an IL-4R antagonist to a patient results in an increase from baseline of FEF25-75%.
  • Methods for measuring FEF are known in the art. For example, a spirometer that meets the 2005 American Thoracic Society (ATS)/European Respiratory Society (ERS) recommendations can be used to measure FEV 1 in a patient.
  • the FEF25-75 forced expiratory flow between 25% and 75%) is the speed (in liters per second) at which a person can empty the middle half of his or her air during a maximum expiration (i.e., forced vital capacity or FVC).
  • the parameter relates to the average flow from the point at which 25 percent of the FVC has been exhaled to the point at which 75 percent of the FVC has been exhaled.
  • the FEF25-75% of a subject provides information regarding small airway function, such that the extent of mall airway disease and/or inflammation.
  • a change in FEF25-75 is an early indicator of obstructive lung disease.
  • an improvement and/or increase in the FEF25-75% parameter is an improvement of at least 10%, 25%, 50% or more as compared to baseline.
  • the methods of the invention result in normal FEF25-75% values in a subject (e.g., values ranging from 50-60% and up to 130% of the average).
  • administering results in an increase from baseline of morning (AM) and/or evening (PM) peak expiratory flow (AM PEF and/or PM PEF).
  • AM PEF and/or PM PEF peak expiratory flow
  • Methods for measuring PEF are known in the art. For example, according to one method for measuring PEF, patients are issued an electronic PEF meter for recording morning (AM) and evening (PM) PEF (as well as daily albuterol use, morning and evening asthma symptom scores, and number of nighttime awakenings due to asthma symptoms that require rescue medications). Patients are instructed on the use of the device, and written instructions on the use of the electronic PEF meter are provided to the patients.
  • AM PEF is generally performed within 15 minutes after arising (between 6 am and 10 am) prior to taking any albuterol.
  • PM PEF is generally performed in the evening (between 6 pm and 10 pm) prior to taking any albuterol.
  • Subjects should try to withhold albuterol for at least 6 hours prior to measuring their PEF.
  • Three PEF efforts are performed by the patient and all 3 values are recorded by the electronic PEF meter. Usually the highest value is used for evaluation.
  • Baseline AM PEF may be calculated as the mean AM measurement recorded for the 7 days prior to administration of the first dose of pharmaceutical composition comprising the IL-33 antagonist, the IL-4R antagonist, or the IL-33 antagonist and the IL-4R antagonist
  • baseline PM PEF may be calculated as the mean PM measurement recorded for the 7 days prior to administration of the first dose of pharmaceutical composition comprising the IL-33 antagonist, the IL-4R antagonist, or the IL-33 antagonist and the IL-4R antagonist.
  • therapeutic methods or uses that result in an increase in AM PEF and/or PM PEF from baseline of at least 1.0 L/min at week 12 following initiation of treatment with a pharmaceutical composition comprising an anti-IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist, are provided.
  • administering causes an increase in PEF from baseline of about 0.5 L/min, 1.0 L/min, 1.5 L/min, 2.0 L/min, 2.5 L/min, 3.0 L/min, 3.5 L/min, 4.0 L/min, 4.5 L/min, 5.0 L/min, 5.5 L/min, 6.0 L/min, 6.5 L/min, 7.0 L/min, 7.5 L/min, 8.0 L/min, 8.5 L/min, 9.0 L/min, 9.5 L/min, 10.0 L/min, 10.5 L/min, 11.0 L/min, 12.0 L/min, 15 L/min, 20 L/min, or more at week 12
  • administering results in a decrease from baseline of daily albuterol or levalbuterol use.
  • the number of albuterol/levalbuterol inhalations can be recorded daily by the patients in a diary, PEF meter, or other recording device.
  • use of albuterol/levalbuterol typically may be on an as-needed basis for symptoms, not on a regular basis or prophylactically.
  • the baseline number of albuterol/levalbuterol inhalations/day may be calculated based on the mean for the 7 days prior to administration of the first dose of pharmaceutical composition comprising the IL-33 antagonist, the IL-4R antagonist, or the IL-33 antagonist and the IL-4R antagonist.
  • therapeutic methods or uses that result in a decrease in albuterol/levalbuterol use from baseline of at least 0.25 puffs per day at week 12 following initiation of treatment with a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist, are provided.
  • administering causes a decrease in albuterol/levalbuterol use from baseline of about 0.25 puffs per day, 0.50 puffs per day, 0.75 puffs per day, 1.00 puff per day, 1.25 puffs per day, 1.5 puffs per day, 1.75 puffs per day, 2.00 puffs per day, 2.25 puffs per day, 2.5 puffs per day, 2.75 puffs per day, 3.00 puffs per day, or more at week 12
  • an IL-33 antagonist, an IL- 4R antagonist, or an IL-33 antagonist and an IL-4R antagonist to a patient can be used in conjunction with an OCS such as oral prednisone.
  • OCS such as oral prednisone.
  • the number of OCS administrations can be recorded daily by the patients in a diary, PEF meter, or other recording device.
  • occasional short-term use of prednisone typically can be used to control acute asthmatic episodes, e.g., episodes in which bronchodilators and other anti-inflammatory agents fail to control symptoms.
  • prednisone is used concurrent with or as a substitution for ICS.
  • Oral prednisone may be administered in dosages of about 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg or 40 mg.
  • OCS can optionally be administered once a day or multiple times a day (e.g., twice a day, three times a day, four times a day, etc.)
  • a reduction of 50% or greater (e.g., 50%, 60%, 70%, 80%, 90% or more) in the OCS dose is achieved after administration of IL-4R antibody therapy, IL-33 antibody therapy, or IL-33 antibody therapy in combination with IL-4R antibody therapy at a period of time (e.g., at week 240).
  • the OCS is substantially eliminated after 40 weeks, 45 weeks, 50 weeks, 52 weeks, or greater after the first dose following administration of the initial dose.
  • the level of OCS use is reduced to less than 5 mg per day (e.g., less than 5 mg, 4 mg, 3 mg, 2 mg or less per day).
  • the dependency on OCS use is substantially eliminated after 3 months, 6 months, 9 months or 1 year following treatment with IL-33 antagonist, IL-4R antagonist, or IL-33 antagonist and IL-4R antagonist.
  • administering results in a decrease from baseline of five-item Asthma Control Questionnaire (ACQ5) score.
  • the ACQ5 is a validated questionnaire to evaluate asthma control.
  • therapeutic methods or uses that result in a decrease in ACQ5 score from baseline of at least 0.10 points at week 12 following initiation of treatment with a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist, are provided.
  • administering causes a decrease in ACQ score from baseline of about 0.10 points, 0.15 points, 0.20 points, 0.25 points, 0.30 points, 0.35 points, 0.40 points, 0.45 points, 0.50 points, 0.55 points, 0.60 points, 0.65 points, 0.70 points, 0.75 points, 0.80 points, 0.85 points, or more at week 12.
  • administering results in a decrease from baseline of average number of nighttime awakenings.
  • the methods or uses decrease the average number of nighttime awakenings from baseline by at least about 0.10 times per night at week 12 following initiation of treatment.
  • administration or use of an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist to a subject in need thereof can cause a decrease in average number of nighttime awakenings from baseline of about 0.10 times per night, 0.15 times per night, 0.20 times per night, 0.25 times per night, 0.30 times per night, 0.35 times per night, 0.40 times per night, 0.45 times per night, 0.50 times per night, 0.55 times per night, 0.60 times per night, 0.65 times per night, 0.70 times per night, 0.75 times per night, 0.80 times per night, 0.85 times per night, 0.90 times per night, 0.95 times per night, 1.0 times per night, 2.0 times per night, or more at week 12.
  • IL-33 antagonist administration or use of an IL-33 antagonist, an IL- 4R antagonist, or an IL-33 antagonist and an IL-4R antagonist to a patient results in a decrease from baseline of 22-item Sinonasal Outcome Test (SNOT-22).
  • the SNOT-22 is a validated questionnaire to assess the impact of chronic rhinosinusitis on quality of life (Hopkins et al 2009, Clin. Otolaryngol. 34: 447-454).
  • therapeutic methods or uses that result in a decrease in SNOT-22 score from baseline of at least 1 point at week 12 following initiation of treatment with a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist are provided.
  • administration or use of an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist to a subject in need thereof can cause a decrease in SNOT-22 score from baseline of about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 points, or more at week 12.
  • an IL-33 antagonist, an IL- 4R antagonist, or an IL-33 antagonist and an IL-4R antagonist to a patient results in an improvement in lung function as measured by a biomarker.
  • the biomarker may be fractional exhaled nitric oxide (FeNO), eotaxin-3, total IgE, periostin, or thymus and activation- regulated chemokine (TARC).
  • an improvement in lung function is indicated by a reduction or increase (as appropriate) at week 4, week 12 or week 24 following treatment.
  • the invention provides methods for treating allergic asthma, including, e.g., mild allergic asthma and mild persistent allergic asthma, in a subject in need thereof, wherein the methods comprise administering a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist to the subject. Also provided is a pharmaceutical composition comprising an anti -IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist to treat allergic asthma, including, e.g., mild allergic asthma and mild persistent allergic asthma, in a subject in need thereof.
  • the methods are useful for treating allergic asthma in a subject.
  • the methods are useful for treating mild persistent allergic asthma in a subject.
  • asthma can be used interchangeably with “intermittent asthma,” or “bronchial asthma.”
  • “Asthma,” “bronchial asthma” and “intermittent asthma” refer to asthma in which one or any combination of the following are true: symptoms occur 2 or fewer days per week; symptoms do not interfere with normal activities; nighttime symptoms occur fewer than 2 days per month; or one or more lung function tests (e.g., forced expiratory volume in one second (FEV 1 ) and/or peak expiratory flow (PEF) of greater than 80%) are normal when the subject is not suffering from an asthma attack.
  • FEV 1 forced expiratory volume in one second
  • PEF peak expiratory flow
  • allergens e.g., inhaled allergens (e.g., perennial aeroallergens and seasonal aeroallergens), such as dust mites, pet dander, pollen, fungi and the like.
  • allergens e.g., inhaled allergens (e.g., perennial aeroallergens and seasonal aeroallergens), such as dust mites, pet dander, pollen, fungi and the like.
  • the allergen is a house dust mite (HDM) allergen (e.g., a perennial aeroallergen).
  • HDM house dust mite
  • a “perennial aeroallergen” refers to airborne allergens that can be present in the environment year-round, such as dust mites, fungi, dander and the like.
  • Perennial aeroallergens include, but are not limited to, Alternaria alternata, Aspergillus fumigatus, Aureobasidium pullulans, Candida albicans, Cladosporium herbarum, Dermatofagoides farinae, Dermatofagoides pteronyssinus, Mucor racemosus, Penicillium chrysogenum, Phoma betae, Setomelanomma rostrata, Stemphylium herbarum, cat dander, dog dander, cow dander, chicken feathers, goose feathers, duck feathers, cockroach (e.g., German cockroach, Oriental cockroach), mouse urine, peanut dust, tree nut dust, and the like.
  • Alternaria alternata Aspergillus fumigatus
  • a “seasonal aeroallergen” refers to airborne allergens that are present in the environment seasonally, such as pollens and spores.
  • Seasonal aeroallergens include, but are not limited to, tree pollen (e.g., birch, alder, cedar, hazel, hornbeam, horse chestnut, willow, poplar, linden, pine, maple, oak, olive and the like), grass pollen (e.g., ryegrass, cat’s tail and the like), weed pollen (e.g., ragweed, plantain, nettles, mugwort, fat hen, sorrel and the like), fungal spores that increase during particular seasons, temperatures, etc.
  • tree pollen e.g., birch, alder, cedar, hazel, hornbeam, horse chestnut, willow, poplar, linden, pine, maple, oak, olive and the like
  • grass pollen e.g., ryegrass, cat’
  • the term “persistent asthma” or “persistent bronchial asthma” refers to asthma that is more severe than (bronchial) asthma/intermittent (bronchial) asthma.
  • a subject suffering from persistent asthma or persistent bronchial asthma experiences one or more of the following: symptoms more than 2 days per week; symptoms that interfere with normal activities; nighttime symptoms that occur more than 2 days per month; or one or more lung function tests (e.g., forced expiratory volume in one second (FEV 1 ) and/or peak expiratory flow (PEF) of less than 80%) that are not normal when the subject is not suffering from an asthma attack; the subject relies on daily asthma control medication; the subject has taken a systemic steroid more than once in the last year after a severe asthma flare-up; or use of a short-acting beta-2 agonist more than two days per week for relief of asthma symptoms.
  • lung function tests e.g., forced expiratory volume in one second (FEV 1 ) and/or peak expiratory flow (PEF) of less than 80%
  • bronchial asthma/intermittent bronchial asthma can be categorized as “mild,” “moderate,” “severe” or “moderate-to-severe.”
  • “Mild intermittent asthma” or “mild intermittent bronchial asthma” is defined as having symptoms less than once a week, and having forced expiratory volume in one second (FEV 1 ) or peak expiratory flow (PEF) >80%.
  • “Mild persistent asthma” or “mild persistent bronchial asthma” differs in that symptoms frequency is greater than once per week but less than once per day, and variability in FEV 1 or PEF is ⁇ 20%-30%.
  • Moderate intermittent asthma or “moderate intermittent bronchial asthma” is defined as having symptoms less than once a week, and having forced expiratory volume in one second (FEV 1 ) or peak expiratory flow (PEF) of 60- 80%.
  • “Moderate persistent asthma” or “moderate persistent bronchial asthma” is defined as having daily symptoms, exacerbations that may affect activity and/or sleep, nocturnal symptoms more than once a week, daily use of inhaled short-acting beta-2 agonist and having forced expiratory volume in one second (FEV 1 ) or peak expiratory flow (PEF) of 60-80%.
  • “Severe intermittent asthma” or “severe intermittent bronchial asthma” is defined as having symptoms less than once a week, and having forced expiratory volume in one second (FEV 1 ) or peak expiratory flow (PEF) of 60%.
  • “Severe persistent asthma” or “severe persistent bronchial asthma” is defined as having daily symptoms, frequent exacerbations that may affect activity and/or sleep, frequent nocturnal symptoms, limitation of physical activities, daily use of inhaled short-acting beta-2 agonist, and having forced expiratory volume in one second (FEV 1 ) or peak expiratory flow (PEF) of 60%.
  • Moderate-to-severe intermittent asthma or “moderate-to-severe intermittent bronchial asthma” is defined as having symptoms between those of moderate intermittent asthma/moderate intermittent bronchial asthma and severe intermittent asthma/severe intermittent bronchial asthma.
  • Moderate-to-severe persistent asthma or “moderate-to-severe persistent bronchial asthma” is defined as having symptoms between those of moderate persistent asthma/moderate persistent bronchial asthma and severe persistent asthma/severe persistent bronchial asthma.
  • the term “inadequately controlled asthma” refers to patients whose asthma is either “not well controlled” or “very poorly controlled” as defined by the “Expert Panel Report 3: Guidelines for the Diagnosis and Management of Asthma,” National Heart, Blood and Lung Institute, NIH, Aug. 28, 2007. “Not well controlled asthma” is defined as having symptoms greater than two days per week, nighttime awakenings one to three times per week, some limitations on normal activity, short-acting beta2-agonist use for symptom control greater than two days per week, FEV 1 of 60-80% of predicted and/or personal best, an ATAQ score of 1-2, an ACQ score of 1.5 or greater, and an ACT score of 16-19.
  • “Very poorly controlled asthma” is defined as having symptoms throughout the day, nighttime awakenings four times or more per week, extreme limitations on normal activity, short-acting beta2-agonist use for symptom control several times per day, FEV 1 of less than 60% of predicted and/or personal best, an ATAQ score of 3-4, an ACQ score of N/A, and an ACT score of less than or equal to 15.
  • a subject is identified as having “moderate-to-severe uncontrolled” asthma if the subject receives such a diagnosis from a physician, based on the Global Initiative for Asthma (GINA) 2009 Guidelines, and one or more of the following criteria: i) Existing treatment with moderate-to-high dose ICS/LABA (2 fluticasone propionate 250 ⁇ g twice daily or equipotent ICS daily dosage) with a stable dose of ICS/LABA for greater than or equal to 1 month prior to administration of an initial dose of IL-4R antagonist, IL-33 antagonist, or an initial dose of IL-33 antagonist and IL-4R antagonist; ii) FEV 1 40 to 80% predicted normal prior to administration of an initial dose of IL-4R antagonist, IL-33 antagonist, or an initial dose of IL-33 antagonist and IL-4R antagonist; iii) ACQ-5 score greater than or equal to 1.5 prior to administration of an initial dose of IL-4R antagonist, IL-33 antagonist, or an
  • “Severe asthma” refers to asthma in which adequate control cannot be achieved by high- dose treatment with inhaled corticosteroids and additional controllers (e.g., long-acting inhaled beta 2 agonists, montelukast, and/or theophylline) or by oral corticosteroid treatment (e.g., for at least six months per year), or is lost when the treatment is reduced.
  • additional controllers e.g., long-acting inhaled beta 2 agonists, montelukast, and/or theophylline
  • oral corticosteroid treatment e.g., for at least six months per year
  • severe asthma includes asthma that is treated with high-dose ICS and at least one additional controller (e.g., LAB A, montelukast, or theophylline) or oral corticosteroids >6 months/year, wherein at least one of the following occurs or would occur if treatment is reduced: ACT ⁇ 20 or ACQ >1.5; at least 2 exacerbations in the last 12 months; at least 1 exacerbation treated in hospital or requiring mechanical ventilation in the last 12 months; or FEVI ⁇ 80% (if FEV1/FVC below the lower limit of normal).
  • additional controller e.g., LAB A, montelukast, or theophylline
  • oral corticosteroids >6 months/year, wherein at least one of the following occurs or would occur if treatment is reduced: ACT ⁇ 20 or ACQ >1.5; at least 2 exacerbations in the last 12 months; at least 1 exacerbation treated in hospital or requiring mechanical ventilation in the last 12 months; or FEVI ⁇
  • Step-dependent asthma refers to asthma which requires one or more of the following treatments: frequent, short term oral corticosteroid treatment bursts in the past 12 months; regular use of high dose inhaled corticosteroids in the past 12 months; regular use of injected long acting corticosteroids; daily use of oral corticosteroids;retemate-day oral corticosteroids; or prolonged use of oral corticosteroids in the past year.
  • Order corticosteroid-dependent asthma refers to a subject having >3 30-day oral corticosteroid (OCS) fills over a 12-month period and a primary asthma diagnosis within 12 months of the first OCS fill.
  • Subjects with OCS-dependent asthma may also experience one or any combination of the following: have received physician prescribed LABA and high dose ICS (total daily dose >500 ⁇ g fluticasone propionate dry powder formulation equivalent) for at least 3 months (the ICS and LABA can be parts of a combination product, or given by separate inhalers); have received additional maintenance asthma controller medications according to standard practice of care e.g., leukotriene receptor antagonists (LTRAs), theophylline, long-acting muscarinic antagonists (LAMAs), secondary ICS and cromones; received OCS for the treatment of asthma at a dose of between > 7.5 to ⁇ 30mg (prednisone or prednisolone equivalent); have received an OCS dose administered every other day (or
  • methods for treating asthma comprising: (a) selecting a patient that exhibits a blood eosinophil level of at least 300 cells per microliter; and (b) administering to the patient a pharmaceutical composition comprising an IL-33 antagonist, an IL- 4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • a pharmaceutical composition comprising an IL-33 antagonist, an IL- 4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • the patient exhibits a blood eosinophil level of at least 300 cells per microliter.
  • methods for treating asthma comprising: (a) selecting a patient that exhibits a blood eosinophil level of 150-299 cells per microliter; and (b) administering to the patient a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • the patient exhibits a blood eosinophil level of 150-299 cells per microliter.
  • methods for treating asthma comprising: (a) selecting a patient that exhibits a blood eosinophil level of less than 150 cells per microliter; and (b) administering to the patient a pharmaceutical composition comprising an IL-33 antagonist, an IL- 4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • a pharmaceutical composition comprising an IL-33 antagonist, an IL- 4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • the patient exhibits a blood eosinophil level of less than 150 cells per microliter.
  • methods for treating asthma comprising: (a) selecting a patient that exhibits a low level of periostin level; and (b) administering to the patient a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • the patient exhibits a low level of periostin level.
  • methods for treating asthma comprising: (a) selecting a patient that exhibits a high level of periostin; and (b) administering to the patient a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • the patient exhibits a high level of periostin level.
  • a “high level of periostin” refers to a blood periostin measurement of greater than or equal to about 60 ng/mL, greater than or equal to about 65 ng/mL, greater than or equal to about 70 ng/mL, greater than or equal to about 75 ng/mL, or greater than or equal to about 80 ng/mL, greater than or equal to about 85 ng/mL, greater than or equal to about 90 ng/mL, greater than or equal to about 95 ng/mL, greater than or equal to about 100 ng/mL.
  • a high level of periostin is greater than or equal to about 75.0 ng/mL or greater than or equal to about 74.4 ng/mL.
  • a “low level of periostin” refers to a blood periostin measurement of less than about 100 ng/mL, less than about 95 ng/mL, less than about 90 ng/mL, less than about 85 ng/mL, less than about 80 ng/mL, less than about 75 ng/mL, less than about 70 ng/mL, less than about 65 ng/mL, or less than about 60 ng/mL.
  • a low level of periostin is less than about 75.0 ng/mL or less than about 74.4 ng/mL.
  • an IL-33 antagonist for use to treat allergic asthma in a patient, wherein IL-33 antagonist is used as an add-on therapy to background therapy.
  • an IL-33 antagonist, an IL-4R antagonist, or an IL- 33 antagonist and an IL-4R antagonist is administered as an add-on therapy to an asthma patient who is on background therapy for a certain period of time (e.g., 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 5 months, 12 months, 18 months, 24 months, or longer) (also called the “stable phase”).
  • the background therapy comprises a ICS and/or a LAB A.
  • the invention includes a method for reducing an asthma patient’s dependence on ICS and/or LABA for the treatment of one or more allergic asthma exacerbations comprising: (a) selecting a patient who has asthma that is not well-controlled with a background asthma therapy comprising an ICS, a LABA, or a combination thereof; and administering to the patient a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • the patient has asthma that is not well-controlled with a background asthma therapy comprising an ICS, a LABA, or a combination thereof.
  • the invention encompasses methods to treat or alleviate conditions or complications associated with asthma, such as chronic rhinosinusitis, allergic rhinitis, allergic fungal rhinosinusitis, allergic broncho-pulmonary aspergillosis, unified airway disease, Churg-Strauss syndrome, vasculitis, chronic obstructive pulmonary disease (COPD), and exercise induced bronchospasm.
  • chronic rhinosinusitis allergic rhinitis
  • allergic fungal rhinosinusitis allergic broncho-pulmonary aspergillosis
  • unified airway disease Churg-Strauss syndrome
  • vasculitis vasculitis
  • COPD chronic obstructive pulmonary disease
  • a pharmaceutical composition comprising an anti-IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist to treat conditions or complications associated with asthma, such as chronic rhinosinusitis, allergic rhinitis, allergic fungal rhinosinusitis, allergic broncho-pulmonary aspergillosis, unified airway disease, Churg-Strauss syndrome, vasculitis, chronic obstructive pulmonary disease (COPD), and exercise induced bronchospasm, in a subject in need thereof.
  • asthma chronic rhinosinusitis, allergic rhinitis, allergic fungal rhinosinusitis, allergic broncho-pulmonary aspergillosis, unified airway disease, Churg-Strauss syndrome, vasculitis, chronic obstructive pulmonary disease (COPD), and exercise induced bronchospasm
  • the invention also includes methods for treating persistent asthma.
  • a pharmaceutical composition comprising an anti-IL-33 antagonist, an IL-4R antagonist, or an IL- 33 antagonist and an IL-4R antagonist to treat persistent asthma, in a subject in need thereof.
  • persistent asthma means that the subject has symptoms at least once a week at day and/or at night, with the symptoms lasting a few hours to a few days.
  • the persistent asthma is “mildly persistent” (e.g., more than twice a week but less than daily with symptoms severe enough to interfere with daily activities or sleep and/or where pulmonary function is normal or reversible with inhalation of a bronchodilator), “moderately persistent” (e.g., symptoms occurring daily with sleep interrupted at least weekly and/or with pulmonary function moderately abnormal), or “severely persistent” (e.g., continuous symptoms despite the correct use of approved medications and/or where pulmonary function is severely affected).
  • Methods disclosed herein optionally comprise administering to a subject in need thereof a therapeutic composition comprising an IL-33 antagonist.
  • an “IL-33 antagonist” is any agent that binds to or interacts with IL-33 and inhibits the normal biological signaling function of IL-33 when IL-33 is expressed on a cell in vitro or in vivo.
  • Methods disclosed herein optionally comprise administering to a subject in need thereof a therapeutic composition comprising an IL-4R antagonist.
  • an “IL-4R antagonist” is any agent that binds to or interacts with IL-4R and inhibits the normal biological signaling function of IL-4R when IL-4R is expressed on a cell in vitro or in vivo.
  • Non-limiting examples of categories of IL-33 antagonists and IL-4R antagonists include small molecule IL-33 antagonists, small molecule IL-4R antagonists, anti-IL-33 aptamers, anti- IL-4R aptamers, peptide-based IL-33 antagonists or peptide-based IL-4R antagonists (e.g., “peptibody” molecules), and antibodies or antigen-binding fragments of antibodies that specifically bind human IL-33 or human IL-4R.
  • the IL-33 antagonist comprises an anti-IL-33 antibody or antigen-binding fragment thereof that can be used in the context of the methods featured in the invention are described elsewhere herein.
  • the IL-33 antagonist is an antibody or antigen-binding fragment thereof that specifically binds to an IL-33, and comprises the heavy chain and light chain (complementarity determining region) CDR sequences from the heavy chain variable region (HCVR) and light chain variable region (LCVR) of SEQ ID NOs: 2 and 10, respectively.
  • the IL-33 antagonist is an antibody or antigen-binding fragment thereof that specifically binds to an IL-33, and comprises the heavy chain and light chain CDR sequences of SEQ ID NOs: 4, 6 and 8, and SEQ ID NOs: 12, 14 and 16, respectively.
  • the IL-33 antagonist is an antibody or antigen-binding fragment thereof that specifically binds to an IL-33, and comprises an HCVR/LCVR pair of SEQ ID NOs: 2 and 10, respectively.
  • HCDRE amino acid sequence [00176] GFTFSRSA (SEQ ID NO: 4).
  • AKDSYTTSWY GGMDV (SEQ ID NO: 8).
  • AAS SEQ ID NO: 14
  • caacaggctaa cagtgtcccg atcacc (SEQ ID NO: 15).
  • the IL-33 antagonist is the REGN3500 antibody, which comprises an HC/LC pair of SEQ ID NOs: 18 and 20, respectively.
  • the IL-4R antagonist comprises an anti-IL-4R antibody or antigen-binding fragment thereof that can be used in the context of the methods featured in the invention are described elsewhere herein.
  • the IL-4R antagonist is an antibody or antigen-binding fragment thereof that specifically binds to an IL-4R, and comprises the heavy chain and light chain (complementarity determining region) CDR sequences from the heavy chain variable region (HCVR) and light chain variable region (LCVR) of SEQ ID NOs: 27 and 28, respectively.
  • the IL-4R antagonist is an antibody or antigen-binding fragment thereof that specifically binds to an IL-4R, and comprises the heavy chain and light chain CDR sequences of SEQ ID NOs: 21, 22 and 23, and SEQ ID NOs: 24, 25 and 26, respectively.
  • the IL-4R antagonist is an antibody or antigen-binding fragment thereof that specifically binds to an IL-4R, and comprises an HCVR/LCVR pair of SEQ ID NOs: 27 and 28, respectively.
  • AKDRLSITIRPRYY GL (SEQ ID NO: 23).
  • LGS SEQ ID NO: 25.
  • Dupilumab LCVR amino acid sequence [00202] DIVMTQSPLSLPVTPGEPASISCRSSQSLLYSIGYNYLDWYLQKSGQSPQLLIYLG SNRAS GVPDRF S GS GS GTDFTLKI SRVE AED V GF Y YCMQ ALQTP YTF GQGTKLEIK (SEQ ID NO: 28).
  • the IL-4R antagonist is dupilumab.
  • human IL-33 refers to a human cytokine receptor that specifically binds to interleukin-33 (IL-33).
  • human IL-4R refers to a human cytokine receptor that specifically binds to interleukin-4 (IL-4), such as IL-4R ⁇ .
  • antibody refers to immunoglobulin molecules comprising four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, as well as multimers thereof (e.g., IgM). Each heavy chain comprises a heavy chain variable region
  • HCVR HCVR
  • VH heavy chain constant region
  • CHI CHI
  • CH2 CH3
  • Each light chain comprises a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
  • the light chain constant region comprises one domain (CLI).
  • CLI complementarity determining regions
  • FR framework regions
  • Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the FRs of the anti-IL-33 antibody, the anti-IL-4R antibody, or an antigen-binding portion thereof may be identical to the human germline sequences, or may be naturally or artificially modified.
  • An amino acid consensus sequence may be defined based on a side-by-side analysis of two or more CDRs.
  • antibody also includes antigen-binding fragments of full antibody molecules.
  • antigen-binding portion of an antibody, “antigen-binding fragment” of an antibody, and the like, as used herein, include any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds to an antigen to form a complex.
  • Antigen-binding fragments of an antibody may be derived, e.g., from full antibody molecules using any suitable standard techniques, such as proteolytic digestion or recombinant genetic engineering techniques involving the manipulation and expression of DNA encoding antibody variable and optionally constant domains.
  • DNA is known and/or is readily available from, e.g., commercial sources, DNA libraries (including, e.g., phage-antibody libraries), or can be synthesized.
  • the DNA may be sequenced and manipulated chemically or by using molecular biology techniques, for example, to arrange one or more variable and/or constant domains into a suitable configuration, or to introduce codons, create cysteine residues, modify, add or delete amino acids, etc.
  • Non-limiting examples of antigen-binding fragments include, but are not limited to: (i) Fab fragments; (ii) F(ab')2 fragments; (iii) Fd fragments; (iv) Fv fragments; (v) single-chain Fv (scFv) molecules; (vi) dAb fragments; and (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g., an isolated complementarity determining region (CDR) such as a CDR3 peptide), or a constrained FR3- CDR3-FR4 peptide.
  • CDR complementarity determining region
  • engineered molecules such as domain-specific antibodies, single domain antibodies, domain-deleted antibodies, chimeric antibodies, CDR-grafted antibodies, diabodies, triabodies, tetrabodies, minibodies, nanobodies (e.g., monovalent nanobodies, bivalent nanobodies, etc.), small modular immunopharmaceuticals (SMIPs), and shark variable IgNAR domains, are also encompassed within the expression “antigen-binding fragment.”
  • SMIPs small modular immunopharmaceuticals
  • shark variable IgNAR domains are also encompassed within the expression “antigen-binding fragment.”
  • An antigen-binding fragment of an antibody will typically comprise at least one variable domain.
  • the variable domain may be of any size or amino acid composition and will generally comprise at least one CDR that is adjacent to or in frame with one or more framework sequences.
  • the VH and VL domains may be situated relative to one another in any suitable arrangement.
  • the variable region may be dimeric and contain VH-VH, VH-VL or VL-VL dimers.
  • the antigen-binding fragment of an antibody may contain a monomeric VH or VL domain.
  • an antigen-binding fragment of an antibody may contain at least one variable domain covalently linked to at least one constant domain.
  • variable and constant domains that may be found within an antigen-binding fragment of an antibody described herein include: (i) VH-CH1; (ii) VH-CH2; (iii) VH-CH3; (iv) VH- CH1-CH2; (V) VH-CH1-CH2-CH3; (vi) VH-CH2-CH3; (vii) VH-CL; (viii) VL-CH1; (ix) VL-CH2; (X) VL-CH3; (xi) VL-CH1-CH2; (xii) VL-CH1-CH2-CH3; (xiii) VL-CH2-CH3; and (xiv) VL-CL.
  • variable and constant domains may be either directly linked to one another or may be linked by a full or partial hinge or linker region.
  • a hinge region may consist of at least 2 (e.g., 5, 10, 15, 20, 40, 60 or more) amino acids that result in a flexible or semi-flexible linkage between adjacent variable and/or constant domains in a single polypeptide molecule, typically the hinge region may consist of between 2 to 60 amino acids, typically between 5 to 50, or typically between 10 to 40 amino acids.
  • an antigen-binding fragment of an antibody described herein may comprise a homo-dimer or hetero-dimer (or other multimer) of any of the variable and constant domain configurations listed above in non-covalent association with one another and/or with one or more monomeric VH or VL domain (e.g., by disulfide bond(s)).
  • antigen-binding fragments may be monospecific or multispecific (e.g., bispecific).
  • a multispecific antigen-binding fragment of an antibody will typically comprise at least two different variable domains, wherein each variable domain is capable of specifically binding to a separate antigen or to a different epitope on the same antigen.
  • Any multispecific antibody format may be adapted for use in the context of an antigen-binding fragment of an antibody described herein using routine techniques available in the art.
  • the constant region of an antibody is important in the ability of an antibody to fix complement and mediate cell-dependent cytotoxicity.
  • the isotype of an antibody may be selected on the basis of whether it is desirable for the antibody to mediate cytotoxicity.
  • human antibody includes antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
  • the human antibodies featured in the invention may nonetheless include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3.
  • the term “human antibody” does not include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described further below), antibodies isolated from a recombinant, combinatorial human antibody library (described further below), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see e.g., Taylor et al. (1992) Nucl. Acids Res. 20:6287-6295) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences.
  • Such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences.
  • such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
  • an immunoglobulin molecule comprises a stable four chain construct of approximately 150-160 kDa in which the dimers are held together by an interchain heavy chain disulfide bond.
  • the dimers are not linked via inter-chain disulfide bonds and a molecule of about 75-80 kDa is formed composed of a covalently coupled light and heavy chain (half-antibody).
  • the frequency of appearance of the second form in various intact IgG isotypes is due to, but not limited to, structural differences associated with the hinge region isotype of the antibody.
  • a single amino acid substitution in the hinge region of the human IgG4 hinge can significantly reduce the appearance of the second form (Angal et al. (1993) Molecular Immunology 30: 105) to levels typically observed using a human IgGl hinge.
  • the invention encompasses antibodies having one or more mutations in the hinge, C H 2, or C H 3 region, which may be desirable, for example, in production, to improve the yield of the desired antibody form.
  • an “isolated antibody” means an antibody that has been identified and separated and/or recovered from at least one component of its natural environment. For example, an antibody that has been separated or removed from at least one component of an organism, or from a tissue or cell in which the antibody naturally exists or is naturally produced, is an "isolated antibody”. An isolated antibody also includes an antibody in situ within a recombinant cell. Isolated antibodies are antibodies that have been subjected to at least one purification or isolation step. According to certain embodiments, an isolated antibody may be substantially free of other cellular material and/or chemicals.
  • the term “specifically binds,” or the like, means that an antibody or antigen-binding fragment thereof forms a complex with an antigen that is relatively stable under physiologic conditions.
  • Methods for determining whether an antibody specifically binds to an antigen are well known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, and the like.
  • an antibody that “specifically binds” IL-33 or IL-4R includes antibodies that bind IL-33 or IL-4R, respectively, or portion thereof, with a K D of less than about 1000 nM, less than about 500 nM, less than about 300 nM, less than about 200 nM, less than about 100 nM, less than about 90 nM, less than about 80 nM, less than about 70 nM, less than about 60 nM, less than about 50 nM, less than about 40 nM, less than about 30 nM, less than about 20 nM, less than about 10 nM, less than about 5 nM, less than about 4 nM, less than about 3 nM, less than about 2 nM, less than about 1 nM, or less than about 0.5 nM, as measured in a surface plasmon resonance assay.
  • An isolated antibody that specifically binds human IL-33 or human IL-4R may, however, have
  • the anti-IL-33 and anti-IL-4R antibodies useful for the methods may comprise one or more amino acid substitutions, insertions, and/or deletions (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 substitutions and/or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 insertions and/or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 deletions) in the framework and/or CDR regions of the heavy and light chain variable domains as compared to the corresponding germline sequences from which the antibodies were derived.
  • Such mutations can be readily ascertained by comparing the amino acid sequences disclosed herein to germline sequences available from, for example, public antibody sequence databases.
  • the invention includes methods involving the use of antibodies, and antigen-binding fragments thereof, that are derived from any of the amino acid sequences disclosed herein, wherein one or more amino acids (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids) within one or more framework and/or one or more (e.g.
  • CDR regions are mutated to the corresponding residue(s) of the germline sequence from which the antibody was derived, or to the corresponding residue(s) of another human germline sequence, or to a conservative amino acid substitution of the corresponding germline residue(s) (such sequence changes are referred to herein collectively as “germline mutations”).
  • germline mutations such sequence changes are referred to herein collectively as “germline mutations”.
  • all of the framework and/or CDR residues within the VH and/or VL domains are mutated back to the residues found in the original germline sequence from which the antibody was derived.
  • only certain residues are mutated back to the original germline sequence, e.g., only the mutated residues found within the first 8 amino acids of FR1 or within the last 8 amino acids of FR4, or only the mutated residues found within CDR1, CDR2 or CDR3.
  • one or more of the framework and/or CDR residue(s) are mutated to the corresponding residue(s) of a different germline sequence (i.e., a germline sequence that is different from the germline sequence from which the antibody was originally derived).
  • the antibodies may contain any combination of two or more germline mutations within the framework and/or CDR regions, e.g., wherein certain individual residues are mutated to the corresponding residue of a particular germline sequence while certain other residues that differ from the original germline sequence are maintained or are mutated to the corresponding residue of a different germline sequence.
  • antibodies and antigen-binding fragments that contain one or more germline mutations can be easily tested for one or more desired property such as, improved binding specificity, increased binding affinity, improved or enhanced antagonistic or agonistic biological properties (as the case may be), reduced immunogenicity, etc.
  • desired property such as, improved binding specificity, increased binding affinity, improved or enhanced antagonistic or agonistic biological properties (as the case may be), reduced immunogenicity, etc.
  • the use of antibodies and antigen-binding fragments obtained in this general manner are encompassed within the invention.
  • the invention also includes methods involving the use of anti-IL33 or anti-IL-4R antibodies comprising variants of any of the HCVR, LCVR, and/or CDR amino acid sequences disclosed herein having one or more conservative substitutions.
  • the invention includes the use of anti-IL-4R antibodies having HCVR, LCVR, and/or CDR amino acid sequences with, e.g., 10 or fewer, 8 or fewer, 6 or fewer, 4 or fewer, etc. conservative amino acid substitutions relative to any of the HCVR, LCVR, and/or CDR amino acid sequences disclosed herein.
  • surface plasmon resonance refers to an optical phenomenon that allows for the analysis of real-time interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the BIAcoreTM system (Biacore Life Sciences division of GE Healthcare, Piscataway, NJ).
  • KD refers to the equilibrium dissociation constant of a particular antibody- antigen interaction.
  • epitope refers to an antigenic determinant that interacts with a specific antigen binding site in the variable region of an antibody molecule known as a paratope.
  • a single antigen may have more than one epitope.
  • different antibodies may bind to different areas on an antigen and may have different biological effects.
  • Epitopes may be either conformational or linear.
  • a conformational epitope is produced by spatially juxtaposed amino acids from different segments of the linear polypeptide chain.
  • a linear epitope is one produced by adjacent amino acid residues in a polypeptide chain.
  • an epitope may include moieties of saccharides, phosphoryl groups, or sulfonyl groups on the antigen.
  • Methods for generating human antibodies in transgenic mice are known in the art. Any such known methods can be used to make human antibodies that specifically bind to human IL- 33 or human IL-4R.
  • VELOCIMMUNE® technology see, for example, US 6,596,541, Regeneron Pharmaceuticals or any other known method for generating monoclonal antibodies
  • high affinity chimeric antibodies to IL-33 or IL-4R are initially isolated having a human variable region and a mouse constant region.
  • the VELOCIMMUNE® technology involves generation of a transgenic mouse having a genome comprising human heavy and light chain variable regions operably linked to endogenous mouse constant region loci such that the mouse produces an antibody comprising a human variable region and a mouse constant region in response to antigenic stimulation.
  • the DNA encoding the variable regions of the heavy and light chains of the antibody are isolated and operably linked to DNA encoding the human heavy and light chain constant regions.
  • the DNA is then expressed in a cell capable of expressing the fully human antibody.
  • a VELOCIMMUNE® mouse is challenged with the antigen of interest, and lymphatic cells (such as B-cells) are recovered from the mice that express antibodies.
  • lymphatic cells such as B-cells
  • the lymphatic cells may be fused with a myeloma cell line to prepare immortal hybridoma cell lines, and such hybridoma cell lines are screened and selected to identify hybridoma cell lines that produce antibodies specific to the antigen of interest.
  • DNA encoding the variable regions of the heavy chain and light chain may be isolated and linked to desirable isotypic constant regions of the heavy chain and light chain.
  • Such an antibody protein may be produced in a cell, such as a CHO cell.
  • DNA encoding the antigen-specific chimeric antibodies or the variable domains of the light and heavy chains may be isolated directly from antigen-specific lymphocytes.
  • high affinity chimeric antibodies are isolated having a human variable region and a mouse constant region.
  • the antibodies are characterized and selected for desirable characteristics, including affinity, selectivity, epitope, etc., using standard procedures known to those skilled in the art.
  • the mouse constant regions are replaced with a desired human constant region to generate a fully human antibody featured in the invention, for example wild-type or modified IgGl or IgG4. While the constant region selected may vary according to specific use, high affinity antigen-binding and target specificity characteristics reside in the variable region.
  • the antibodies that can be used in the methods possess high affinities, as described above, when measured by binding to antigen either immobilized on solid phase or in solution phase.
  • the mouse constant regions are replaced with desired human constant regions to generate the fully human antibodies featured in the invention. While the constant region selected may vary according to specific use, high affinity antigen-binding and target specificity characteristics reside in the variable region.
  • human antibody or antigen-binding fragment thereof that specifically binds IL-33 comprises the three heavy chain CDRs (HCDR1, HCDR2 and HCDR3) contained within a heavy chain variable region (HCVR) having an amino acid sequence of SEQ ID NO: 2.
  • the antibody or antigen-binding fragment may comprise the three light chain CDRs (LCVR1 , LCVR2, LCVR3) contained within a light chain variable region (LCVR) having an amino acid sequence of SEQ ID NO: 10.
  • human antibody or antigen-binding fragment thereof that specifically binds IL-4R comprises the three heavy chain CDRs (HCDR1, HCDR2 and HCDR3) contained within a heavy chain variable region (HCVR) having an amino acid sequence of SEQ ID NO: 27.
  • the antibody or antigen-binding fragment may comprise the three light chain CDRs (LCVR1 , LCVR2, LCVR3) contained within a light chain variable region (LCVR) having an amino acid sequence of SEQ ID NO: 28.
  • Methods and techniques for identifying CDRs within HCVR and LCVR amino acid sequences are well known in the art and can be used to identify CDRs within the specified HCVR and/or LCVR amino acid sequences disclosed herein.
  • Exemplary conventions that can be used to identify the boundaries of CDRs include, e.g., the Rabat definition, the Chothia definition, and the AbM definition.
  • the Rabat definition is based on sequence variability
  • the Chothia definition is based on the location of the structural loop regions
  • the AbM definition is a compromise between the Rabat and Chothia approaches.
  • the antibody or antigen-binding fragment thereof comprises the six CDRs (HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3) from the heavy and light chain variable region amino acid sequence pairs (HCVR/LCVR) of SEQ ID NOs: 2 and 10.
  • the antibody or antigen-binding fragment thereof comprises six CDRs (HCDR1 /HCDR2/HCDR3/LCDR1 /LCDR2/LCDR3) having the amino acid sequences of SEQ ID NOs: 4/6/8/12/14/16.
  • the antibody or antigen-binding fragment thereof comprises HCVR/LCVR amino acid sequence pairs of SEQ ID NOs: 2 and 10.
  • the antibody is REGN3500, which comprises the HCVR/LCVR amino acid sequence pairs of SEQ ID NOs: 2 and 10, and comprises the heavy chain/light chain amino acid sequences pair of SEQ ID NOs: 18 and 20.
  • the antibody or antigen-binding fragment thereof comprises the six CDRs (HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3) from the heavy and light chain variable region amino acid sequence pairs (HCVR/LCVR) of SEQ ID NOs: 27 and 28.
  • the antibody or antigen-binding fragment thereof comprises six CDRs (HCDR1 /HCDR2/HCDR3/LCDR1 /LCDR2/LCDR3) having the amino acid sequences of SEQ ID NOs: 21/22/23/24/25/26.
  • the antibody or antigen-binding fragment thereof comprises HCVR/LCVR amino acid sequence pairs of SEQ ID NOs: 27 and 28.
  • the antibody is dupilumab, which comprises the HCVR/LCVR amino acid sequence pairs of SEQ ID NOs: 27 and 28, and comprises the heavy chain/light chain amino acid sequences pair of SEQ ID NOs: 29 and 30.
  • the invention includes methods that comprise administering an IL-33 antagonist, an IL- 4R antagonist, or an IL-33 antagonist and an IL-4R antagonist, to a patient, wherein the IL-33 antagonist, the IL-4R antagonist, or the IL-33 antagonist and the IL-4R antagonist are contained within a pharmaceutical composition.
  • the invention also includes an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist for use, wherein the IL-33 antagonist, the IL-4R antagonist, or the IL-33 antagonist and the IL-4R antagonist, are contained within a pharmaceutical composition.
  • compositions featured in the invention are formulated with suitable carriers, excipients, and other agents that provide suitable transfer, delivery, tolerance, and the like.
  • suitable carriers excipients, and other agents that provide suitable transfer, delivery, tolerance, and the like.
  • a multitude of appropriate formulations can be found in the formulary known to all pharmaceutical chemists: Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, PA.
  • formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid (cationic or anionic) containing vesicles (such as LIPOFECTINTM), DNA conjugates, anhydrous absorption pastes, oil-in-water and water-in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax. See also Powell et al. “Compendium of excipients for parenteral formulations” PDA (1998) J. Pharm. Sci. Technol. 52:238-311.
  • the dose of antibody administered to a patient may vary depending upon the age and the size of the patient, symptoms, conditions, route of administration, and the like.
  • the dose is typically calculated according to body weight or body surface area.
  • Effective dosages and schedules for administering pharmaceutical compositions comprising anti-IL-33 antibodies or anti-IL-4R antibodies may be determined empirically. For example, patient progress can be monitored by periodic assessment, and the dose adjusted accordingly.
  • interspecies scaling of dosages can be performed using well-known methods in the art (e.g., Mordenti et al. , 1991 , Pharmaceut. Res. 8: 1351 ).
  • compositions featured in the invention e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the mutant viruses, receptor mediated endocytosis (see, e.g., Wu et al., 1987, J. Biol. Chem. 262:4429-4432).
  • Methods of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, intra-tracheal, epidural, and oral routes.
  • composition may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents.
  • infusion or bolus injection by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents.
  • epithelial or mucocutaneous linings e.g., oral mucosa, rectal and intestinal mucosa, etc.
  • a pharmaceutical composition featured in the invention can be delivered subcutaneously or intravenously with a standard needle and syringe.
  • a pen delivery device e.g., an autoinjector pen
  • Such a pen delivery device can be reusable or disposable.
  • a reusable pen delivery device generally utilizes a replaceable cartridge that contains a pharmaceutical composition. Once all of the pharmaceutical composition within the cartridge has been administered and the cartridge is empty, the empty cartridge can readily be discarded and replaced with a new cartridge that contains the pharmaceutical composition. The pen delivery device can then be reused.
  • a disposable pen delivery device there is no replaceable cartridge. Rather, the disposable pen delivery device comes prefilled with the pharmaceutical composition held in a reservoir within the device. Once the reservoir is emptied of the pharmaceutical composition, the entire device is discarded.
  • Numerous reusable pen and autoinjector delivery devices have applications in the subcutaneous delivery of a pharmaceutical composition. Examples include, but are not limited to AUTOPENTM (Owen Mumford, Inc., Woodstock, UK), DISETRONICTM pen (Disetronic Medical Systems, Bergdorf, Switzerland), HUMALOG MIX 75/25TM pen, HUMALOGTM pen, HUMALIN 70/30TM pen (Eli Lilly and Co., Indianapolis, IN), NOVOPENTM I, II and III (Novo Nordisk, Copenhagen, Denmark), NOVOPEN JUNIORTM (Novo Nordisk, Copenhagen, Denmark), BDTM pen (Becton Dickinson, Franklin Lakes, NJ), OPTIPENTM, OPTIPEN PROTM, OPTIPEN STARLETTM, and OPTICLIKTM (Sanofi-Aventis, Frankfurt, Germany), to name only a few.
  • Examples of disposable pen delivery devices having applications in subcutaneous delivery of a pharmaceutical composition featured in the invention include, but are not limited to the SOLOSTARTM pen (Sanofi-Aventis), the FLEXPENTM (Novo Nordisk), and the KWIKPENTM (Eli Lilly), the SURECLICKTM Autoinjector (Amgen, Thousand Oaks, CA), the PENLETTM (Haselmeier, Stuttgart, Germany), the EPIPEN (Dey, L.P.), and the HUMIRATM Pen (Abbott Labs, Abbott Park IL), to name only a few.
  • SOLOSTARTM pen Sanofi-Aventis
  • the FLEXPENTM Novo Nordisk
  • KWIKPENTM Eli Lilly
  • SURECLICKTM Autoinjector Amgen, Thousand Oaks, CA
  • the PENLETTM Heaselmeier, Stuttgart, Germany
  • EPIPEN Dey, L.P.
  • HUMIRATM Pen Abbott Labs, Abbott Park IL
  • large-volume delivery devices include, but are not limited to, bolus injectors such as, e.g., BD Libertas West SmartDose, Enable Injections, SteadyMed PatchPump, Sensile SenseTrial, YPsomed YpsoDose, Bespak Lapas, and the like.
  • bolus injectors such as, e.g., BD Libertas West SmartDose, Enable Injections, SteadyMed PatchPump, Sensile SenseTrial, YPsomed YpsoDose, Bespak Lapas, and the like.
  • the pharmaceutical compositions featured in the invention may be administered using, e.g., a microcatheter (e.g., an endoscope and microcatheter), an aerosolizer, a powder dispenser, a nebulizer or an inhaler.
  • the methods include administration of an IL-33 antagonist or an IL-4R antagonist to a subject in need thereof, in an aerosolized formulation.
  • aerosolized antibodies to IL-33 or IL-4R may be administered to treat asthma in a patient. Aerosolized antibodies can be prepared as described in, for example, US 8,178 098, incorporated herein by reference in its entirety.
  • the pharmaceutical composition can be delivered in a controlled release system.
  • a pump may be used (see Langer, supra; Sefton, 1987, CRC Crit. Ref. Biomed. Eng. 14:201).
  • polymeric materials can be used; see, Medical Applications of Controlled Release, Langer and Wise (eds.), 1974, CRC Pres., Boca Raton, Florida.
  • a controlled release system can be placed in proximity of the composition’s target, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, 1984, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138). Other controlled release systems are discussed in the review by Langer, 1990, Science 249:1527-1533.
  • the injectable preparations may include dosage forms for intravenous, subcutaneous, intracutaneous and intramuscular injections, drip infusions, etc. These injectable preparations may be prepared by known methods. For example, the injectable preparations may be prepared, e.g., by dissolving, suspending or emulsifying the antibody or its salt described above in a sterile aqueous medium or an oily medium conventionally used for injections.
  • aqueous medium for injections there are, for example, physiological saline, an isotonic solution containing glucose and other auxiliary agents, etc., which may be used in combination with an appropriate solubilizing agent such as an alcohol (e.g., ethanol), a polyalcohol (e.g., propylene glycol, polyethylene glycol), a nonionic surfactant (e.g., polysorbate 80, HCO-50 (polyoxyethylene (50 mol) adduct of hydrogenated castor oil)), etc.
  • an alcohol e.g., ethanol
  • a polyalcohol e.g., propylene glycol, polyethylene glycol
  • a nonionic surfactant e.g., polysorbate 80, HCO-50 (polyoxyethylene (50 mol) adduct of hydrogenated castor oil)
  • oily medium there are employed, e.g., sesame oil, soybean oil, etc., which may be used in combination with a solubilizing agent such as benzyl benzoate, benzyl alcohol, etc.
  • a solubilizing agent such as benzyl benzoate, benzyl alcohol, etc.
  • the pharmaceutical compositions for oral or parenteral use described above are prepared into dosage forms in a unit dose suited to fit a dose of the active ingredients.
  • dosage forms in a unit dose include, for example, tablets, pills, capsules, injections (ampoules), suppositories, etc.
  • compositions comprising an anti-IL-4R antibody that can be used in the invention are disclosed, e.g., in US Patent Application Publication No. 2012/0097565.
  • the amount of IL-33 antagonist (e.g., an anti-IL-33 antibody or antigen-binding fragment thereol) or IL-4R antagonist (e.g., anti-IL-4R antibody or antigen-binding fragment thereol) administered to a subject according to the methods or uses featured in the invention is, generally, a therapeutically effective amount.
  • the phrase “therapeutically effective amount” means an amount of IL-33 antagonist or IL-4R antagonist that results in one or more of: (a) a reduction in the incidence of allergic asthma exacerbations; (b) an improvement in one or more allergic asthma-associated parameters (as defined elsewhere herein); and/or (c) a detectable improvement in one or more symptoms or indicia of an upper airway inflammatory condition.
  • a “therapeutically effective amount” also includes an amount of IL-33 antagonist or IL-4R antagonist that inhibits, prevents, lessens, or delays the progression of allergic asthma in a subject.
  • a therapeutically effective amount can be from about 0.05 mg to about 700 mg, e.g., about 0.05 mg, about 0.1 mg, about 1.0 mg, about 1.5 mg, about 2.0 mg, about 3.0 mg, about 5.0 mg, about 7.0 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 110 mg, about 120 mg, about 130 mg, about 140 mg, about 150 mg, about 160 mg, about 170 mg, about 180 mg, about 190 mg, about 200 mg, about 210 mg, about 220 mg, about 230 mg, about 240 mg, about 250 mg, about 260 mg, about 270 mg, about 280 mg, about 290 mg, about 300 mg, about 310 mg, about 320 mg, about 330 mg, about 340 mg, about 350 mg, about 360 mg, about 370 mg, about 380 mg,
  • the amount of IL-33 antagonist or IL-4R antagonist contained within the individual doses may be expressed in terms of milligrams of antibody per kilogram of patient body weight (i.e., mg/kg).
  • the IL-4R antagonist may be administered to a patient at a dose of about 0.0001 to about 30 mg/kg of patient body weight.
  • a therapeutically effective amount can be about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 11 mg/kg, about 12 mg/kg, about 13 mg/kg, about 14 mg/kg, about 15 mg/kg, about 16 mg/kg, about 17 mg/kg, about 18 mg/kg, about 19 mg/kg, about 20 mg/kg, about 21 mg/kg, about 22 mg/kg, about 23 mg/kg, about 24 mg/kg, about 25 mg/kg, about 26 mg/kg, about 27 mg/kg, about 28 mg/kg, about 29 mg/kg, or about 30 mg/kg of the anti- IL-33 antibody or anti-IL-4R antibody.
  • 10 mg/kg of an anti-IL-33 antibody is administered.
  • the dose of IL-4R antagonist or IL-33 antagonist may vary according to eosinophil count.
  • the subject may have a blood eosinophil count (high blood eosinophils) >300 cells/ ⁇ L, or 300 - 499 cells/ ⁇ L or >500 cells/ ⁇ L (HEos); a blood eosinophil count of 200 to 299 cells/ ⁇ L (moderate blood eosinophils); or a blood eosinophil count ⁇ 200 cells/ ⁇ L (low blood eosinophils).
  • the dose of IL-4R antagonist or IL-33 antagonist may vary according to periostin levels.
  • the subject may have high periostin levels (e.g., >75.0 ng/mL or 74.4 ng/mL) or low periostin levels (e.g., ⁇ 75.0 ng/mL or ⁇ 74.4 ng/mL).
  • the methods comprise an initial dose of about 5 mg/kg to about 15 mg/kg of an IL-33 antagonist, e.g., about 10 mg/kg of an IL-33 antagonist. In certain embodiments, the methods comprise an initial dose of about 200 to about 600 mg of an IL-4R antagonist, e.g., about 600 mg of an IL-4R antagonist.
  • the methods comprise one or more maintenance doses of about 200 to about 300 mg of the IL-4R antagonist.
  • ICS and LABA are administered for the duration of administration of the IL-33 antagonist. In certain embodiments, ICS and LABA are administered for the duration of administration of the IL-4R antagonist.
  • the initial dose comprises 600 mg of an anti-IL-4R antibody or antigen-binding fragment thereof
  • the one or more maintenance doses comprises 300 mg of the antibody or antigen-binding fragment thereof administered every other week.
  • the initial dose comprises 600 mg of an anti-IL-4R antibody or antigen-binding fragment thereof, and the one or more maintenance doses comprises 300 mg of the antibody or antigen-binding fragment thereof administered every fourth week.
  • the initial dose comprises 600 mg of an anti-IL-4R antibody or antigen-binding fragment thereof, and the one or more maintenance doses comprises 300 mg of the antibody or antigen-binding fragment thereof administered once a week.
  • the initial dose comprises 600 mg of an anti-IL-4R antibody or antigen-binding fragment thereof
  • the one or more maintenance doses comprises 300 mg of the antibody or antigen-binding fragment thereof administered every third week.
  • the subject is 6 to ⁇ 18 years old and the IL-33 antibody or antigen- binding fragment thereof or the IL-4R antibody or antigen binding fragment thereof is administered at 2 mg/kg or 4 mg/kg.
  • the subject is 12 to ⁇ 18 years old and the IL-33 antibody or antigen-binding fragment thereof or the IL-4R antibody or antigen binding fragment thereof is administered at 2 mg/kg or 4 mg/kg.
  • the subject is 6 to ⁇ 12 years old and the IL-33 antibody or antigen-binding fragment thereof or the IL-4R antibody or antigen binding fragment thereof is administered at 2 mg/kg or 4 mg/kg.
  • the subject is 2 to ⁇ 6 years old and the IL-33 antibody or antigen-binding fragment thereof or the IL-4R antibody or antigen binding fragment thereof is administered at 2 mg/kg or 4 mg/kg.
  • the subject is ⁇ 2 years old and the IL-33 antibody or antigen- binding fragment thereof or the IL-4R antibody or antigen binding fragment thereof is administered at 2 mg/kg or 4 mg/kg.
  • Certain embodiments of the methods featured in the invention comprise administering to the subject one or more additional therapeutic agents in combination with the IL-33 antagonist, one or more additional therapeutic agents in combination with the IL-4R antagonist, or one or more additional therapeutic agents in combination with the IL-33 antagonist and the IL-4R antagonist. Certain embodiments of the invention comprise the IL-33 antagonist, the IL-4R antagonist or the IL-33 antagonist and the IL-4R antagonist for use in combination with additional therapeutic agents. Certain embodiments of the invention comprise a combination of the IL-33 antagonist, the IL-4R antagonist or the IL-33 antagonist and the IL-4R antagonist with additional therapeutic agents for use.
  • the expression “in combination with” means that the additional therapeutic agents are administered before, after, or concurrent with the pharmaceutical composition comprising the IL-4R antagonist, IL-33 antagonist, or the IL-33 antagonist and the IL-4R antagonist.
  • the term “in combination with” includes sequential or concomitant administration of an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist, and an additional therapeutic agent.
  • the invention includes methods to treat asthma or an associated condition or complication or to reduce at least one exacerbation, comprising administration of an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist, in combination with an additional therapeutic agent for additive or synergistic activity.
  • the additional therapeutic agent when administered “before” the pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist, the additional therapeutic agent may be administered about 72 hours, about 60 hours, about 48 hours, about 36 hours, about 24 hours, about 12 hours, about 10 hours, about 8 hours, about 6 hours, about 4 hours, about 2 hours, about 1 hour, about 30 minutes, about 15 minutes, or about 10 minutes prior to the administration of the pharmaceutical composition comprising the IL-33 antagonist, the IL-4R antagonist, or the IL-33 antagonist and the IL-4R antagonist.
  • the additional therapeutic agent may be administered about 10 minutes, about 15 minutes, about 30 minutes, about 1 hour, about 2 hours, about 4 hours, about 6 hours, about 8 hours, about 10 hours, about 12 hours, about 24 hours, about 36 hours, about 48 hours, about 60 hours, or about 72 hours after the administration of the pharmaceutical composition comprising the IL-33 antagonist, the IL-4R antagonist, or the IL-33 antagonist and the IL-4R antagonist.
  • Administration “concurrent” with the pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist means that the additional therapeutic agent is administered to the subject in a separate dosage form within less than 5 minutes (before, after, or at the same time) of administration of the pharmaceutical composition comprising the IL-33 antagonist, the IL-4R antagonist, or the IL-33 antagonist and the IL-4R antagonist, or administered to the subject as a single combined dosage formulation comprising both the additional therapeutic agent and the IL- 33 antagonist, the IL-4R antagonist, or the IL-33 antagonist and the IL-4R antagonist.
  • the additional therapeutic agent may be, e.g., another IL-33 antagonist, another IL-4R antagonist, an IL-1 antagonist (including, e.g., an IL-1 antagonist as set forth in US Patent No. 6,927,044), an IL-6 antagonist, an IL-6R antagonist (including, e.g., an anti-IL-6R antibody as set forth in US Patent No.
  • a TNF antagonist e.g., bitolterol, fenoterol, isoprenaline, isoprotenerol, levosalbutamol, levalbuterol, orciprenaline, metaproterenol, pirbuterol, procaterol, ritodrine, salbutamol, albuterol or terbutaline
  • a long-acting beta2 agonist e.g., salmeterol or formoterol
  • an inhaled corticosteroid e.g., fluticasone or budesonide
  • a systemic corticosteroid e.g., oral or intravenous
  • the pharmaceutical composition comprising an IL-4R antagonist, an IL-33 antagonist, or an IL-33 antagonist and an IL-4R antagonist, is administered with a combination comprising a long-acting beta2 agonist and an inhaled corticosteroid (e.g., fluticasone + salmeterol [e.g., Advair® (GlaxoSmithKline)]; or budesonide + formoterol [e.g., SYMBICORT® (AstraZeneca)]).
  • a long-acting beta2 agonist e.g., fluticasone + salmeterol [e.g., Advair® (GlaxoSmithKline)]
  • budesonide + formoterol e.g., SYMBICORT® (AstraZeneca)
  • multiple doses of an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist may be administered to a subject over a defined time course.
  • Such methods or uses comprise sequentially administering to a subject multiple doses of an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • “sequentially administering” means that each dose of an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist, is administered to the subject at a different point in time, e.g., on different days separated by a predetermined interval (e.g., hours, days, weeks, or months).
  • methods or uses that comprise sequentially administering to the patient a single initial dose of an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist, followed by one or more secondary doses of the IL-33 antagonist, the IL-4R antagonist, or the IL-33 antagonist and the IL-4R antagonist, and optionally followed by one or more tertiary doses of the IL-33 antagonist, the IL- 4R antagonist, or the IL-33 antagonist and the IL-4R antagonist.
  • the invention includes methods or uses comprising administering to a subject a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist at a dosing frequency of about four times a week, twice a week, once a week (qlw), once every two weeks (bi-weekly or q2w), once every three weeks (tri- weekly or q3w), once every four weeks (monthly or q4w), once every five weeks (q5w), once every six weeks (q6w), once every eight weeks (q8w), once every twelve weeks (ql2w), or less frequently so long as a therapeutic response is achieved.
  • a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist at a dosing frequency of about four times a week, twice a week, once a week (qlw), once every two weeks (bi-weekly or q2w), once every three
  • a pharmaceutical composition comprising an anti-IL-33 antibody or an anti-IL- 4R antibody
  • once a week dosing of an amount of about 75 mg, 100 mg, 150 mg, 200 mg, or 300 mg can be employed.
  • once every two weeks dosing (bi-weekly dosing) of an amount of about 75 mg, 100 mg, 150 mg, 200 mg, or 300 mg can be employed.
  • a pharmaceutical composition comprising an anti-IL-33 antibody or an anti-IL-4R antibody once every three weeks dosing of an amount of about 75 mg, 100 mg, 150 mg, 200 mg, or 300 mg, can be employed. In other embodiments involving the administration of a pharmaceutical composition comprising an anti-IL-33 antibody or an anti-IL-4R antibody, once every four weeks dosing (monthly dosing) of an amount of about 75 mg, 100 mg, 150 mg, 200 mg, or 300 mg, can be employed.
  • a pharmaceutical composition comprising an anti- IL-33 antibody or an anti-IL-4R antibody once every five weeks dosing of an amount of about 75 mg, 100 mg, 150 mg, 200 mg, or 300 mg, can be employed.
  • a pharmaceutical composition comprising an anti-IL-33 antibody or an anti- IL-4R antibody once every six weeks dosing of an amount of about 75 mg, 100 mg, 150 mg, 200 mg, or 300 mg, can be employed.
  • a pharmaceutical composition comprising an anti-IL-33 antibody or an anti-IL-4R antibody once every eight weeks dosing of an amount of about 75 mg, 100 mg, 150 mg, 200 mg, or 300 mg, can be employed.
  • a pharmaceutical composition comprising an anti-IL-33 antibody or an anti-IL-4R antibody
  • dosing of an amount of about 75 mg, 100 mg, 150 mg, 200 mg, or 300 mg can be employed.
  • the route of administration is subcutaneous.
  • week refers to a period of (n x 7 days) ⁇ 2 days, e.g. (n x 7 days) ⁇ 1 day, or (n x 7 days), wherein “n” designates the number of weeks, e.g. 1, 2, 3, 4, 5, 6, 8, 12 or more.
  • the terms “initial dose,” “subsequent dose(s),” “secondary dose(s),” and “tertiary dose(s),” refer to the temporal sequence of administration of the IL-4R antagonist or the IL-33 antagonist.
  • the “initial dose” is the dose that is administered at the beginning of the treatment regimen (also referred to as the “baseline dose”); the “subsequent doses” or “secondary doses” are the doses that are administered after the initial dose; and the “tertiary doses” are the doses that are administered after the secondary doses.
  • the initial, subsequent, secondary, and tertiary doses may all contain the same amount of IL-33 antagonist or IL-4R antagonist, but generally may differ from one another in terms of frequency of administration. In certain embodiments, however, the amount of IL-33 antagonist or IL-4R antagonist contained in the initial, subsequent, secondary and/or tertiary doses varies from one another (e.g., adjusted up or down as appropriate) during the course of treatment. In certain embodiments, two or more (e.g., 2, 3, 4, or 5 or more) doses are administered at the beginning of the treatment regimen as “initial doses” or “loading doses” followed by subsequent doses that are administered on a less frequent basis (e.g., “maintenance doses”). In one embodiment, the maintenance dose may be lower than the loading or initial dose. For example, one or more loading doses of 600 mg of IL-4R antagonist may be administered followed by maintenance doses of about 75mg to about 300 mg.
  • the initial dose is about 400 mg to about 600 mg of the IL-4R antagonist. In one embodiment, the initial dose is 400 mg of the IL-4R antagonist. In another embodiment, the initial dose is 600 mg of the IL-4R antagonist.
  • the subsequent dose is about 200 to about 300 mg of the IL-4R antagonist. In one embodiment, the subsequent dose is 200 mg of the IL-4R antagonist. In another embodiment, the subsequent dose is 300 mg of the IL-4R antagonist.
  • the initial dose is about 5 mg/kg to about 15 mg/kg of the IL-33 antagonist. In one embodiment, the initial dose is 10 mg/kg of the IL-33 antagonist.
  • the subsequent dose is about 5 mg/kg to about 15 mg/kg of the IL-33 antagonist. In one embodiment, the subsequent dose is 5 mg/kg of the IL-33 antagonist. In another embodiment, the subsequent dose is 10 mg/kg of the IL-33 antagonist. In another embodiment, no subsequent dose is administered to the subject (e.g., only an initial dose is administered to the subject).
  • the loading dose is two times the maintenance dose. In certain embodiments, the initial dose is the same amount as the maintenance dose. In certain embodiments, the initial dose is the only dose administered.
  • the initial dose comprises 300 mg of the antibody or antigen- binding fragment thereof
  • the one or more maintenance doses comprises 300 mg of the antibody or antigen-binding fragment thereof administered every other week.
  • the initial dose comprises 300 mg of the antibody or antigen- binding fragment thereof
  • the one or more maintenance doses comprises 300 mg of the antibody or antigen-binding fragment thereof administered every fourth week.
  • a subject has mild allergic asthma
  • the initial dose comprises 600 mg of the antibody or antigen-binding fragment thereof
  • the one or more maintenance doses comprises 300 mg of the antibody or antigen-binding fragment thereof administered every fourth week.
  • the initial dose comprises 10 mg/kg of the antibody or antigen- binding fragment thereof
  • the one or more maintenance doses comprises 10 mg/kg of the antibody or antigen-binding fragment thereof administered every other week.
  • the initial dose comprises 10 mg/kg of the antibody or antigen- binding fragment thereof
  • the one or more maintenance doses comprises 10 mg/kg of the antibody or antigen-binding fragment thereof administered every fourth week.
  • a subject has mild allergic asthma, and the initial dose comprises 10 mg/kg of the antibody or antigen-binding fragment thereof.
  • each subsequent, secondary and/or tertiary dose is administered 1 to 14 (e.g., 1, 11 ⁇ 2, 2, 21 ⁇ 2, 3, 31 ⁇ 2, 4, 41 ⁇ 2, 5, 51 ⁇ 2, 6, 61 ⁇ 2, 7, 71 ⁇ 2, 8, 81 ⁇ 2, 9, 91 ⁇ 2, 10, 101 ⁇ 2, 11, 111 ⁇ 2, 12, 121 ⁇ 2, 13, 131 ⁇ 2, 14, 141 ⁇ 2, or more) weeks after the immediately preceding dose.
  • the phrase “the immediately preceding dose” means, in a sequence of multiple administrations, the dose of IL-33 antagonist or IL-4R antagonist that is administered to a patient prior to the administration of the very next dose in the sequence with no intervening doses.
  • the methods or uses may include administering to a patient any number of secondary and/or tertiary doses of an IL-33 antagonist or an IL-4R antagonist.
  • any number of secondary and/or tertiary doses of an IL-33 antagonist or an IL-4R antagonist may include administering to a patient any number of secondary and/or tertiary doses of an IL-33 antagonist or an IL-4R antagonist.
  • only a single secondary dose is administered to the patient.
  • two or more (e.g., 2, 3, 4, 5, 6, 7, 8, or more) secondary doses are administered to the patient.
  • two or more (e.g., 2, 3, 4, 5, 6, 7, 8, or more) tertiary doses are administered to the patient.
  • each secondary dose may be administered at the same frequency as the other secondary doses. For example, each secondary dose may be administered to the patient 1 to 2 weeks after the immediately preceding dose. Similarly, in embodiments involving multiple tertiary doses, each tertiary dose may be administered at the same frequency as the other tertiary doses. For example, each tertiary dose may be administered to the patient 2 to 4 weeks after the immediately preceding dose. Alternatively, the frequency at which the secondary and/or tertiary doses are administered to a patient can vary over the course of the treatment regimen. The frequency of administration may also be adjusted during the course of treatment by a physician depending on the needs of the individual patient following clinical examination.
  • the invention includes methods comprising sequential administration of an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist and an additional therapeutic agent, to a patient to treat asthma or an associated condition.
  • the invention also includes an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist for use to a patient to treat asthma or an associated condition, wherein said patient is treated with sequential administration of an IL-33 antagonist or an IL-33 antagonist and an IL-4R antagonist and an additional therapeutic agent.
  • the methods or uses comprise administering one or more doses of an IL-33 antagonist or one or more doses of both an IL-33 antagonist and an IL-4R antagonist followed by one or more doses (e.g., 2, 3, 4, 5, 6, 7, 8, or more) of an additional therapeutic agent.
  • one or more doses of about 75 mg to about 300 mg of an IL-4R antagonist and/or one or more doses of about 5 mg/kg to about 20 mg/kg of an IL-33 antagonist may be administered after which one or more doses (e.g., 2, 3, 4, 5, 6, 7, 8, or more) of an additional therapeutic agent (e.g., an inhaled corticosteroid or a beta2-agonist or any other therapeutic agent, as described elsewhere herein) may be administered to treat, alleviate, reduce or ameliorate one or more symptoms of asthma.
  • an additional therapeutic agent e.g., an inhaled corticosteroid or a beta2-agonist or any other therapeutic agent, as described elsewhere herein
  • an IL-33 antagonist and/or an IL-33 antagonist are administered at one or more doses (e.g., 2, 3, 4, 5, 6, 7, 8, or more) resulting in an improvement in one or more asthma-associated parameters followed by the administration of a second therapeutic agent to prevent recurrence of at least one symptom of asthma.
  • doses e.g., 2, 3, 4, 5, 6, 7, 8, or more
  • Alternative embodiments pertain to concomitant administration of an IL-33 antagonist and/or an IL-4R antagonist, and an additional therapeutic agent.
  • one or more doses e.g., 2, 3, 4, 5, 6, 7, 8, or more
  • an additional therapeutic agent is administered at a separate dosage at a similar or different frequency relative to an IL-33 antagonist and/or an IL-4R antagonist.
  • the additional therapeutic agent is administered before, after or concurrently with the IL-33 antagonist and/or the IL-4R antagonist.
  • an IL-33 antagonist and/or an IL-4R antagonist are administered every other week for 12 weeks, 14 weeks, 16 weeks, 18 weeks, 20 weeks, 22 weeks, 24 weeks, 26 weeks, 28 weeks, 30 weeks, 32 weeks, 34 weeks, 36 weeks, 38 weeks, 40 weeks, 42 weeks, 44 weeks, 46 weeks, 48 weeks or more.
  • an IL-33 antagonist and/or an IL-4R antagonist are administered every four weeks for 12 weeks, 16 weeks, 20 weeks, 24 weeks, 28 weeks, 32 weeks, 36 weeks, 40 weeks, 44 weeks, 48 weeks or more.
  • an IL-33 antagonist and/or an IL-4R antagonist are administered for at least 24 weeks.
  • the invention includes methods for treating a subject having mild allergic asthma comprising administering to the subject a loading dose of an antibody or an antigen-binding fragment thereof that specifically binds to IL-4R, and/or an antibody or an antigen-binding fragment thereof that specifically binds to IL-33.
  • the methods or uses comprise administering to the subject a plurality of maintenance doses of the antibody(ies) or the antigen-binding fragment(s) thereof, wherein the plurality of maintenance doses are administered during a treatment phase.
  • a subject in need thereof may include, e.g., subjects who, prior to treatment, exhibit (or have exhibited) one or more asthma-associated parameter, such as, e.g., impaired FEV 1 (e.g., less than 2.0 L), impaired FEF25-75%; impaired AM PEF (e.g., less than 400 L/min), impaired PM PEF (e.g., less than 400 L/min), an ACQ5 score of at least 2.5, at least 1 nighttime awakenings per night, and/or a SNOT-22 score of at least 20.
  • impaired FEV 1 e.g., less than 2.0 L
  • impaired FEF25-75% e.g., less than 400 L/min
  • impaired PM PEF e.g., less than 400 L/min
  • an ACQ5 score of at least 2.5, at least 1 nighttime awakenings per night, and/or a SNOT-22 score of at least 20.
  • the methods featured in the invention include administering to a subject in need thereof a therapeutic composition comprising an IL-33 antagonist, an IL-4R antagonist, or both an IL-33 antagonist and an IL-4R antagonist.
  • a subject in need thereof means a human or non-human animal that exhibits one or more symptoms or indicia of asthma (e.g., allergic asthma), or who has been diagnosed with asthma.
  • the methods may be used to treat mild, moderate-to-severe, and severe allergic asthma in patients in need thereof, including mild persistent allergic asthma.
  • a “subject in need thereof’ may be a subject who, prior to receiving an IL-4R antagonist or both an IL-33 antagonist and an IL-4R antagonist, has been prescribed or is currently taking a SABA or a combination of ICS/LABA.
  • SABA include, but are not limited to, bitolterol, fenoterol, isoprenaline, isoprotenerol, levosalbutamol, levalbuterol, orciprenaline, metaproterenol, pirbuterol, procaterol, ritodrine, salbutamol, albuterol or terbutaline
  • Examples of ICS include, but are not limited to, mometasone furoate, budesonide, and fluticasone propionate.
  • Examples of LABA include, but are not limited to, formoterol and salmeterol.
  • Examples of ICS/LABA therapies include, but are not limited to, fluticasone/salmeterol combination therapy and budesonide/formoterol combination therapy.
  • the invention includes methods that comprise administering an IL-4R antagonist or both an IL-33 antagonist and an IL-4R antagonist to a patient who has been taking a course of SABA for two or more weeks immediately preceding the administration of the IL-4R antagonist and/or the IL-33 antagonist on a per needed basis (such prior treatments are referred to herein as “background treatments”).
  • the invention includes therapeutic methods in which background treatments are continued in combination with administration of the IL-4R antagonist and/or the IL-33 antagonist.
  • the amount of the LABA is gradually decreased prior to or after the start of IL-4R antagonist and/or IL-33 antagonist administration.
  • the methods to treat patients with mild persistent asthma for at least > 12 months are provided.
  • a patient with mild persistent allergic asthma may be administered an IL-4R antagonist and/or an IL-33 antagonist according to the present methods.
  • a “subject in need thereof’ may be a subject with elevated levels of an asthma-associated biomarker.
  • asthma-associated biomarkers include, but are not limited to, IgE, thymus and activation regulated chemokine (TARC), eotaxin-3, CEA, YKL- 40, and periostin.
  • a “subject in need thereof’ may be a subject with blood eosinophils > 300 cells/ ⁇ L, 150-299 cells/ ⁇ L, or ⁇ 150 cells/ ⁇ L.
  • a “subject in need thereof’ may be a subject with elevated level of bronchial or airway inflammation as measured by the fraction of exhaled nitric oxide (FeNO).
  • a “subject in need thereof’ is selected from the group consisting of: a subject age 18 years old or older, a subject 12 years or older, a subject age 12 to 17 years old (12 to ⁇ 18 years old), a subject age 6 to 11 years old (6 to ⁇ 12 years old), and a subject age 2 to 5 years old (2 to ⁇ 6 years old).
  • a “subject in need thereof’ is selected from the group consisting of: an adult, an adolescent, and a child.
  • a “subject in need thereof’ is selected from the group consisting of: an adult age 18 years of age or older, an adolescent age 12 to 17 years old (12 to ⁇ 18 years old), a child age 6 to 11 years old (6 to ⁇ 12 years old), and a child age 2 to 5 years old (2 to ⁇ 6 years old).
  • the subject can be less than 2 years of age, e.g., 12 to 23 months, or 6 to 11 months.
  • a normal IgE level in healthy subjects is less than about 100 kU/L (e.g., as measured using the IMMUNOCAP® assay [Phadia, Inc. Portage, MI]).
  • the invention includes methods comprising selecting a subject who exhibits an elevated serum IgE level, which is a serum IgE level greater than about 100 kU/L, greater than about 150 kU/L, greater than about 500 kU/L, greater than about 1000 kU/L, greater than about 1500 kU/L, greater than about 2000 kU/L, greater than about 2500 kU/L, greater than about 3000 kU/L, greater than about 3500 kU/L, greater than about 4000 kU/L, greater than about 4500 kU/L, or greater than about 5000 kU/L, and administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of an IL-33 antagonist and/or an IL-4R antagonist.
  • TARC levels in healthy subjects are in the range of 106 ng/L to 431 ng/L, with a mean of about 239 ng/L.
  • An exemplary assay system for measuring TARC level is the TARC quantitative ELISA kit offered as Cat. No.
  • the invention involves methods comprising selecting a subject who exhibits an elevated TARC level, which is a serum TARC level greater than about 431 ng/L, greater than about 500 ng/L, greater than about 1000 ng/L, greater than about 1500 ng/L, greater than about 2000 ng/L, greater than about 2500 ng/L, greater than about 3000 ng/L, greater than about 3500 ng/L, greater than about 4000 ng/L, greater than about 4500 ng/L, or greater than about 5000 ng/L, and administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of an IL-33 antagonist and/or an IL-4R antagonist.
  • TARC level which is a serum TARC level greater than about 431 ng/L, greater than about 500 ng/L, greater than about 1000 ng/L, greater than about 1500 ng/L, greater than about 2000 ng/L, greater than about 2500 ng/L, greater than about 3000 ng/L, greater than about 3500
  • Eotaxin-3 belongs to a group of chemokines released by airway epithelial cells, which is up-regulated by the Th2 cytokines IL-4 and IL-13 (Lilly et al 1999, J. Allergy Clin. Immunol. 104: 786-790).
  • the invention includes methods comprising administering an IL-33 antagonist and/or an IL-4R antagonist to treat patients with elevated levels of eotaxin-3, such as more than about 100 pg/ml, more than about 150 pg/ml, more than about 200 pg/ml, more than about 300 pg/ml, or more than about 350 pg/ml.
  • Serum eotaxin-3 levels may be measured, for example, by ELISA.
  • Fractional exhaled NO is a biomarker of bronchial or airway inflammation. FeNO is produced by airway epithelial cells in response to inflammatory cytokines including IL- 4 and IL-13 (Alwing et al 1993, Eur. Respir. J. 6: 1368-1370). FeNO levels in healthy adults range from 2 to 30 parts per billion (ppb).
  • An exemplary assay for measuring FeNO is by using aNIOX instrument by Aerocrine AB, Solna, Sweden. The assessment may be conducted prior to spirometry and following a fast of at least an hour.
  • IL-33 antagonist and/or an IL-4R antagonist
  • elevated levels of exhaled NO such as more than about 30ppb, more than about 31 ppb, more than about 32 ppb, more than about 33ppb, more than about 34 ppb, or more than about 35ppb.
  • CEA Carcinoembryogenic antigen
  • CEACAM5 CEA cell adhesion molecule 5
  • the invention includes methods comprising administering an IL-33 antagonist and/or an IL-4R antagonist, to patients with elevated levels of CEA, such as more than about 1.0 ng/ml, more than about 1.5 ng/ml, more than about 2.0 ng/ml, more than about 2.5 ng/ml, more than about 3.0 ng/ml, more than about 4.0 ng/ml, or more than about 5.0 ng/ml.
  • YKL-40 (named for its N-terminal amino acids tyrosine (Y), lysine (K)and leucine (L) and its molecular mass of 40kD) is a chitinas e-like protein found to be up regulated and correlated to asthma exacerbation, IgE, and eosinophils (Tang et al 2010 Eur. Respir. J. 35: 757-760). Serum YKL-40 levels are measured by, for example, ELISA.
  • the invention includes methods comprising administering an IL-33 antagonist and/or an IL-4R antagonist, to patients with elevated levels of YKL-40, such as more than about 40 ng/ml, more than about 50 ng/ml, more than about 100 ng/ml, more than about 150 ng/ml, more than about 200 ng/ml, or more than about 250 ng/ml.
  • Periostin is a secreted matricellular protein associated with fibrosis, and its expression is upregulated by recombinant IL-4 and IL-13 in cultured bronchial epithelial cells and bronchial fibroblasts (Jia et al. (2012) J. Allergy Clin. Immunol.130:647). In human asthmatic patients periostin expression levels correlate with reticular basement membrane thickness, an indicator of subepithelial fibrosis. Id. Included here are methods comprising administering an IL-33 antagonist and/or an IL-4R antagonist, to patients with elevated levels of periostin (e.g., ⁇ 74.4 ng/mL).
  • periostin e.g., ⁇ 74.4 ng/mL
  • the subjects are stratified into the following groups: a blood eosinophil count (high blood eosinophils) ⁇ 300 cells/ ⁇ L (HEos) or 300 - 499 cells/ ⁇ L or ⁇ 500 cells/ ⁇ L, a blood eosinophil count of 200 to 299 cells/ ⁇ L (moderate blood eosinophils), or a blood eosinophil count ⁇ 200 cells/ ⁇ L (low blood eosinophils), and are administered an IL-33 antagonist and/or an IL-4R antagonist, at a dose or dosing regimen based upon the eosinophil level.
  • a blood eosinophil count high blood eosinophils
  • HEos high blood eosinophils
  • 300 - 499 cells/ ⁇ L or ⁇ 500 cells/ ⁇ L a blood eosinophil count of 200 to 299 cells/ ⁇ L (moderate blood eosinophils)
  • a subject has “eosinophilic phenotype” asthma defined by a blood eosinophil count of ⁇ 150 cells/ ⁇ L, a blood eosinophil count of >300 cells/ ⁇ L, or a blood eosinophil count of ⁇ 500 cells/ ⁇ L, and are administered an IL-33 antagonist and/or an IL-4R antagonist.
  • a subject has “periostin phenotype” asthma defined by a high blood periostin level as defined herein, and are administered an IL-33 antagonist and/or an IL-4R antagonist.
  • a “subject in need thereof’ is a subject that is a clinically stable, non-smoker with mild persistent allergic asthma who requires only inhaled short-acting b2 agonist (SABA) use on a per needed basis to control asthma symptoms and who is allergic to house dust mite (HDM) allergen, as determined by a skin prick test.
  • SABA short-acting b2 agonist
  • the invention also includes methods for assessing one or more pharmacodynamic asthma-associated parameters in a subject in need thereof, caused by administration of a pharmaceutical composition comprising an IL-33 antagonist, an IL-4R antagonist, or an IL-33 antagonist and an IL-4R antagonist.
  • a reduction in the incidence of an allergic asthma exacerbation (as described above) or an improvement in one or more asthma-associated parameters (as described above) may correlate with an improvement in one or more pharmacodynamic asthma-associated parameters; however, such a correlation is not necessarily observed in all cases.
  • Examples of “pharmacodynamic asthma-associated parameters” include, for example, the following: (a) biomarker expression levels; (b) serum protein and RNA analysis; (c) induced sputum eosinophils and neutrophil levels; (d) exhaled nitric oxide (FeNO); and (e) blood eosinophil count.
  • An “improvement in a pharmacodynamic asthma-associated parameter” means, for example, a decrease from baseline of one or more biomarkers, such as periostin, TARC, eotaxin-3 or IgE, a decrease in sputum eosinophils or neutrophils, FeNO, periostin or blood eosinophil count.
  • the term “baseline,” with regard to a pharmacodynamic asthma- associated parameter means the numerical value of the pharmacodynamic asthma-associated parameter for a patient prior to or at the time of administration of a pharmaceutical composition described herein.
  • a pharmacodynamic asthma-associated parameter is quantified at baseline and at a time point after administration of the pharmaceutical composition.
  • a pharmacodynamic asthma-associated parameter may be measured at day 1, day 2, day 3, day 4, day 5, day 6, day 7, day 8, day 9, day 10, day 11, day 12, day 14, or at week 3, week 4, week 5, week 6, week 7, week 8, week 9, week 10, week 11, week 12, week 13, week 14, week 15, week 16, week 17, week 18, week 19, week 20, week 21, week 22, week 23, week 24, or longer, after the initial treatment with the pharmaceutical composition.
  • the difference between the value of the parameter at a particular time point following initiation of treatment and the value of the parameter at baseline is used to establish whether there has been change, such as an “improvement,” in the pharmacodynamic asthma-associated parameter (e.g., an increase or decrease, as the case may be, depending on the specific parameter being measured).
  • administering causes a change, such as a decrease or increase, in expression of a particular biomarker.
  • Asthma-associated biomarkers include, but are not limited to, the following: (a) total IgE; (b) thymus and activation-regulated chemokine (TARC); (c) YKL-40; (d) carcinoembryonic antigen in serum; (e) eotaxin-3 in plasma; and (1) periostin in serum.
  • administration of an IL-33 antagonist and/or an IL-4R antagonist, to an asthma patient can cause one or more of a decrease in TARC or eotaxin-3 levels, or a decrease in total serum IgE levels.
  • the decrease can be detected at week 1, week 2, week 3, week 4, week 5, or longer following administration of the IL-33 antagonist, the IL-4R antagonist or the IL-33 antagonist and the IL-4R antagonist.
  • Biomarker expression can be assayed by methods known in the art. For example, protein levels can be measured by ELISA (Enzyme Linked Immunosorbent Assay). RNA levels can be measured, for example, by reverse transcription coupled to polymerase chain reaction (RT-PCR).
  • Biomarker expression can be assayed by detection of protein or RNA in serum.
  • the serum samples can also be used to monitor additional protein or RNA biomarkers related to response to treatment with an IL-33 antagonist and/or an IL-4R antagonist, IL-4/IL-13 signaling, asthma, atopy or eosinophilic diseases (e.g., by measuring soluble IL-4Ra, IL-4, IL-13, periostin and the like).
  • RNA samples are used to determine RNA levels (non-genetic analysis), e.g., RNA levels of biomarkers, and in other embodiments, RNA samples are used for transcriptome sequencing (e.g., genetic analysis).
  • the exemplary IL-33 antagonist used in the following Example is the human anti-IL-33 antibody named SAR440340, which is also referred to as REGN3500 or by its international nonproprietary name (INN), itepekimab.
  • the exemplary IL-4R antagonist used in the following Example is the human anti-IL-4R antibody named dupilumab (i.e., DUPIXENT®).
  • Example 1 A randomized, placebo-controlled, parallel panel study to assess the effects of REGN3500, dupilumab, and combination of REGN3500 plus dupilumab on markers of inflammation after bronchial allergen challenge in patients with allergic asthma
  • REGN3500 and dupilumab are fully human monoclonal antibodies (mAbs).
  • Dupilumab is an anti-interleukin-4 receptor alpha subunit (IL-4Ra) mAb.
  • REGN3500 targets IL-33, a pro- inflammatory cytokine that initiates and amplifies innate and adaptive inflammatory cascades (Cayrol et al. IL-33: an alarmin cytokine with crucial roles in innate immunity, inflammation and allergy. Curr Opin Immunol. 2014. 31:31-37.)
  • This study is to evaluate the treatment effects of REGN3500, dupilumab, and REGN3500 plus dupilumab combination, as compared with placebo, and the effect of inhaled corticosteroids on the allergic inflammatory pathways triggered by an inhaled house dust mite (HDM) bronchial allergen challenge (BAC), in HDM-sensitive adult patients with mild asthma.
  • the inhaled BAC model has been effectively used in asthma drug development for over 30 years (Diamant et al. Inhaled allergen bronchoprovocation tests. J Allergy Clin Immunol. 2013. 132: 1045-1055 el046, Fahy et al.
  • Bronchial allergen challenge involves patient inhalation of allergen that results in a biphasic airway response, which is characterized by an early (30 minutes to 2 hours post-allergen challenge) and a late (approximately 3 to 8 hours post-allergen challenge) decline in forced expiratory volume over 1 second (FEV1).
  • This model facilitates the evaluation of allergic inflammatory response via measurement of changes in cell content, cytokine production, and mRNA inflammatory signatures in bronchoalveolar lavage, bronchial biopsies, or induced sputum (Zuiker et al. Sputum RNA signature in allergic asthmatics following allergen bronchoprovocation test. Eur Clin Respir J. 2016. 3:31324.)
  • this study leverages the BAC model to evaluate treatment-induced changes in allergic inflammation as measured in induced sputum, with a particular focus on changes in targeted selected mRNA signatures.
  • a key feature of this study design is the requirement of a pre-treatment BAC to allow intra-patient comparison of pre- and post-treatment effects on BAC.
  • the purpose of this study is to evaluate the effects of REGN3500, dupilumab, and REGN3500 plus dupilumab combination on the molecular mechanisms involved in allergic inflammation in the asthmatic airway, which are thought to contribute to asthma pathogenesis.
  • this study explores the expression of select markers of inflammation in the sputum of patients with mild allergic asthma, induced with a controlled BAC using HDM.
  • Comparison of the effects of treatment with REGN3500, dupilumab, or REGN3500 plus dupilumab combination on changes in the expression of inflammatory pathway molecules in the sputum provides data on whether REGN3500 plus dupilumab combination has an additive effect.
  • the primary objective is to assess the effects of REGN3500, dupilumab, and the combination of REGN3500 plus dupilumab, compared with placebo, on changes in inflammatory gene expression signatures in sputum induced after a bronchial allergen challenge (BAC) in adults with mild allergic asthma, at week 4 after treatment initiation compared with those at screening.
  • BAC bronchial allergen challenge
  • the secondary objectives of the study are: to assess the safety and tolerability of limited doses of REGN3500 and the combination of REGN3500 plus dupilumab in adult patients with mild allergic asthma who undergo BACs; to assess the pharmacokinetic (PK) profile of REGN3500 in adult patients with mild allergic asthma who undergo BACs; to assess the immunogenicity of REGN3500 and dupilumab in adult patients with mild allergic asthma who undergo serial BACs; to assess target engagement of REGN3500 via measurement of total interleukin-33 (IL-33) levels in serum in adult patients with mild allergic asthma who undergo serial BACs; and to assess the effect of fluticasone on changes in inflammatory gene expression signatures in sputum induced after a BAC in adults with mild allergic asthma at day 4 after treatment initiation compared with that at screening.
  • PK pharmacokinetic
  • the inhaled BAC model is used to assess the impact of REGN3500, dupilumab, and combination of REGN3500 plus dupilumab on airway inflammation.
  • the inhaled BAC model is a well-established and reproducible model of induced allergic airway inflammation, which allows assessment of drug treatment effects at a functional, cellular, and molecular level.
  • Previous studies have demonstrated that application of this model may be used to evaluate treatment response via measurement of mRNAs of inflammatory genes in induced sputum (Zuiker et al. Sputum RNA signature in allergic asthmatics following allergen bronchoprovocation test. Eur Clin Respir J. 2016.
  • Part 1 a randomized, double-blind, placebo-controlled component
  • Part 2 an open-label component
  • Fig. 1 in Part 1 of the study, patients are randomized to receive REGN3500 (intravenous (IV), single dose), dupilumab (subcutaneous (SC), 2 doses, 14 days apart), the combination of REGN3500 (IV, single dose) plus dupilumab (SC, 2 doses, 14 days apart), or placebo.
  • REGN3500 intravenous (IV), single dose
  • dupilumab subcutaneous (SC), 2 doses, 14 days apart
  • SC dupilumab
  • SC dupilumab
  • placebo placebo.
  • the effects of the study drugs on BAC -induced lung inflammation are assessed via measurements of sputum molecular signatures (mRNAs and proteins).
  • the sputum molecular signatures are assessed before BAC (baseline) and after BAC (post-BAC) at screening and at weeks 4 and 8 after treatment initiation (Fig. 1).
  • the BAC- induced difference in the sputum signatures before and after BAC are evaluated at screening (screening change) and at weeks 4 and 8 post-treatment (week 4 change and week 8 change) will be observed. Since both REGN3500 and dupilumab display long half-lives, BAC change is evaluated at both week 4 and week 8 in the current study, to monitor the durability of the potential impact of study drug treatment on airway inflammation.
  • the effect of study drug treatment on induced sputum gene signatures is evaluated by the difference between the BAC -induced screening change and the BAC-induced week 4 change (screening to week 4 change) and by the difference between the BAC-induced screening change and the BAC-induced week 8 change (screening to week 8 change).
  • the BAC model has been used in the development of effective, potent anti-inflammatory agents for asthma such as inhaled corticosteroids (Hansel et al. The allergen challenge. Clin Exp Allergy. 2002. 32: 162-167, Inman et al. Dose-dependent effects of inhaled mometasone furoate on airway function and inflammation after allergen inhalation challenge. Am J Respir Crit Care Med. 2001. 164:569-574, and Ravensberg etal. Validated safety predictions of airway responses to house dust mite in asthma. Clin Exp Allergy. 2007.
  • each patient undergoes a BAC during the screening period.
  • each patient In order to be included in the study, each patient must demonstrate both an early FEV1 decline (from 0 to 30 minutes after BAC) as well as a late FEV1 decline (3 to 8 hours after BAC).
  • Previous studies have demonstrated that patients who have both early and late FEV1 decline have higher levels of type 2 cytokines at the late phase than do patients without a FEV1 decline in this period.
  • the second BAC in Part 1 of the study is performed at approximately 4 weeks after the first dose of study treatment.
  • a third BAC is proposed at approximately 8 weeks after treatment initiation to provide an assessment of durability of effect.
  • Part 1 is of 42 weeks duration, excluding the screening period.
  • Part 2 is of 2 weeks duration, excluding the screening period. Part 1 and Part 2 are run concurrently.
  • Part 1 of this study is a randomized, double-blind, placebo-controlled, double-dummy parallel group study in mild persistent allergic asthmatic patients to assess the effect of REGN3500, dupilumab, REGN3500 plus dupilumab combination, or placebo on lung inflammation (as measured by sputum cytokine mRNAs) and measurements of the late phase inflammatory airway response to a BAC using HDM.
  • Patients are randomized to one of the following treatment groups: REGN3500 (IV single dose); dupilumab (SC 2 doses, Q2W); combination REGN3500 (IV single dose) plus dupilumab (SC 2 doses, Q2W), and placebo (IV single dose and SC 2 doses, Q2W).
  • Part 2 involves open-label treatment with a short course of inhaled fluticasone propionate. Patients are administered 8 doses of inhaled fluticasone propionate over 4 days and are followed up through the end of study visit on day 15. The effects of fluticasone propionate on sputum cytokine mRNAs and measurements of the late phase airway response are used as a positive control for comparison with those measurements in Part 1.
  • Anti-drug antibody variables include status (positive or negative) and titer as follows: total number of patients negative in ADA assay at all time points analyzed, total number of patients positive in the ADA assay at all time points analyzed, total number of patients with pre- existing immunoreactivity, total number of patients with treatment-emergent ADA response, total number of patients with treatment-boosted ADA response, and titer category: low (titer ⁇ l,000), moderate (1,000 ⁇ titer ⁇ 10,000), and high (titer >10,000).
  • the dose of allergen required to demonstrate an appropriate EAR for an individual patient during the screening challenge is used to calculate the dose regimen of allergen for this particular patient in the post-treatment BACs (day 29 and day 57 after treatment initiation for Part 1 and day 4 after treatment initiation for Part 2).
  • patients must demonstrate an adequate LAR defined as a drop in FEV1 of 15% or more from pre-BAC FEV1 (however, patient must not drop his/her FEV1 below 25% predicted or ⁇ 1 ,4L).
  • Procedures during the screening BAC are similar to the procedures performed in the treatment phase of the trial. Study Part 1
  • eligible patients are randomized 1 : 1 : 1 : 1 to receive REGN3500, dupilumab, REGN3500 plus dupilumab combination, or placebo. Because the treatment groups in this study include a first clinical dosing of REGN3500 plus dupilumab combination, Part 1 is performed in 2 phases to address any potential safety issues. The first 8 patients are randomized 1 : 1 : 1 : 1 to receive study drug.
  • patients in the REGN3500 group receive REGN3500 IV 10 mg/kg, followed by dupilumab-matching placebo SC
  • patients in the dupilumab group receive REGN3500-matching placebo IV followed by a loading dose of dupilumab SC 600 mg (2 injections of 300 mg)
  • patients in the REGN3500 plus dupilumab combination will receive REGN3500 10 mg/kg IV, followed by dupilumab SC 600 mg (2 injections of 300 mg)
  • patients in the placebo group will receive REGN3500-matching placebo IV, followed by 2 injections of dupilumab-matching placebo SC.
  • Sputum induction is performed 8 hours and 24 hours after inhaled BAC at both the days 29 ⁇ 2 (week 4) and 57 ⁇ 2 days (week 8) visits. Patients are monitored at least 8 hours post-BAC in house and are permitted to leave the study site when deemed stable by the study physician. The washout period between BACs will be at least 21 days. [00344] Measurements of pulmonary function as assessed by spirometry, sputum mRNA, sputum cytokines, FeNO, and additional serum markers of IL-33 and IL-4R activity will be performed, as detailed in the Schedule of Events shown in Table 1 below. Patients will be followed after BAC at scheduled visits until the end of study visit (day 293).
  • Informed consent may be obtained on a separate visit prior to the screening period.
  • Patients must sign a separate informed consent form (ICF) prior to collection of samples for DNA analysis. Patients who meet the inclusion/ exclusion criteria are eligible to enroll in the study regardless of whether they choose to participate in the genomics sub-study.
  • REGN3500 (or matching placebo) is administered as a single IV dose on day 1.
  • Dupilumab (or matching placebo) is administered SC in 2 injections on day 1 and in 1 injection on day 15.
  • Intravenous administration of study drug is performed prior to SC administration of study drug, with at least 1 hour between the IV and SC dosing.
  • ECG ECG is performed prior to, immediately (within 10 minutes) after the end of the IV infusion and 4 hours after the end of the SC injection of study drug.
  • All blood samples for PK and ADA are collected prior to initiation of study drug administration.
  • samples for safety laboratory, ADA, and biomarkers are collected prior to the start of the study drug administration (fasted).
  • In-clinic spirometry is performed in accordance with American Thoracic Society criteria standards of acceptability quality control with a standard spirometer (Miller et al. Standardisation of spirometry. Eur Respir J. 2005. 26:319-338).
  • FeNO should be conducted following a fast of at least 1 hour.
  • FeNO measurement must be performed before spirometry and methacholine challenge.
  • FeNO measurement must be performed before sputum induction.
  • sputum is measured before BAC is performed, and at 8 hours and 23 hours post-BAC.
  • Days in which sputum may be collected are shown in gray.
  • Pre-allergen screening sputum samples are collected at least 48 hours after the methacholine challenge performed at visit 1, and 72 hours prior to the BAC performed at visit 3. Other pre-allergen sputum samples are collected at least 72 hours prior to the BAC. If a pre- BAC sample cannot be collected on a first attempt, a repeat attempt may be performed at least 72 hours later. j2.
  • RNA sample should be collected on day 1. However, DNA may be collected at any visit during the course of the trial.
  • Whole blood for extraction of RNA samples should only be collected at the indicated study visits prior to BAC, spirometry, or induced sputum procedures on the indicated day. Whole blood for RNA samples should be collected prior to drug administration on study drug treatment days.
  • Biomarker samples are collected at the specified times during the study, with the following notes: nl.
  • Biomarkers and total IL-33 samples on BAC days should be collected pre-BAC and at 8 hours post-BAC (after collection of the 8 hour post- BAC sputum sample). n2. Biomarkers samples collected on the day following BAC (visit 4, visit 9, and visit 13) should be collected 24 hours post-BAC, after collection of the sputum sample.
  • Patients are given an inhaled BAC with HDM similar to that in study Part 1 after receiving the seventh of 8 doses of fluticasone propionate.
  • Induced sputum samples are collected 8 hours, and 24 hours after the HDM challenge on day 4.
  • Measurements of pulmonary function as assessed by spirometry, sputum mRNA, sputum cytokines, FeNO, and additional serum markers of IL-33 and IL-4R activity are performed, similarly to those described in Part 1. If in the event that a patient is unable to return on day 4, the patient may continue dosing with fluticasone propionate twice per day for up to 2 additional days. When the patient returns to the clinic they follow day 4 procedures.
  • Part 2 of this study runs in parallel with Part 1. Patients who complete Part 2 may participate in Part 1 after a washout period of at least 21 days.
  • Informed consent may be obtained on a separate visit prior to the screening period.
  • Patients must sign a separate informed consent form (ICF) prior to collection of samples for DNA analysis. Patients who meet the inclusion/ exclusion criteria are eligible to enroll in the study regardless of whether they choose to participate in the genomics sub-study.
  • ICF informed consent form
  • Patients begin self-administration of inhaled fluticasone propionate twice daily for 4 consecutive days, beginning on day 1. Patients receive fluticasone propionate in clinic on day 1 and at home on days 2 and 3. On day 4, patients receive fluticasone propionate (in the clinic) prior to BAC procedures and patient self-administers the second dose that day after sputum induction (either in the clinic or at home).
  • FeNO should be conducted following a fast of at least 1 hour.
  • hi. FeNO measurement must be performed before spirometry and methacholine challenge.
  • FeNO measurement must be performed before sputum induction.
  • FeNO is measured prior to BAC and at 8 hours and 23 hours post-BAC on BAC days.
  • FeNO measurement on day 1 should be pre-dose i. For the screening and treatment periods, all pre-BAC sputum samples must be collected 72 hours prior to the BAC.
  • pre-BAC induced sputum sample is collected at least 72 hours before the BAC. If a pre-BAC sample cannot be collected on a first attempt at screening, a repeat may be performed at least 72 hours later. On visit 3, sputum is collected at 8 hours after the challenge, and on the following day, approximately 24 hours after the BAC (visit 4).
  • pre-BAC Induced sputum samples
  • Biomarkers and total IL-33 samples on BAC days should be collected pre-BAC and 8 hours post-BAC, after the 8 hour post-BAC sputum sample was collected. m2. Biomarkers collected on the day following BAC should be collected 24 hours after BAC, after the collection of sputum sample
  • BAC Bronchial allergen challenge
  • REGN3500 a potential impact of REGN3500 and dupilumab on lung inflammation.
  • BAC is safe and well-tolerated in the patient population proposed for this study.
  • BAC because there is a risk of inducing severe, acute bronchoconstriction or anaphylaxis (Diamant et al. Inhaled allergen bronchoprovocation tests. J Allergy Clin Immunol. 2013. 132: 1045-1055 el046), BAC will not be performed on patients with severe or unstable asthma.
  • Demographic and baseline characteristics include standard demography (e.g., age, gender, race, ethnicity, weight, height), disease characteristics, including medical history and medication history for each patient, and biomarkers (total IL-33, sST2, calcitonin, and MMP12).
  • Enrollment includes up to 38 patients in the UK for the 2 parts of the study (approximately 32 patients for Part 1, and approximately 6 patients for Part 2).
  • EAR is defined as a fall in FEV1 of at least 20% from pre-challenge post diluent baseline values during the 30 minutes after inhaled BAC
  • LAR is defined by a fall from post diluent value of FEV1 of 215% on at least 3 occasions, 2 of which must be consecutive, between 3 to 8 hours following administration of the final concentration of allergen.
  • [00356] Has a history of life-threatening asthma, defined as an asthma episode that required intubation and/or was associated with hypercapnia, respiratory arrest and/or hypoxic seizures. 2. Has been hospitalized or has attended the emergency room for asthma in the 12 months prior to screening. 3. Has had asthma exacerbations or respiratory tract infections within 4 weeks prior to screening or prior to administration of initial dose of study drug. 4. Has diagnosis of other airway/ pulmonary diseases such as Chronic Obstructive Pulmonary Disease (COPD) as defined by the Global Initiative for Chronic Obstructive Lung Disease (GOLD) guidelines (updated 2013), a history of cystic fibrosis, bronchiectasis or alpha- 1 antitrypsin deficiency or restrictive lung disease. 5.
  • COPD Chronic Obstructive Pulmonary Disease
  • GOLD Global Initiative for Chronic Obstructive Lung Disease
  • patient After screening BAC, patient has a decline in FEV1 below 25% of their predicted and/or FEV1 ⁇ 1.4L or has a symptomatic drop in FEV1 associated with shortness of breath unresolved with bronchodilators within a reasonable timeframe (approximately 30 minutes) after allergen exposure.
  • 7. Has a history of severe allergies or history of an anaphylactic reaction or significant intolerability to prescription or non-prescription drugs or food.
  • short acting b-agonists e.g., leukotrienes receptor antagonist, muscarinic antagonist, terbutaline, theophylline beta blockers, digoxin, NSAIDs, MAO inhibitors or tricyclic antidepressants
  • b-agonists e.g., leukotrienes receptor antagonist, muscarinic antagonist, terbutaline, theophylline beta blockers, digoxin, NSAIDs, MAO inhibitors or tricyclic antidepressants
  • For approved drugs or investigational biologic agents e.g., anti-IgE or anti-IL5
  • eGFR estimated glomerular filtration rate
  • Patients with a history of uncomplicated nephrolithiasis (kidney stones) may be enrolled in the study at the discretion of the investigator. 18.
  • Highly effective contraceptive measures include stable use of oral contraceptives associated with inhibition of ovulation (such as contraceptives containing estrogen/progesterone or high dose progesterone) for 2 or more menstrual cycles prior to screening; intrauterine device; intrauterine hormone releasing system; bilateral tubal ligation; vasectomized partner; and or sexual abstinence. Contraception for male patients is not required.
  • ovulation such as contraceptives containing estrogen/progesterone or high dose progesterone
  • Contraception for male patients is not required.
  • REGN3500 is supplied as a lyophilized powder. Placebo that matches REGN3500 (REGN3500-matching placebo) is prepared in the same formulation as REGN3500 but without the addition of protein (i.e., active substance, anti-IL-33 monoclonal antibody). Vials of REGN3500 or REGN3500-matching placebo are reconstituted with sterile water prior to infusion. REGN3500 and REGN3500-matching placebo are administered IV by the investigator, or other qualified study personnel on day 1.
  • protein i.e., active substance, anti-IL-33 monoclonal antibody
  • Dupilumab is supplied in pre-filled syringes, each of which can deliver 2 mL of a 150 mg/mL solution (300 mg) of study drug. Placebo that matches dupilumab (dupilumab-matching placebo) is prepared in the same formulation as dupilumab, without the addition of protein. Dupilumab or dupilumab-matching placebo is administered SC by the investigator, or other qualified study personnel, in 2 injections on day 1 (600 mg) and in 1 injection (300 mg) on day 15. All SC injections are in the abdomen.
  • REGN3500 REGN3500 IV 10 mg/kg plus 2 injections of dupilumab-matching placebo SC on day 1; one injection of dupilumab-matching placebo SC on day 15;
  • Dupilumab REGN3500-matching placebo for IV plus 2 injections of dupilumab SC 300 mg (600 mg total loading dose) on day 1; one injection of dupilumab SC 300 mg on day 15;
  • REGN3500 Plus Dupilumab Combination REGN3500 IV 10 mg/kg plus 2 injections of dupilumab SC 300 mg (600 mg total loading dose) on day 1; one injection dupilumab SC 300 mg on day 15; and Placebo: REGN3500-matching placebo IV plus 2 injections of dupilumab-matching placebo SC on day 1; one injection
  • Fluticasone propionate (250 ⁇ g/pufl) is supplied in metered dose inhalers and administered by inhalation of 500 ⁇ g (2 puffs of 250 ⁇ g) per dose twice daily on day 1 through day 4.
  • Another approximately 24 patients may be randomized 1 : 1 : 1 : 1 to receive REGN3500, dupilumab, REGN3500 plus dupilumab combination, or placebo similarly to the first 8 patients.
  • Part 2 of the study approximately 6 patients are enrolled and treated open-label with fluticasone propionate. Patients who complete Part 2 may participate in Part 1 after a washout period of at least 21 days.
  • Anti-drug antibody and drug concentration results are not communicated to the sites, and the sponsor operational team does not have access to results associated with patient identification until after the final database lock.
  • the bioanalytical analyst, bioanalytical team representative, and clinical pharmacology representative responsible for determining serum drug concentration levels, ADAs, and biomarkers is not blinded to the dosing information.
  • a medication numbering system is used to label blinded investigational study drug. Lists linking medication numbers with product lot numbers are maintained by the groups (or companies) responsible for study drug packaging. In order to maintain the blind, these lists are not accessible to individuals involved in the conduct of the study.
  • This automated system is also used to manage the expiration dating of the investigational study drugs, in accordance with the EMA Reflection paper on the use of interactive response technologies (IVRS) in clinical trials, with particular emphasis on the handling of expiration date (EMA/INS/GCP/600788/2011, Dec 2013).
  • IVRS interactive response technologies
  • Dupilumab drug labels will include the expiration dates. Expiration dates are not included on drug labels for REGN3500.
  • open-label study drug displays the product lot number and expiration date on the label.
  • Study drug will be stored at the site at a temperature of 2°C to 8°C.
  • REGN3500, dupilumab, and the matching placebo for each study drug are shipped at a temperature of 2°C to 8°C to the investigator or designee at regular intervals or as needed during the study.
  • all opened and unopened study drug are destroyed or returned to the sponsor or designee.
  • All drug accountability records must be kept current. The investigator must be able to account for all opened and unopened study drug. These records should contain the dates, quantity, and study medication that was: dispensed to each patient, returned from each patient (if applicable), and disposed of at the site or returned to the sponsor or designee. All accountability records must be made available for inspection by the sponsor and regulatory agency inspectors; photocopies must be provided to the sponsor at the conclusion of the study.
  • any treatment administered from the time of informed consent to the end of the treatment period is considered concomitant medication. This includes medications that were started before the study and are ongoing during the study. Any concomitant medications must be reviewed and approved by the Regeneron Medical Monitor. Information on concomitant medication for each patient is recorded at each study visit from screening through the end of study.
  • the following medications are permitted: short acting b-agonists; thyroid replacement therapy by patients who have been on stable doses for >6 months prior to screening; vitamins and calcium supplements; over-the-counter antihistamines and decongestants; paracetamol (care should be taken to adhere to all guidance related to paracetamol administration and to not exceed local maximally allowed daily doses); laxatives; antacids; and heat-killed vaccine.
  • Safety Procedures patient safety is monitored via AEs reported by the patients or observed by the Investigator and via clinical laboratory tests (e.g., biochemistry, hematology, and urinalysis), vital signs, and standard 12-lead ECG automatic reading. Clinically significant abnormalities (if any) are monitored until resolution or until clinically stable.
  • Vital Signs vital signs, including temperature, blood pressure, pulse, and respiration, are collected, after at least 5 minutes of rest, pre-dose at time points according to Table 1 and Table 2
  • Electrocardiograms should be performed before blood is drawn during visits requiring blood draws.
  • a standard 12-lead ECG is performed at the time points specified in Table 1 and Table 2.
  • Heart rate is recorded from the ventricular rate, and the PR, QRS, RR, and QT intervals are recorded.
  • the ECG strips or reports are retained with the source.
  • 12-lead ECGs are digitally recorded systematically after the patient has been in the supine position for at least 10 minutes.
  • the electrodes are positioned in the same location for each ECG recording throughout the study.
  • Each ECG consists of a 10-second recording of the 12 leads simultaneously, leading to a single 12 lead ECG (25 mm/s, 10 mm/mV) printout with evaluation (HR, PR, QRS, RR, QT intervals, and QTc) including date, time, initials and number of the patient, signature of the research physician, and at least 3 complexes for each lead.
  • the reading is used for immediate safety assessment.
  • the investigator’s medical opinion and ECG values are recorded in the eCRF.
  • HDM Skin Prick Tests at the screening visit, a standard skin prick test using HDM allergen is performed to confirm inclusion criteria. Following this, a serial skin prick test using diluted HDM solutions is performed to determine skin sensitivity. The skin sensitivity is used in determining the allergen dose regimen to be used during the screening BAC.
  • Methacholine Challenge at the screening visit, a methacholine challenge is performed to confirm inclusion criteria and determine the allergen dose regimen used during the screening BAC.
  • the methacholine challenge is performed according to ATS/ERS (1999) guidelines (Crapo RO, et al. Guidelines for methacholine and exercise challenge testing-1999. This official statement of the American Thoracic Society was adopted by the ATS Board of Directors, July 1999. Am J Respir Crit Care Med. 2000 Jan;161(l):309-29), using a 2-minute tidal breathing protocol.
  • Tests will include:
  • BUN Blood urea nitrogen
  • AST Carbon dioxide Aspartate aminotransferase
  • ALT Uric acid Calcium Alanine aminotransferase
  • CPK Creatine phosphokinase
  • FSH follicle-stimulating hormone
  • Patients are tested for follicle-stimulating hormone (FSH) levels (menopausal women only), and undergo serum and urine pregnancy testing (women only) at time points listed in Table 1 and Table 2.
  • Samples are collected for assessment of serum/plasma sST2, and total IL-33, calcitonin, MMP12, TARC, PARC, eotaxin-3.
  • Tests for HIV, HBsAg, HBcAb, and HCV, and blood test for TB are performed.
  • urine samples are collected for a drug screening.
  • Intact parathyroid hormone (iPTH) 25-hydroxy Vitamin D samples are collected in Part 1 (Table 1) and are not collected in study Part 2.
  • Samples for drug concentration are collected at time points listed in Table 1. Any unused samples may be used for exploratory biomarker research.
  • Anti-Drug Antibody Measurements and Samples samples for ADA assessments are collected at time points listed in Table 1. Results from any exploratory analyses are reported separately from the clinical study report. Unused samples collected for ADA analyses may be used for future biomedical research.
  • Pharmacodynamic Procedures include BAC, sputum induction, measurement of gene expression levels in sputum mRNA, in-clinic measures of FEV1, FeNO, and measures of circulating biomarkers.
  • Bronchial Allergen Challenge the BAC using HDM is performed, as per standard procedures leveraging the Cockcroft allergen calculation (Cockcroft et al. The links between allergen skin test sensitivity, airway responsiveness and airway response to allergen. Allergy. 2005 Jan;60(l):56-59) and as delineated in the study manual to confirm the presence of an early and late phase response at screening visits specified in Table 1 and Table 2.
  • Post-treatment BAC is performed utilizing the dose regimen calculated from the screening BAC.
  • the EAR is measured as the largest decrease in FEV1 within the first 120 minutes (30 minutes for inclusion at screening).
  • the LAR is measured as the decrease in FEV1 at 3 to 8 hours after allergen inhalation.
  • Sputum Induction sputum induction is performed at time points according to Table 1 and Table 2.
  • Hypertonic saline (4.5% NaCl) is nebulized and inhaled through the mouth, with the nose held closed with a clip, for 4 periods of 5 minutes.
  • Spirometry is performed approximately 7 minutes after each 5-minute period of induction as a safety procedure.
  • Sputum induction is generally well-tolerated, although some patients develop wheeze and dyspnea. Any airway constriction caused by sputum induction with hypertonic saline may be quickly reversed by treatment with an inhaled short-acting b2 agonist (Wong et al. Safety of one method of sputum induction in asthmatic subjects. Am J Respir Crit Care Med. 1997. 156:299-303.).
  • induced sputum samples are collected at time points according to Table 1 and Table 2. Sputum is processed into RNA and gene expression analyses are performed using either Taqman assays, RNAseq or Nanostring.
  • the genes studied are those believed to be relevant to the pathophysiology of asthma (Type 1 and Type 2 inflammation), target engagement, and mechanism of action of REGN3500, dupilumab, and/or REGN3500 plus dupilumab combination therapy.
  • the molecular signature for Type 1 inflammation may include the genes for IFN ⁇ , CXCL9, CXCL10, CXCL11, IL-8, MPO, and neutrophil elastase.
  • the molecular signature for Type 2 inflammation may include the genes for IL-4, IL-5, IL-13, IL-9, CCL17, CCL26, CCL13, and CCL11.
  • the list of genes studied may be altered or expanded as additional potentially relevant or novel biomarkers are discovered during the study.
  • Spirometry In-clinic spirometry is performed in accordance with American Thoracic Society criteria standards of acceptability quality control with a standard spirometer (Miller et al. Force. Standardisation of spirometry. Eur Respir J. 2005. 26:319-338.). During the study (screening and treatment, and post-treatment periods), patients are required to undergo in-clinic spirometry (FEV1) measurement at every scheduled study visit (Table 1 and Table 2).
  • FEV1 in-clinic spirometry
  • Fractional Exhaled Nitric Oxide measurement of FeNO level in asthmatic patients is used as a marker of airway inflammation. Fractional exhaled nitric oxide is analyzed from exhaled breath condensates. Patients are instructed to refrain from eating and drinking nitrate rich foods for at least 2 hours AND any food or drink for at least 1 hour prior to FeNO measurements and FeNO measurements should be made prior to any spirometry. During the study (screening, treatment, and post-treatment periods), patients are required to undergo FeNO measurement as specified (Table 1 and Table 2).
  • Circulating Biomarkers circulating biomarker samples are collected at time points according to Table 1 and Table 2. Biomarker measurements are performed in serum and plasma samples to determine effects on biomarkers of inflammatory diseases pathobiology or relevant physiological and pathogenic processes.
  • the biomarkers studied are ones believed to be relevant to the pathophysiology of diseases, target engagement, mechanism of action of REGN3500 (and/or combination therapy) and possible toxicities. Biomarkers studied in the blood may include but need not be limited to, IL-33, soluble ST2, calcitonin, and MMP12.
  • Future Biomedical Research the future biomedical research samples, as well as unused PK and ADA samples, will be stored for up to 15 years after the final date of the database lock.
  • the unused samples may be utilized for future biomedical research, including research on inflammatory diseases. After 15 years, any samples that remain will be destroyed.
  • Genomics Sub-study - Optional patients who agree to participate in the genomics sub- study are required to sign a separate genomics sub-study ICF before collection of the samples. Patients are not required to participate in the genomics sub-study in order to enroll in the primary study. Both DNA and whole blood RNA samples are covered in the genomics sub-study. Samples for DNA extraction should be collected on day 1/baseline (pre-dose), but may be collected at any study visit. Samples for whole blood RNA should be collected as specified in the study chart. DNA samples for the genomics sub-study are double-coded as defined by the International Council of Harmonisation (ICH) guideline El 5.
  • ICH International Council of Harmonisation
  • Sub-study samples will be stored for up to 15 years after the final date of the database lock and may be used for research purposes.
  • the purpose of the genomic analyses is to identify genomic associations with clinical or biomarker response, other clinical outcome measures and possible AEs.
  • associations between genomic variants and prognosis or progression of as well as other diseases may also be studied. These data may be used or combined with data collected from other studies to identify and validate genomic markers related to the study drug or diseases.
  • Analyses may include sequence determination or single nucleotide polymorphism studies of candidate genes and surrounding genomic regions. Other methods, including whole exome sequencing, whole genome sequencing, DNA copy number variation, and transcriptome sequencing may also be utilized. The list of methods may be expanded to include novel methodology that may be developed during the course of this study or sample storage period.
  • Induced sputum samples have been used in clinical studies of asthma to assess airway inflammation. Studies comparing sputum from asthmatics with sputum from normal controls have found elevated concentrations of IL-33 and ST2 (Hamzaoui et al. Induced sputum levels of IL-33 and soluble ST2 in young asthmatic children. J Asthma. 2013. 50:803-809 and Salter et al. IL-25 and IL-33 induce Type 2 inflammation in basophils from subjects with allergic asthma. Respir Res. 2016. 17:5), eotaxin, TARC (Heijink etal. Effect of ciclesonide treatment on allergen- induced changes in T cell regulation in asthma.
  • Sputum cytokines such as IL-4, IL-5, and IL-13 are elevated and associated with the presence of asthma symptoms and severity (Truyen et al. Evaluation of airway inflammation by quantitative Thl/Th2 cytokine mRNA measurement in sputum of asthma patients. Thorax. 2006. 61:202-208.)
  • BAC in mild asthmatic patients acutely increased levels of Type 2 cytokines, such as IL-13 and IL-5 by approximately 10X in the lung.
  • Treatment with inhaled corticosteroids significantly suppressed this BAC-mediated upregulation of protein and mRNA levels of Type 2 cytokines (Zuiker et al. Kinetics of TH2 biomarkers in sputum of asthmatics following inhaled allergen. Eur Clin Respir J. 2015. 2 and Zuiker et al. Sputum RNA signature in allergic asthmatics following allergen bronchoprovocation test. Eur Clin Respir J. 2016. 3:31324).
  • the endpoints in this study are designed to investigate the effect of REGN3500, dupilumab, and combined REGN3500 plus dupilumab treatment on Type 2 inflammatory gene expression.
  • sputum mRNA measurements are analyzed to assess a broader gene expression profile, which includes genes involved in type 1 and 2 inflammation and genes that reflect change in cellular content.
  • cytokines and chemokines may be measured in sputum induced after a BAC. Though the effect size of changes seen in previous studies have shown that measurement of mRNA gene signatures may be superior to that of protein signatures, this study collects samples for cytokine and chemokine protein evaluation as an exploratory endpoint. Cytokines and chemokines related to both the IL-33 and the IL4R pathways, including IL-13, IL- 5, tumor necrosis factor-alpha (TNFa), TARC, pulmonary and activation-regulated chemokine (PARC), and eotaxin-3, are expected to be elevated after a BAC. This increase in cytokines and chemokines is expected to be blunted by treatment with REGN3500 and/or dupilumab.
  • sputum eosinophils have been shown to increase in asthmatic patients who display a late phase response. Although an association of sputum eosinophils and FeNO has been reported, FeNO is not an eosinophil-specific marker and may be present in non-eosinophilic inflammation (Haidar et al. Mepolizumab and exacerbations of refractory eosinophilic asthma. N Engl J Med. 2009. 360:973-984.).
  • the study is powered for the primary endpoint, suppression of sputum IL-13, IL-5 and ST2 mRNA for an active treatment (rather than relative to placebo), not change in the LAR, which is historically the primary endpoint of BAC trials (typically ⁇ 20 patients per treatment group).
  • Six patients per treatment group provides >99% power at 2-sided 0.05 significance level to detect a change in IL-5 and IL-13 gene expression levels that is equivalent to the change observed with inhaled corticosteroids (maximum observed effect size of 3.7 based on treatment difference over placebo).
  • approximately 8 patients per treatment group may be enrolled in Part 1 of the study.
  • Efficacy endpoints will be analyzed using the full analysis set (FAS). For part 1 of the study, the FAS includes all randomized patients and is based on the treatment allocated (as randomized).
  • Safety Analysis Set the safety analysis set (SAF) includes all randomized patients who received at least 1 dose of study medication. Patients are be analyzed as-treated. All safety analyses are summarized based on the SAF.
  • Pharmacokinetic Analysis Set the PK analysis set includes all treated patients who received any study drug and who had at least 1 non-missing post-dose PK results following the administration of study drug.
  • ADA Anti-Drug Antibody
  • descriptive statistics include the following information: the number of patients reflected in the calculation (n), mean, median, standard deviation, Ql, Q3, minimum, and maximum. For categorical or ordinal data, frequencies and percentages are displayed for each category. [00409] For patient disposition, the following will be provided: the total number of screened patients: met the inclusion criteria regarding the target indication and signed the ICF; the total number of randomized patients: received a randomization number; the total number of patients in each analysis set; the total number of patients who discontinued the study, and the reasons for discontinuation; a listing of patients treated but not randomized, patients randomized but not treated, and patients randomized but not treated as randomized; and a listing of patients prematurely discontinued from treatment, along with reasons for discontinuation.
  • Safety Analysis treatment compliance/administration and all clinical safety variables is analyzed using the SAF.
  • the safety analysis is based on the SAF. This includes reported TEAEs and other safety information (i.e., clinical laboratory evaluations, vital signs, and 12-lead ECG results).
  • a summary of safety results is presented for each treatment group.
  • 3 observation periods are defined: the pretreatment period is defined as the time from signing the ICF to before the first dose of study drug.
  • the treatment period is defined as the day from first dose of study drug to the last dose of study drug + 7 days.
  • the posttreatment period is defined as the time after the last dose of study drug + 7 days.
  • Treatment-emergent adverse events TEAEs are defined as those that are not present at baseline or represent the exacerbation of a pre-existing condition during the on-treatment period.
  • Vital Signs vital signs (temperature, pulse, blood pressure, and respiration rate) are summarized by baseline and change from baseline to each scheduled assessment time with descriptive statistics.
  • Laboratory Tests laboratory test results are summarized by baseline and change from baseline to each scheduled assessment time with descriptive statistics. Number and percentage of patients with a potentially clinically significant value (PCSV) at any post-randomization time point are summarized for each clinical laboratory test. Shift tables based on baseline normal/abnormal and other tabular and graphical methods may be used to present the results for laboratory tests of interest.
  • PCSV clinically significant value
  • Treatment Exposure the duration of exposure during the study is presented by treatment group (placebo pooled) and calculated as: (date of last study drug injection - date of first drug injection) + 7. The number (%) of patients randomized and exposed to double-blind study drug are presented by specific time periods for each treatment group. In addition, duration of exposure during the study is summarized for each treatment group using number of patients, mean, SD, minimum, Ql, median, Q3, and maximum.
  • the treatment compliance is presented by specific ranges for each treatment group in Part 1 of the study.
  • Pharmacodynamic parameters (circulating markers and FeNO) of REGN3500, dupilumab and a combination of REGN3500 and dupilumab are summarized by measured values (SD, Ql, Q3, SEM, minimum, mean, median, maximum, and number of observations), change from baseline (SD, Ql, Q3, SEM, minimum, mean, median, maximum, and number of observations) and percentage change from baseline (SD, Ql, Q3, SEM, minimum, mean, median, maximum, and number of observations).
  • Correlation analyses between baseline concentration of IL-33 and other baseline biomarkers (calcitonin, sST2, and MMP12, TARC, PARC, eotaxin-3 and FeNO) is performed.
  • a scatter plot with Pearson or Spearman correlation is provided for each correlation analysis.
  • the start date by the study medication intake date will be imputed; otherwise, the missing day or month by the first day or the first month is imputed.
  • No imputations for missing laboratory data, ECG data, vital sign data, or physical examination data are made. Assessments taken outside of protocol allowable windows will be displayed according to the CRF assessment recorded by the investigator. Extra assessments (laboratory data or vital signs associated with non-protocol clinical visits or obtained in the course of investigating or managing AEs) are included in listings, but not summaries. If more than one laboratory value is available for a given visit, the first observation is used in summaries and all observations are presented in listings.
  • FIG. 5 presents data showing that treatment with REGN3500 reduced inflammation in a chronic house dust mite (HDM) model of lung inflammation.
  • Treatment with REGN3500 suppressed pro-inflammatory cytokines and chemokines.
  • These results were based on data showing levels of lung eosinophils and lung neutrophils in the HDM model, with and without anti-IL-33 treatment.
  • Other data presented includes a heat map of lung of cytokine panel showing levels of hIL-4, IL-5, IL-lb, TNFa, IFNg, GROa, and MCP-1. Alveolar SMA testing was also performed.
  • FIG. 8 An analysis of the bronchial allergen challenge molecular signature in sputum is shown in FIG. 8, which depicts the expression of various genes related to type 2 inflammation before allergen challenge, 8 hours after the allergen challenge, and 24 hours after the allergen challenge.
  • the top genes induced by the bronchial allergen challenge at screening were enriched for type 2 inflammation, including IL-4, IL-5, IL-13, IL-9, IL1RL1 (IL-33 receptor), Eot-3 (CCL26), TARC (CCL17), and FCER2.
  • FIG. 9 An analysis of the suppression by REGN3500 of various genes induced by the allergen challenge is shown in FIG. 9, which shows that various genes of type 2 inflammatory cytokines and chemokines that that were induced in the bronchial allergen challenge were suppressed by REGN3500, including IL-5, IL-13, Eot-3 (CCL26), and TARC (CCL17).
  • Other genes suppressed by REGN3500 and induced by the bronchial allergen challenge included CCL1 (a ligand for CCR8 that attracts activated Th2 type and Treg cells), CCL26, FCER2, SIGLEC8, and CCL17.
  • FIG. 10 The gene signature utilized to evaluate treatment effects on sputum eosinophils is presented in FIG. 10.
  • a set of 10 genes showed high correlation to eosinophils counts in sputum, both pre- and post-allergen challenge. These genes included ADARBl, ASB2, CLC, GLOD5, HDC, IL1RL1, PTPN7, SIGLEC8, SYNE1, and VSTM1. These genes are not exclusive to eosinophils, e.g., SIGLEC8 is expressed in eosinophils, basophils, and mast cells; HDC is expressed in mast cells; and VSTM1 is expressed in myeloid cells.
  • FIG. 11 shows that REGN3500 treatment suppressed eosinophil signature genes in sputum. Data is presented for ADARBl, ASB2, CLC, HDC, IL1RL1, PTPN7, SIGLEC8, SYNE1, and VSTM1. No anti-IL-33 (REGN3500) treatment-mediated effects were noted on neutrophil signature genes.
  • FIG. 12 shows that REGN3500 treatment suppressed type 2 inflammatory signature genes in sputum. Data is presented for IL-4, IL-13, CCL26, CCL13, CCL17, CCL11, POSTN, IL-5, and IL-9. FIG. 12 also shows that type 1 inflammatory signature genes were not induced by the allergen challenge.
  • FIGS. 8-12 show that the reduction in blood eosinophils was a consistent pharmacodynamic effect of anti-IL-33. No anti-IL-33 mediated reduction in neutrophils was observed. Further, no anti-IL-33 mediated reduction in other circulating type 2 inflammatory mediators was observed.
  • FIG. 14 shows that both dupilumab and REGN3500 were able to reduce eosinophil gene signature scores post bronchial allergen challenge.
  • the combination treatment of dupilumab and REGN3500 was the most effective treatment in reducing eosinophil gene signature scores post bronchial allergen challenge.
  • FIG. 14 depicts eosinophil gene signature scores across treatment arms. The arms include placebo, fluticasone, dupilumab, REGN3500, and the combination therapy of dupilumab and REGN3500. Results are presented pre and post bronchial allergen challenge.
  • FIG. 15 shows a lower decrease of type 2 signature scores in the REGN3500 treatment arm than the fluticasone treatment arm.
  • FIG. 15 depicts type 2 signature scores across the treatment arms.
  • the arms include placebo, fluticasone, dupilumab, REGN3500, and the combination therapy of dupilumab and REGN3500. Results are presented pre- and post-bronchial allergen challenge.
  • FIG. 16 presents data to show the genes affected by the various treatment arms at 8 and 24 hours post bronchial allergen challenge.
  • FIG. 16 depicts genes effected by placebo, fluticasone, dupilumab, REGN3500, and the combination therapy of dupilumab and REGN3500. Results are presented at screening and at treatment which occurs post bronchial allergen challenge.
  • Genes tested include, from top to bottom, BC042385, AB209315, LOC100607117, BC035084, LOC145474, AX747853, TIMP1, NT5DC2, LOC541471, AREG, PTPN7, RETNDC3, XXYLT1, FAM159A, PTGDS, TESC, ITGB2-AS1, D0574721, CLDN9, LOC100132052, AGAP7, NBEAL2, NTNG2, FLJ45445, KCNH3, POU51P3, OUG1, KIF21B, HSPA7, GAPT, BX6485Q2, PRR52, P1K3R6, LTC4S, CLEC11A, TRABD2A, DLGAP3, VDR, DKFZp686M11215, SIGLEC12, BC016361, BC052769, and RHOH.
  • FIG. 17 shows, from top to bottom, that the top genes induced by the bronchial allergen challenge at 24 hours and suppressed by REGN3500 were ASAP1-IT1, AX747757, BC042385, PABPC1P2, AB209315, AX748268, TCEAL5, CCL17, CCL13, CCL26, CLC, CACNG8, GPR82, GATA1, PRSS33, FFAR3, LGALS12, ASB2, PTGDR2, SIGLEC8, IL13, IL5, PTGDS, and RD3.
  • FIG. 17 depicts genes effected by placebo, fluticasone, dupilumab, REGN3500, and the combination therapy of dupilumab and REGN3500. Results are presented at screening and at treatment which occurs post bronchial allergen challenge.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Pulmonology (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2020/066559 2019-12-23 2020-12-22 Methods for treating or preventing allergic asthma by administering an il-33 antagonist and/or an il-4r antagonist Ceased WO2021133776A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
CN202080096917.XA CN115151568A (zh) 2019-12-23 2020-12-22 用于通过施用il-33拮抗剂和/或il-4r拮抗剂以治疗或预防过敏性哮喘的方法
JP2022538719A JP2023508360A (ja) 2019-12-23 2020-12-22 Il-33アンタゴニストおよび/またはil-4rアンタゴニストを投与することによりアレルギー性喘息を治療するまたは予防するための方法
EP20842863.1A EP4081544A1 (en) 2019-12-23 2020-12-22 Methods for treating or preventing allergic asthma by administering an il-33 antagonist and/or an il-4r antagonist
AU2020415382A AU2020415382A1 (en) 2019-12-23 2020-12-22 Methods for treating or preventing allergic asthma by administering an IL-33 antagonist and/or an IL-4R antagonist
CA3162507A CA3162507A1 (en) 2019-12-23 2020-12-22 Methods for treating or preventing allergic asthma by administering an il-33 antagonist and/or an il-4r antagonist
KR1020227025216A KR20220119446A (ko) 2019-12-23 2020-12-22 Il-33 길항제 및/또는 il-4r 길항제를 투여하여 알레르기성 천식을 치료 또는 예방하는 방법
US17/786,226 US20230340101A1 (en) 2019-12-23 2020-12-22 Methods for treating or preventing allergic asthma by administering an il-33 antagonist and/or an il-4r antagonist
MX2022007958A MX2022007958A (es) 2019-12-23 2020-12-22 Metodos para tratar o prevenir el asma alergica mediante la administracion de un antagonista de il-33 y/o un antagonista de il-4r.
BR112022011388A BR112022011388A2 (pt) 2019-12-23 2020-12-22 Métodos para tratar ou prevenir asma alérgica administrando um antagonista de il-33 e/ou um antagonista de il-4r
IL294066A IL294066A (en) 2019-12-23 2022-06-19 Methods for treating or preventing allergic asthma by administering an il-33 antagonist and/or an il-4r antagonist
JP2025283256A JP2026068738A (ja) 2019-12-23 2025-12-26 Il-33アンタゴニストおよび/またはil-4rアンタゴニストを投与することによりアレルギー性喘息を治療するまたは予防するための方法

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201962952996P 2019-12-23 2019-12-23
US62/952,996 2019-12-23
US202062964970P 2020-01-23 2020-01-23
US62/964,970 2020-01-23

Publications (1)

Publication Number Publication Date
WO2021133776A1 true WO2021133776A1 (en) 2021-07-01

Family

ID=74191948

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/066559 Ceased WO2021133776A1 (en) 2019-12-23 2020-12-22 Methods for treating or preventing allergic asthma by administering an il-33 antagonist and/or an il-4r antagonist

Country Status (11)

Country Link
US (1) US20230340101A1 (enExample)
EP (1) EP4081544A1 (enExample)
JP (2) JP2023508360A (enExample)
KR (1) KR20220119446A (enExample)
CN (1) CN115151568A (enExample)
AU (1) AU2020415382A1 (enExample)
BR (1) BR112022011388A2 (enExample)
CA (1) CA3162507A1 (enExample)
IL (1) IL294066A (enExample)
MX (1) MX2022007958A (enExample)
WO (1) WO2021133776A1 (enExample)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025028942A1 (ko) * 2023-07-28 2025-02-06 재단법인 아산사회복지재단 혈액 단백체를 이용한 생물학적 제제에 대한 천식 치료 반응성 예측을 위한 바이오마커 및 이의 용도
WO2025088063A3 (en) * 2023-10-24 2025-06-05 Sanofi Systems and methods for monitoring a medicament dosing schedule

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR112022000740A2 (pt) 2019-07-16 2022-07-05 Sanofi Biotechnology Métodos para tratamento ou prevenção de asma por administração de um antagonista de il-4r
CA3236201A1 (en) * 2021-11-11 2023-05-19 Regeneron Pharmaceuticals, Inc. Treatment of lung disease based upon stratification of polygenic risk score for interleukin 33 (il-33)
CN117949666B (zh) * 2024-01-12 2025-07-15 首都医科大学附属北京同仁医院 一种预测或评估抗IL-4Rα单抗在治疗鼻黏膜2型炎症相关鼻病疗效的标志物、方法和应用

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6596541B2 (en) 2000-10-31 2003-07-22 Regeneron Pharmaceuticals, Inc. Methods of modifying eukaryotic cells
US6927044B2 (en) 1998-09-25 2005-08-09 Regeneron Pharmaceuticals, Inc. IL-1 receptor based cytokine traps
US7582298B2 (en) 2006-06-02 2009-09-01 Regeneron Pharmaceuticals, Inc. High affinity antibodies to human IL-6 receptor
US20120097565A1 (en) 2010-10-06 2012-04-26 Regeneron Pharmaceuticals, Inc. Stabilized Formulations Containing Anti-Interleukin-4 Receptor (IL-4R) Antibodies
US8178098B2 (en) 2001-04-03 2012-05-15 National Jewish Health Method to inhibit airway hyperresponsiveness using aerosolized T cell receptor antibodies
US20140271658A1 (en) * 2013-03-13 2014-09-18 Regeneron Pharmaceuticals, Inc. Anti-il-33 antibodies and uses thereof
WO2018102597A1 (en) * 2016-12-01 2018-06-07 Regeneron Pharmaceuticals, Inc. Methods of treating inflammatory conditions

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AR108263A1 (es) * 2016-05-03 2018-08-01 Bayer Pharma AG Procedimiento para la preparación de derivados de 1-fenilo-1,2,4-triazol sustituidos por 5-hidroxialquilo
HUE067888T2 (hu) * 2016-09-01 2024-11-28 Regeneron Pharma Módszerek az allergia megelõzésére vagy kezelésére egy IL-4R antagonista adagolásával
BR112022000740A2 (pt) * 2019-07-16 2022-07-05 Sanofi Biotechnology Métodos para tratamento ou prevenção de asma por administração de um antagonista de il-4r

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6927044B2 (en) 1998-09-25 2005-08-09 Regeneron Pharmaceuticals, Inc. IL-1 receptor based cytokine traps
US6596541B2 (en) 2000-10-31 2003-07-22 Regeneron Pharmaceuticals, Inc. Methods of modifying eukaryotic cells
US8178098B2 (en) 2001-04-03 2012-05-15 National Jewish Health Method to inhibit airway hyperresponsiveness using aerosolized T cell receptor antibodies
US7582298B2 (en) 2006-06-02 2009-09-01 Regeneron Pharmaceuticals, Inc. High affinity antibodies to human IL-6 receptor
US20120097565A1 (en) 2010-10-06 2012-04-26 Regeneron Pharmaceuticals, Inc. Stabilized Formulations Containing Anti-Interleukin-4 Receptor (IL-4R) Antibodies
US20140271658A1 (en) * 2013-03-13 2014-09-18 Regeneron Pharmaceuticals, Inc. Anti-il-33 antibodies and uses thereof
WO2018102597A1 (en) * 2016-12-01 2018-06-07 Regeneron Pharmaceuticals, Inc. Methods of treating inflammatory conditions

Non-Patent Citations (52)

* Cited by examiner, † Cited by third party
Title
AL-LAZIKANI ET AL., J MOL. BIOL., vol. 273, 1997, pages 927 - 948
ALWING ET AL., EUR. RESPIR. J., vol. 6, 1993, pages 1368 - 1370
ANGAL ET AL., MOLECULAR IMMUNOLOGY, vol. 30, 1993, pages 105
BESNARD ANNE-GAËLLE ET AL: "IL-33-activated dendritic cells are critical for allergic airway inflammation", EUROPEAN JOURNAL OF IMMUNOLOGY, vol. 41, no. 6, 25 May 2011 (2011-05-25), Weinheim, pages 1675 - 1686, XP055797251, ISSN: 0014-2980, DOI: 10.1002/eji.201041033 *
CAMPO ET AL., J. INVESTIG. ALLERGOL. CLIN. IMMUNOL., vol. 23, 2013, pages 76 - 88
CAYROL ET AL.: "IL-33: an alarmin cytokine with crucial roles in innate immunity, inflammation and allergy", CURR OPIN IMMUNOL, vol. 31, 2014, pages 31 - 37, XP055361950, DOI: 10.1016/j.coi.2014.09.004
COCKCROFT ET AL.: "The links between allergen skin test sensitivity, airway responsiveness and airway response to allergen", ALLERGY, vol. 60, no. 1, January 2005 (2005-01-01), pages 56 - 59
CRAPO RO ET AL.: "Guidelines for methacholine and exercise challenge testing-1999", AM J RESPIR CRIT CARE MED, vol. 161, no. 1, July 1999 (1999-07-01), pages 309 - 29
DHAMI ET AL., EUR. J. ALLERGY CLIN. IMMUNOL., vol. 72, no. 12, 2017, pages 1825 - 1848
DIAMANT ET AL.: "Inhaled allergen bronchoprovocation tests", J ALLERGY CLIN IMMUNOL, vol. 132, 2013, pages 1045 - 1055e1046
DJUKANOVIC ET AL., EUR. RESPIRE. J., vol. 37, 2002, pages 1S - 2S
ERIN ET AL.: "Optimized dialysis and protease inhibition of sputum dithiothreitol supernatants", AM J RESPIR CRIT CARE MED, vol. 177, 2008, pages 132 - 141
FAHY ET AL.: "Analysis of cellular and biochemical constituents of induced sputum after allergen challenge: a method for studying allergic airway inflammation", J ALLERGY CLIN IMMUNOL, vol. 93, 1994, pages 1031 - 1039
FAHY, NAT. REV. IMMUNOL., vol. 15, 2015, pages 57 - 65
FOO YEW LIEW ET AL: "Interleukin-33 in health and disease", NATURE REVIEWS IMMUNOLOGY, vol. 16, no. 11, 1 November 2016 (2016-11-01), GB, pages 676 - 689, XP055522116, ISSN: 1474-1733, DOI: 10.1038/nri.2016.95 *
FORCED EXPIRATORY, vol. 1
GOODSON, MEDICAL APPLICATIONS OF CONTROLLED RELEASE, vol. 2, 1984, pages 115 - 138
GOUGH ET AL., PEDIATR. ALLERGY IMMUNOL., vol. 26, 2015, pages 431 - 437
HALDAR ET AL.: "Mepolizumab and exacerbations of refractory eosinophilic asthma", N ENGL J MED, vol. 360, 2009, pages 973 - 984, XP055151419, DOI: 10.1056/NEJMoa0808991
HAMZAOUI ET AL.: "Induced sputum levels of IL-33 and soluble ST2 in young asthmatic children", J ASTHMA, vol. 50, 2013, pages 803 - 809
HANSEL ET AL.: "The allergen challenge", CLIN EXP ALLERGY, vol. 32, 2002, pages 162 - 167
HEIJINK ET AL.: "Effect of ciclesonide treatment on allergen-induced changes in T cell regulation in asthma", INT ARCH ALLERGY IMMUNOL, vol. 145, 2008, pages 111 - 121
HO JEONG NA ET AL: "IL-33 enhances Siglec-8 mediated apoptosis of human eosinophils", CYTOKINE, ACADEMIC PRESS LTD, PHILADELPHIA, PA, US, vol. 57, no. 1, 17 October 2011 (2011-10-17), pages 169 - 174, XP028345241, ISSN: 1043-4666, [retrieved on 20111022], DOI: 10.1016/J.CYTO.2011.10.007 *
HOPKINS ET AL., CLIN. OTOLARYNGOL., vol. 34, 2009, pages 447 - 454
HUANG ET AL.: "IL-13 expression at the sites of allergen challenge in patients with asthma", J IMMUNOL, vol. 155, 1995, pages 2688 - 2694
INMAN ET AL.: "Dose-dependent effects of inhaled mometasone furoate on airway function and inflammation after allergen inhalation challenge", AM J RESPIR CRIT CARE MED, vol. 164, 2001, pages 569 - 574
JIA ET AL., J. ALLERGY CLIN. IMMUNOL., vol. 130, 2012, pages 647
LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533
LEE HEA YON ET AL: "Blockade of IL-33/ST2 ameliorates airway inflammation in a murine model of allergic asthma", EXPERIMENTAL LUNG RESEARCH, INFORMA HEALTHCARE, vol. 40, no. 2, 1 March 2014 (2014-03-01), pages 66 - 76, XP009188134, ISSN: 1521-0499 *
LILLY ET AL., J. ALLERGY CLIN. IMMUNOL., vol. 104, 1999, pages 786 - 790
LIU X ET AL: "Anti-IL-33 antibody treatment inhibits airway inflammation in a murine model of allergic asthma", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, ELSEVIER, AMSTERDAM NL, vol. 386, no. 1, 14 August 2009 (2009-08-14), pages 181 - 185, XP026467441, ISSN: 0006-291X, [retrieved on 20090607], DOI: 10.1016/J.BBRC.2009.06.008 *
MARECHAL ET AL., ANTICANCER RES, vol. 8, 1988, pages 677 - 680
MARTIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 9268 - 9272
MILLER ET AL.: "Force. Standardisation of spirometry", EUR RESPIR J, vol. 26, 2005, pages 319 - 338
MILLER ET AL.: "Standardisation of spirometry", EUR RESPIR J, vol. 26, 2005, pages 319 - 338
MORDENTI ET AL., PHARMACEUT. RES., vol. 5, 1991, pages 1351
NATIONAL HEART, BLOOD AND LUNG INSTITUTE, EXPERT PANEL REPORT 3: GUIDELINES FOR THE DIAGNOSIS AND MANAGEMENT OF ASTHMA, 28 August 2007 (2007-08-28)
PARK ET AL.: "Interleukin-13 and interleukin-5 in induced sputum of eosinophilic bronchitis: comparison with asthma", CHEST, vol. 128, 2005, pages 1921 - 1927
PETERS, M.C.Z.K. MEKONNENS. YUANN.R. BHAKTAP.G. WOODRUFFJ.V. FAHY: "Measures of gene expression in sputum cells can identify TH2-high and TH2-low subtypes of asthma", J ALLERGY CLIN IMMUNOL, vol. 133, 2014, pages 388 - 394
PORSBJERG ET AL.: "IL-33 is related to innate immune activation and sensitization to HDM in mild steroid-free asthma", CLIN EXP ALLERGY, vol. 46, 2016, pages 564 - 574
POWELL ET AL.: "Compendium of excipients for parenteral formulations'' PDA", J. PHARM. SCI. TECHNOL., vol. 52, 1998, pages 238 - 311, XP009119027
RAVENSBERG ET AL.: "Validated safety predictions of airway responses to house dust mite in asthma", CLIN EXP ALLERGY, vol. 37, 2007, pages 100 - 107
SALTER ET AL.: "IL-25 and IL-33 induce Type 2 inflammation in basophils from subjects with allergic asthma", RESPIR RES, vol. 17, 2016, pages 5
SEKIYA ET AL.: "Increased levels of a TH2-type CC chemokine thymus and activation-regulated chemokine (TARC) in serum and induced sputum of asthmatics", ALLERGY, vol. 57, 2002, pages 173 - 177
TANG ET AL., EUR. RESPIR. J., vol. 35, 2010, pages 757 - 760
TAYLOR ET AL., NUCL. ACIDS RES., vol. 20, 1992, pages 6287 - 6295
TRUYEN ET AL.: "Evaluation of airway inflammation by quantitative Thl/Th2 cytokine mRNA measurement in sputum of asthma patients", THORAX, vol. 61, 2006, pages 202 - 208
WENZEL, CLIN EXP ALLERGY, vol. 42, 2012, pages 650 - 8
WONG ET AL.: "Safety of one method of sputum induction in asthmatic subjects", AM J RESPIR CRIT CARE MED, vol. 156, 1997, pages 299 - 303
WU ET AL., J. BIOL. CHEM., vol. 262, 1987, pages 4429 - 4432
ZUIKER ET AL.: "Kinetics of TH2 biomarkers in sputum of asthmatics following inhaled allergen", EUR CLIN RESPIR J, vol. 2, 2015
ZUIKER ET AL.: "Sputum RNA signature in allergic asthmatics following allergen bronchoprovocation test", EUR CLIN RESPIR J, vol. 3, 2016, pages 31324

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025028942A1 (ko) * 2023-07-28 2025-02-06 재단법인 아산사회복지재단 혈액 단백체를 이용한 생물학적 제제에 대한 천식 치료 반응성 예측을 위한 바이오마커 및 이의 용도
WO2025088063A3 (en) * 2023-10-24 2025-06-05 Sanofi Systems and methods for monitoring a medicament dosing schedule

Also Published As

Publication number Publication date
MX2022007958A (es) 2022-10-07
CN115151568A (zh) 2022-10-04
JP2026068738A (ja) 2026-04-22
BR112022011388A2 (pt) 2022-08-30
AU2020415382A1 (en) 2022-08-18
CA3162507A1 (en) 2021-07-01
EP4081544A1 (en) 2022-11-02
JP2023508360A (ja) 2023-03-02
KR20220119446A (ko) 2022-08-29
IL294066A (en) 2022-08-01
US20230340101A1 (en) 2023-10-26

Similar Documents

Publication Publication Date Title
US20260055198A1 (en) Methods for treating or preventing asthma by administering an il-4r antagonist
US20230340101A1 (en) Methods for treating or preventing allergic asthma by administering an il-33 antagonist and/or an il-4r antagonist
AU2020266593B2 (en) Methods for treating or preventing asthma by administering an IL-33 antagonist
JP2017507139A (ja) Il−4r拮抗薬の投与により喘息を処置または予防するための方法
US20220169739A1 (en) Methods for treating asthma in pediatric subjects by administering an il-4r antagonist
JP2025164767A (ja) Il-33アンタゴニストを投与することによりcopdを治療するための方法
EA050548B1 (ru) Способы лечения или предупреждения аллергической астмы посредством введения антагониста il-33 и/или антагониста il-4r
US20250388685A1 (en) Methods for treating chronic rhinosinusitis without nasal polyps by administering an il-4r antagonist
RU2838119C2 (ru) Способы лечения или предупреждения астмы посредством введения антагониста il-33
JP6923594B2 (ja) Il−4rアンタゴニストを投与することにより喘息を処置又は予防するための方法
EA052377B1 (ru) Применение антитела, которое специфически связывает il-33, для лечения copd
IL301777A (en) Methods for treating asthma in pediatric subjects by administering an il-4r antagonist

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20842863

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3162507

Country of ref document: CA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022011388

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2022538719

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20227025216

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: DZP2022000509

Country of ref document: DZ

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020842863

Country of ref document: EP

Effective date: 20220725

ENP Entry into the national phase

Ref document number: 2020415382

Country of ref document: AU

Date of ref document: 20201222

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112022011388

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20220609

WWE Wipo information: entry into national phase

Ref document number: 522433119

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 522433119

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 522433119

Country of ref document: SA

WWR Wipo information: refused in national office

Ref document number: 522433119

Country of ref document: SA