WO2021119467A1 - Compositions and methods for treating and preventing influenza - Google Patents

Compositions and methods for treating and preventing influenza Download PDF

Info

Publication number
WO2021119467A1
WO2021119467A1 PCT/US2020/064573 US2020064573W WO2021119467A1 WO 2021119467 A1 WO2021119467 A1 WO 2021119467A1 US 2020064573 W US2020064573 W US 2020064573W WO 2021119467 A1 WO2021119467 A1 WO 2021119467A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
antibody molecule
acid sequence
molecule comprises
cdrs
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/064573
Other languages
English (en)
French (fr)
Inventor
Karthik Viswanathan
Brian Booth
Boopathy Ramakrishnan
Andrew M. WOLLACOTT
Gregory Babcock
Zachary Shriver
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Visterra Inc
Original Assignee
Visterra Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Visterra Inc filed Critical Visterra Inc
Priority to IL293804A priority Critical patent/IL293804A/en
Priority to KR1020227023210A priority patent/KR20220113749A/ko
Priority to AU2020403133A priority patent/AU2020403133A1/en
Priority to CA3164230A priority patent/CA3164230A1/en
Priority to JP2022535124A priority patent/JP2023506156A/ja
Priority to BR112022011350A priority patent/BR112022011350A2/pt
Priority to US17/783,966 priority patent/US20230257449A1/en
Priority to CN202080096260.7A priority patent/CN115551885A/zh
Priority to MX2022007207A priority patent/MX2022007207A/es
Priority to EP20829493.4A priority patent/EP4073107A1/en
Publication of WO2021119467A1 publication Critical patent/WO2021119467A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/108Orthomyxoviridae (F), e.g. influenza virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/16Antivirals for RNA viruses for influenza or rhinoviruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • Influenza Said ASCII copy, created on December 10, 2020, is named P2029-7033WO_SL.txt and is 434,364 bytes in size.
  • BACKGROUND Influenza is a common seasonal virus which can be deadly. It is a highly mutable virus resulting in continually emerging new strains. Influenza results in about 35 million infections, about 400,000 hospitalizations, and about 49,000 deaths each season/year in the United States. Globally, there are about 5 million severe diseases and about 500,000 deaths relating to influenza each season/year. Influenza, particularly influenza A, caused global pandemics in 1918, 1957, 1968, and 2009, including about 50 million deaths in 1918 (Lambert and Fauci, N Engl J Med.2010; 363(21): 2036-2044).
  • HA human anti-hemagglutinin
  • binding agents e.g., antibody molecules, or preparations, or isolated preparations thereof, that bind hemagglutinin (HA) from influenza viruses.
  • a binding agent e.g., an antibody molecule
  • a binding agent is broad spectrum, and binds more than one HA, e.g., an HA from one or both of Group 1 or Group 2 strains of influenza A viruses. Therefore, in some embodiments, a binding agent, e.g., an antibody molecule, featured in the disclosure can treat or prevent infections by a Group 1 influenza virus and a Group 2 influenza virus. In other embodiments, a binding agent, e.g., an antibody molecule, featured in the disclosure can treat or prevent an infection by an influenza A virus.
  • the binding agents e.g., antibody molecules
  • the structural similarity can be in terms of three-dimensional structure, or linear amino acid sequence, or both.
  • the antibody molecules described herein can be used, as a single agent or combination therapy, to prevent an influenza infection a subject at risk of having an influenza, or to treat influenza in subjects exhibiting severe symptoms and/or infected with drug resistant strains.
  • the disclosure features an anti-HA antibody molecule (e.g., an anti-HA broadly neutralizing antibody (bNAb)), e.g., for seasonal prophylaxis of influenza, having one or more (e.g., 2, 3, 4, 5, 6, or all) of the following properties: (i) targets an epitope that is conserved, e.g., across a plurality of influenza subtypes and/or strains (e.g., H1N1 and H3N2), and/or is constrained in its ability to mutate; (ii) binds to a broad panel of HAs, e.g., seasonal coverage across H1 and H3; (iii) has a Kd value less than or equal to about 1 nM, e.g., less than or equal to about 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nM; (iv) has an anti-HA
  • the antibody molecule targets an epitope that is conserved, e.g., across a plurality of influenza subtypes and/or strains (e.g., H1N1 and H3N2), and/or is constrained in its ability to mutate.
  • the antibody molecule binds to a broad panel of HAs, e.g., seasonal coverage across H1 and H3.
  • the antibody molecule has a Kd value less than or equal to about 1 nM, e.g., less than or equal to about 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nM.
  • the antibody molecule has an IC 50 value less than or equal to about 10 ⁇ g/mL (e.g., less than or equal to about 2 or 1 ⁇ g/mL) for neutralizing influenza virus (e.g., influenza A virus), e.g., one or more influenza strains, (e.g., an IC 50 value less than or equal to about 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 4, 5, 6, 7, 8, 9, or 10 ⁇ g/mL).
  • influenza virus e.g., influenza A virus
  • influenza strains e.g., an IC 50 value less than or equal to about 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3,
  • the antibody molecule has a half-life (e.g., circulating half-life) that confers season long protection or is at least 5, 10, 15, 20, 25, 30, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200 days, or more (e.g., 45 days or more), e.g., such that at a subcutaneous or intramuscular administered dose, the antibody molecule is present at the site of action at a concentration that is greater than the IC50 value for over about the entire season.
  • a half-life e.g., circulating half-life
  • the antibody molecule has a half-life (e.g., circulating half-life) that confers season long protection or is at least 5, 10, 15, 20, 25, 30, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200 days, or more (e.g., 45 days or more), e.g., such that at a subcutaneous or intramuscular administered dose, the antibody molecule is present at the site of action at a concentration that is greater than
  • the antibody molecule has a solubility that is greater than 100 mg/mL (e.g., greater than 120 mg/mL, 150 mg/mL, 200 mg/mL, or 250 mg/mL), e.g., to support subcutaneous or intramuscular administration.
  • the antibody molecule has mucosal transport and availability in upper respiratory tract (URT).
  • the antibody molecule is an anti-HA antibody molecule described herein.
  • the disclosure features an anti-HA antibody molecule comprising (a) one, two, or all of CDR1, CDR2, or CDR3 of a heavy chain variable region segment described herein (e.g., any of SEQ ID NOs: 1-39, 41-43, or 45-187); (b) one, two, or all of CDR1, CDR2, or CDR3 of a light chain variable region segment described herein (e.g., any of SEQ ID NOs: 188-298); or (c) both (a) and (b).
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of the heavy chain variable region segment and CDR1, CDR2, and CDR3 of the light chain variable region segment.
  • the antibody molecule comprises the heavy chain variable region segment, the light chain variable region segment, or both. In some embodiments, the antibody molecule comprises the heavy chain variable region segment and the light chain variable region segment. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a heavy chain variable region (VH) comprising the amino acid sequences of the corresponding VH CDRs of any one of VH1-VH184 (e.g., as described in Table 15, e.g., any of SEQ ID NOs: 299-318 for HCDR1, any of SEQ ID NOs: 319-348 for HCDR2, and/or any of SEQ ID NOs: 349-423 for HCDR3).
  • VH heavy chain variable region
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a light chain variable region (VL) comprising the amino acid sequences of the corresponding VL CDRs of any one of VK-1 through VK-111 (e.g., as described in Table 16, e.g., any of SEQ ID NOs: 424- 492 for LCDR1, any of SEQ ID NOs: 493-514 for HCDR2, and/or any of SEQ ID NOs: 515-525 for HCDR3).
  • VL light chain variable region
  • the antibody molecule comprises (i) CDR1, CDR2, and CDR3 of a heavy chain variable region comprising the amino acid sequences of the corresponding VH CDRs of any one of VH1-VH184, and (ii) CDR1, CDR2, and CDR3 of a light chain variable region comprising the amino acid sequences of the corresponding VL CDRs of any one of VK-1 through VK-111.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH1.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH2. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH3. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH4. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH5.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH6. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH7. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH8. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH9.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH10. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH11. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH12. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH13.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH14. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH15. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH16. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH17.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH18. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH19. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH20. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH21.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH22. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH23. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH24. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH25.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH26. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH27. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH28. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH29.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH30. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH31. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH32. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH33.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH34. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH35. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH36. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH37.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH38. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH39. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH40. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH41.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH42. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH43. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH44. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH45.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH46. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH47. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH48. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH49.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH50. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH51. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH52. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH53.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH54. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH55. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH56. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH57.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH58. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH59. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH60. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH61.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH62. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH63. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH64. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH65.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH66. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH67. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH68. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH69.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH70. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH71. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH72. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH73.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH74. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH75. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH76. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH77.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH78. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH79. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH80. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH81.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH82. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH83. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH84. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH85.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH86. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH87. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH88. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH89.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH90. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH91. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH92. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH93.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH94. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH95. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH96. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH97.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH98. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH99. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH100. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH101.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH102. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH103. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH104. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH105.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH106. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH107. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH108. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH109.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH110. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH111. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH112. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH113.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH114. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH115. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH116. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH117.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH118. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH119. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH1120. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH121.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH122. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH123. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH124. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH125.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH126. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH127. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH128. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH129.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH130. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH131. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH132. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH133.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH134. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH135. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH136. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH137.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH138. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH139. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH140. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH141.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH142. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH143. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH144. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH145.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH146. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH147. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH148. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH149.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH150. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH151. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH152. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH153.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH154. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH155. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH156. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH157.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH158. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH159. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH160. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH161.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH162. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH163. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH164. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH165.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH166. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH167. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH168. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH169.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH170. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH171. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH172. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH173.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH174. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH175. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH176. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH177.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH178. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH179. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH180. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH181.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH182. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH183. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH184. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-1.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-2. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-3. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-4. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-5.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-6. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-7. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-8. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-9.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-10. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-11. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-12. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-13.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-14. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-15. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-16. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-17.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-18. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-19. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-20. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-21.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-22. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-23. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-24. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-25.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-26. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-27. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-28. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-29.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-30. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-31. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-32. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-33.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-34. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-35. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-36. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-37.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-38. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-39. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-40. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-41.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-42. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-43. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-44. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-45.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-46. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-47. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-48. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-49.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-50. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-51. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-52. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-53.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-54. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-55. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-56. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-57.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-58. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-59. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-60. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-61.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-62. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-63. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-64. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-65.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-66. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-67. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-68. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-69.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-70. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-71. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-72. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-73.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-74. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-75. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-76. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-77.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-78. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-79. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-80. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-81.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-82. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-83. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-84. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-85.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-86. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-87. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-88. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-89.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-90. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-91. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-92. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-93.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-94. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-95. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-96. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-97.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-98. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-99. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-100. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-101.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-102. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-103. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-104. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-105.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-106. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-107. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-108. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-109.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-110. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-111. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH107. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH123.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH148. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH175. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH176. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-24.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-65. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-83. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-107. In some embodiments, the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-110.
  • the antibody molecule comprises CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-111. In some embodiments, the antibody molecule comprises: (i) the CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH123; and (ii) the CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-65.
  • the antibody molecule further comprises one or more Fc mutations, e.g., one, two, or all three mutations of FcMut215, as described herein (e.g., T307Q, Q311V, and/or A378V).
  • the antibody molecule comprises: (i) the CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH148; and (ii) the CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-65.
  • the antibody molecule further comprises one or more Fc mutations, e.g., one, two, or all three mutations of FcMut215, as described herein (e.g., T307Q, Q311V, and/or A378V).
  • the antibody molecule comprises: (i) the CDR1, CDR2, and CDR3 of a VH comprising the amino acid sequences of the corresponding VH CDRs of VH175; and (ii) the CDR1, CDR2, and CDR3 of a VL comprising the amino acid sequences of the corresponding VL CDRs of VK-65.
  • the antibody molecule further comprises one or more Fc mutations, e.g., one, two, or all three mutations of FcMut215, as described herein (e.g., T307Q, Q311V, and/or A378V).
  • the VH further comprises one or more (e.g., 2, 3, or 4) framework regions from a VH germline selected from VH1-69*04, VH3-30*01, VH3-30*02, VH3-30-03*03, and VH1-8*01, or as listed in Table 6.
  • the VL further comprises one or more (e.g., 2, 3, or 4) framework regions from a VL germline selected from V ⁇ 1-39*01, V ⁇ 4-1*01, and V ⁇ 3-15*01, or as listed in Table 6.
  • the VH further comprises one or more (e.g., 2, 3, or 4) framework regions from a VH germline comprising one or more mutations at Vernier residues.
  • the VL further comprises one or more (e.g., 2, 3, or 4) framework regions from a VL germline comprising one or more mutations at Vernier residues.
  • the antibody molecule comprises the VH CDRs, VL CDRs, and/or framework regions of any one antibody listed in Table 7, 13, or 14. In some embodiments, the antibody molecule comprises the VH CDRs and VL CDRs of any one antibody listed in Table 7, 13, or 14. In some embodiments, the antibody molecule comprises the VH CDRs and framework regions of any one antibody listed in Table 7, 13, or 14. In some embodiments, the antibody molecule comprises the VL CDRs and framework regions of any one antibody listed in Table 7, 13, or 14. In some embodiments, the antibody molecule comprises the VH CDRs, VL CDRs, and framework regions of any one antibody listed in Table 7, 13, or 14. In some embodiments, the antibody molecule comprises one or more VH CDR mutations listed in Table 9.
  • the antibody molecule comprises one or more VK CDR mutations listed in Table 10 and/or Table 11. In some embodiments, the antibody molecule comprises one or more LCDR (also referred to herein as VL CDR) mutations as listed in Table 12.
  • the anti-HA antibody molecule comprises (a) a heavy chain variable region (VH) comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of a heavy chain variable region described herein (e.g., any of SEQ ID NOs: 1-39, 41-43, or 45-187); (b) a light chain variable region (VL) comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of a light chain variable region described herein (e.g., any of SEQ ID NOs: 188-298); or (c) both (VH) comprising an amino
  • the antibody molecule comprises a heavy chain variable region (VH) comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of any one of VH1-VH184.
  • the antibody molecule comprises a light chain variable region (VL) comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of any one of VK-1 through VK-111.
  • the antibody molecule comprises (i) a heavy chain variable region comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of any one of VH1-VH184, and (ii) a light chain variable region comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of any one of VK-1 through VK-111.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH1. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH2. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH3.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH4. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH5. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH6.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH7. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH8. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH9.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH10. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH11. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH12.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH13. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH14. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH15.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH16. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH17. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH18.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH19. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH20. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH21.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH22. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH23. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH24.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH25. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH26. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH27.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH28. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH29. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH30.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH31. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH32. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH33.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH34. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH35. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH36.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH37. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH38. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH39.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH40. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH41. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH42.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH43. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH44. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH45.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH46. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH47. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH48.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH49. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH50. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH51.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH52. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH53. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH54.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH55. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH56. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH57.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH58. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH59. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH60.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH61. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH62. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH63.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH64. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH65. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH66.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH67. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH68. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH69.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH70. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH71. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH72.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH73. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH74. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH75.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH76. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH77. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH78.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH79. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH80. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH81.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH82. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH83. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH84.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH85. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH86. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH87.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH88. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH89. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH90.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH91. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH92. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH93.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH94. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH95. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH96.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH97. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH98. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH99.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH100. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH101. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH102.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH103. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH104. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH105.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH106. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH107. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH108.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH109. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH110. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH111.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH112. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH113. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH114.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH115. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH116. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH117.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH118. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH119. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH1120.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH121. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH122. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH123.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH124. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH125. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH126.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH127. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH128. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH129.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH130. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH131. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH132.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH133. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH134. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH135.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH136. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH137. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH138.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH139. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH140. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH141.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH142. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH143. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH144.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH145. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH146. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH147.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH148. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH149. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH150.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH151. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH152. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH153.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH154. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH155. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH156.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH157. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH158. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH159.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH160. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH161. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH162.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH163. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH164. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH165.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH166. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH167. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH168.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH169. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH170. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH171.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH172. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH173. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH174.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH175. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH176. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH177.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH178. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH179. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH180.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH181. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH182. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH183.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH184. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-1. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-2.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-3. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-4. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-5.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-6. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-7. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-8.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-9. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-10. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-11.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-12. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-13. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-14.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-15. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-16. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-17.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-18. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-19. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-20.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-21. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-22. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-23.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-24. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-25. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-26.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-27. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-28. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-29.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-30. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-31. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-32.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-33. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-34. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-35.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-36. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-37. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-38.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-39. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-40. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-41.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-42. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-43. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-44.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-45. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-46. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-47.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-48. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-49. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-50.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-51. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-52. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-53.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-54. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-55. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-56.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-57. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-58. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-59.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-60. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-61. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-62.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-63. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-64. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-65.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-66. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-67. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-68.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-69. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-70. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-71.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-72. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-73. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-74.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-75. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-76. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-77.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-78. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-79. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-80.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-81. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-82. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-83.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-84. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-85. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-86.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-87. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-88. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-89.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-90. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-91. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-92.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-93. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-94. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-95.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-96. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-97. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-98.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-99. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-100. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-101.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-102. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-103. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-104.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-105. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-106. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-107.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-108. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-109. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-110.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-111. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH107. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH123.
  • the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH148. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH175. In some embodiments, the antibody molecule comprises a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH176.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-24. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-65. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-83.
  • the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-107. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-110. In some embodiments, the antibody molecule comprises a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-111.
  • the antibody molecule comprises: (i) a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH123; and (ii) a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-65.
  • the antibody molecule further comprises one or more Fc mutations, e.g., one, two, or all three mutations of FcMut215, as described herein (e.g., T307Q, Q311V, and/or A378V).
  • the antibody molecule comprises: (i) a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH148; and (ii) a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-65.
  • the antibody molecule further comprises one or more Fc mutations, e.g., one, two, or all three mutations of FcMut215, as described herein (e.g., T307Q, Q311V, and/or A378V).
  • the antibody molecule comprises: (i) a VH comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VH175; and (ii) a VL comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of VK-65.
  • the antibody molecule further comprises one or more Fc mutations, e.g., one, two, or all three mutations of FcMut215, as described herein (e.g., T307Q, Q311V, and/or A378V).
  • the antibody molecule comprises an Fc region described herein, e.g., an Fc region comprising one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more) Fc mutations listed in Table 2.
  • the antibody molecule comprises an Fc region described herein, e.g., an Fc region comprising a combination of Fc mutations listed in a single row of Table 2.
  • the antibody molecule comprises one or more (e.g., 1, 2, or all 3 of) Fc mutations at positions selected from Q307, V311, and V378.
  • the antibody molecule comprises one or more (e.g., 1, 2, or all 3 of) Fc mutations selected from T307Q, Q311V, and A378V. In some embodiments, the antibody molecule comprises the Fc mutations T307Q, Q311V, and A378V. In some embodiments, the antibody molecule comprising a heavy chain variable region (VH) comprising one or more of CDR1, CDR2, and CDR3 of VH123, and a light chain variable region (VL) comprising one or more of CDR1, CDR2, and CDR3 of VK-65.
  • VH heavy chain variable region
  • VL light chain variable region
  • the antibody molecule comprising a heavy chain variable region (VH) comprising one or more of CDR1, CDR2, and CDR3 of VH123, a light chain variable region (VL) comprising one or more of CDR1, CDR2, and CDR3 of VK-65, and an Fc region described herein, e.g., an Fc region comprising FcMut215.
  • the antibody molecule comprises a heavy chain variable region (VH) with at least 90% sequence identity to VH123.
  • the antibody molecule comprises a light chain variable region (VL) with at least 90% sequence identity to VK-65.
  • the antibody molecule comprises an Fc region with at least 90% sequence identity to an Fc region described herein, e.g., an Fc region comprising FcMut215.
  • the antibody molecule comprises a heavy chain variable region (VH) with at least 90% sequence identity to VH123 and a light chain variable region (VL) with at least 90% sequence identity to VK-65.
  • the antibody molecule comprises a heavy chain variable region (VH) with at least 90% sequence identity to VH123, a light chain variable region (VL) with at least 90% sequence identity to VK-65, and an Fc region with at least 90% sequence identity to an Fc region described herein, e.g., an Fc region comprising FcMut215.
  • the antibody molecule comprises one or more Fc mutations that enhances the half-life of the antibody molecule (e.g., in circulation and/or in serum) relative to a corresponding antibody molecule comprising a wild-type Fc region.
  • the Fc mutations enhance the interaction between the Fc region and FcRn.
  • antibody molecule comprises one or more Fc mutations that enhances an effector function (e.g., ADCC and/or CDC).
  • the antibody molecule exhibits reduced polyreactivity compared to a reference antibody (e.g., FX-0-1-m3), e.g., according to an assay as described in Example 2.
  • the antibody molecule exhibits reduced self-interaction proclivity compared to a reference antibody (e.g., FX-0-1-m3), e.g., according to an assay as described in Example 2.
  • the disclosure features a composition (e.g., a pharmaceutical composition) comprising an anti-HA antibody molecule as described herein.
  • the pharmaceutical composition further comprises a pharmaceutically acceptable excipient or carrier.
  • the disclosure features a kit comprising an anti-HA antibody molecule as described herein.
  • the kit further comprises instructions for use of the anti-HA antibody molecule.
  • the kit further comprises instructions for administering the antibody molecule to a subject in need thereof (e.g., a subject having, or at risk of having, an influenza virus infection), e.g., according to a method as described herein.
  • the disclosure features a nucleic acid molecule encoding an anti-HA antibody molecule described herein, or a portion thereof.
  • the nucleic acid molecule encodes a VH of an antibody molecule described herein (or a functional fragment thereof) and/or a VL of an antibody molecule described herein (or a functional fragment thereof). In some embodiments, the nucleic acid molecule encodes a VH comprising the VH CDR sequences of an antibody molecule described herein (or a functional fragment thereof) and/or a VL comprising the VL CDR sequences of an antibody molecule described herein (or a functional fragment thereof). In an aspect, the disclosure features a vector comprising a nucleic acid molecule as described herein. In an aspect, the disclosure features a host cell comprising a nucleic acid molecule or vector as described herein.
  • the disclosure feature a method of making an anti-HA antibody molecule, the method comprising incubating a host cell as described herein (e.g., a host cell comprising a nucleic acid molecule or vector as described herein) under conditions suitable for production of the anti-HA antibody molecule.
  • a host cell as described herein (e.g., a host cell comprising a nucleic acid molecule or vector as described herein) under conditions suitable for production of the anti-HA antibody molecule.
  • the disclosure features a method of treating or preventing an influenza virus infection, or a symptom thereof, in a subject, comprising administering to the subject an effective amount of an anti-HA antibody molecule described herein.
  • the method prevents an influenza virus infection.
  • the subject is at risk of having an influenza infection.
  • the antibody molecule is administered before the subject is exposed to an influenza virus.
  • the antibody molecule the antibody molecule is administered subcutaneously or intramuscularly.
  • the method prevents an influenza virus infection for at least 5, 10, 15, 20, 25, 30, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200 days or more.
  • the antibody molecule is administered once during an influenza season.
  • the subject is a human subject (e.g., a human subject described herein).
  • the subject is prevented from being infected with an influenza virus for at least 1 week, 2 weeks, 3 weeks, 4 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, or more (e.g., season-long prevention).
  • the disclosure features an antibody molecule as described herein for use in treating or preventing an influenza virus infection, or a symptom thereof, in a subject (e.g., a subject described herein), e.g., in accordance with a method described herein.
  • the disclosure features use of an antibody molecule as described herein in treating or preventing an influenza virus infection, or a symptom thereof, in a subject (e.g., a subject described herein), e.g., in accordance with a method described herein.
  • the disclosure features use of an antibody molecule as described herein in the manufacture of a medicament for treating or preventing an influenza virus infection, or a symptom thereof, in a subject (e.g., a subject described herein), e.g., in accordance with a method described herein.
  • a subject e.g., a subject described herein
  • all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control.
  • FIG.1 depicts the binding and neutralization activity by antibody molecule FX-0-1-215 and an exemplary anti-HA antibody molecule described herein.
  • FIG.2 depicts the pharmacokinetics of FX-0-1-m3, FX-0-1-215, and an exemplary anti-HA antibody molecule described herein.
  • FIG.3 depicts the effector functions of FX-0-1-m3, FX-0-1-215, and an exemplary anti-HA antibody molecule described herein.
  • FIG.4A depicts the pharmacokinetics of FX-0-1-215 (control) and an exemplary anti-HA antibody (FX-122-4-215) that comprises FcMut215.
  • FIG.4B depicts the polyreactivity of FX-0-1-m3 (control) and an exemplary anti-HA antibody molecule (FX-122-4-m3) that comprises FcMut215.
  • FIG.5A depicts four potential aggregation sites with surface hydrophobic residues that were identified by in silico analysis.
  • FIG.5B depicts the convergence of the four sites with hydrophobic residues in the HCDR3 and LCDR1 regions of the antibody molecule.
  • FIG.6 depicts, in the top panel, a representation of FX-0-1-m3 binding to H3 HA. N76 of FX-0-1-m3 VH contacts N278 of HA1. Insertion of leucine at position 76 (bottom) is predicted to provide better hydrophobic surface complementarity.
  • FIG.7 depicts the percentage of IgG remaining in serum (normalized to 1-hour concentration) in Tg276 mice after a 2 mg/kg injection with the indicated exemplary anti-HA antibody molecules.
  • FIG.8 depicts SE-HPLC analysis of two lots of the exemplary anti-HA antibody molecule FX-0-0-m17 on a Phenomenex Bio-Sep S3000 column.
  • FIGS.9A-9C show expression and binding properties of exemplary anti-HA antibody molecules. All data is organized with heavy chain designs in each column (3–12) and light chain designs in each row (2–7).
  • FIG.9A shows small-scale expression of exemplary engineered antibodies in Expi293 cells. Data is reported as ⁇ g/mL of antibody in cell culture supernatant.
  • FIGS. 9B-9C show cell culture supernatant binding to H1 (A/CA/152007) (FIG.9B) and H3 (A/Brisbane/10/2007) (FIG.9C).
  • FIG.10 is a diagram showing a homology model of the HCDR3 loop of an exemplary anti- HA antibody molecule and the HA2 ⁇ -helix. Highlighted in red are the residues contributing to site I SAP and highlighted in dark blue are residues contributing to site II.
  • FIG.11 is a diagram showing a homology model of the LCDR1 loop of FX-0-1-m3 and the HA2 ⁇ -helix.
  • FIG.12 is a table showing the affinity of exemplary anti-HA antibodies having mutations of S74, K75, and N76 to hydrophobic or aromatic residues.
  • FIG.13 is a series of graphs showing the results of pharmacokinetic studies performed in Tg276 mice for the indicated exemplary anti-HA antibody molecules. Percent of IgG remaining in serum (normalized to 1-hour C max ) in Tg276 mice after a 2 mg/kg intravenous injection.
  • FIG.14 is a series of graphs showing abbreviated pharmacokinetic studies performed in Tg276 mice for the indicated exemplary anti-HA antibody molecules. Percent of IgG remaining in serum (normalized to 1- hour C max ) in Tg276 mice after a 2 mg/kg intravenous injection.
  • FIG.15 is a series of graphs showing that an exemplary anti-HA antibody molecule containing Q27D/S27aE affinity-enhancing mutations in LCDR1 exhibited enhanced properties.
  • FIG.16 is a series of graphs showing ADCC (left panel) and ADCP (right panel) activity of exemplary anti-HA antibodies against H3 infected MDCK London cells.
  • the disclosure is based, at least in part, on the design and synthesis of antibody molecules that can bind an epitope that is conserved across multiple hemagglutinin subtypes of influenza viruses (e.g., influenza A viruses).
  • the antibody molecules described herein are useful as broad- spectrum therapy against disease caused by at least one influenza A strain belonging to Group 1 and one influenza A strain belonging to Group 2 to neutralize infectivity of viruses belonging to both Group 1 and Group 2 (at least one subtype of each).
  • the antibody molecules described herein have broad activity against seasonal strains (H1N1 and H3N2 subtype), are available in the target organs for the entire season (e.g., at least about 5 to 6 months) at efficacious concentrations, and/or are able to be formulated at high concentrations (e.g., greater than about 100 mg/mL), to support the use of the antibody molecules as a single administration (e.g., intramuscular or subcutaneous administration) prophylactic against influenza.
  • a single administration e.g., intramuscular or subcutaneous administration
  • the antibody molecules described herein are effective for the prophylaxis of influenza.
  • the antibody molecules described herein can result in higher protection against severe infection than vaccination, such as protection from pandemic strains, and/or can confer protection for immunocompromised and other high-risk groups for which vaccines are less effective.
  • the high-risk populations include, but are not limited to, immunocompromised patients (e.g., cancer patients on a chemotherapy, transplant recipients, or HIV/AIDS patients), patients with chronic obstructive pulmonary disease (COPD) (e.g., mold-to-moderate, or severe COPD), patients with asthma (e.g., mild-to-moderate, or severe asthma), patients with diabetes, patients with a heart disease, patients with a chronic kidney disease, cancer patients not on a chemotherapy, or healthy elderly people (e.g., age 65 year or older).
  • COPD chronic obstructive pulmonary disease
  • asthma e.g., mild-to-moderate, or severe asthma
  • patients with diabetes e.g., patients with a heart disease, patients with a chronic kidney disease, cancer patients not on a chemotherapy, or healthy elderly people (e.g., age 65 year or older).
  • HA hemagglutinin
  • the antibody molecule targets a highly constrained region on the stem or stalk region of HA.
  • the conserved and constrained epitope can be associated with the structural and functional integrity, common across multiple influenza strains, and/or resistant to mutations.
  • the antibody molecule is a modified human IgG1 monoclonal antibody.
  • multiple mechanisms of action can allow for potent anti-viral activity, including distinct mechanisms from small molecule antivirals.
  • the antibody molecules described herein can inhibit viral/endosomal membrane fusion, have an antibody-dependent cellular cytotoxicity (ADCC) activity, and/or have an antibody-dependent cellular phagocytosis (ADCP) activity.
  • ADCC antibody-dependent cellular cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • the antibody molecule is a human IgG1 monoclonal antibody, e.g., modified to improve the inhibition of viral/endosomal membrane fusion, the ADCC activity, and/or the ADCP activity.
  • the antibody molecule has broad coverage across Groups 1 and 2 influenza A viruses.
  • the antibody molecule has picomolar (pM) binding affinity to HA.
  • the antibody molecule has an enhanced binding affinity for H3 HA protein.
  • the antibody molecules described herein can have a half-life that is suitable for prophylactic use. IgG can be internalized into vascular endothelial cells through pinocytosis.
  • IgG and albumin can bind to the neonatal Fc receptor (FcRn) in low pH environment of the endosome.
  • FcRn-bound IgG can be processed in one of two ways: recycling back to the apical cell membrane, or transcytosis from the apical to basolateral side. IgG not associated with FcRn is degraded by lysosomes.
  • the antibody molecules described herein can comprise an Fc variant, for example, an Fc variant having one or more (e.g., two, three, or all) of the following properties: (a) enhancing circulatory half-life when combined with different Fabs; (b) maintaining robust biophysical properties and favorable developability characteristics; (c) having effector functions that are comparable to wild-type Fc, or that in some cases are enhanced compared to wild-type Fc; or (d) enhancing half-life in non-human primates (NHP) by about 3-4 fold or more.
  • Fc variants are described, e.g., in PCT Application Publication No. WO2018/052556, U.S. Patent Application Publication No.
  • the Fc region, the Fab region, or both, of the antibody molecule is engineered for enhanced circulatory half-life and developability characteristics.
  • the antibody molecules described herein can be used for prevention of influenza infection in high-risk individuals.
  • a single subcutaneous dose can be effective for season- long protection.
  • the antibody molecule has equivalent safety and efficacy in neutralizing multiple influenza A strains (e.g., from both groups, or of multiple or all subtypes), e.g., as a result of retaining one or more (e.g., 2, 3, 4, 5, or all) of the CDR regions of a reference anti-HA antibody, e.g., FX-0-1-m3.
  • FX-0-1-m3 also known as Ab 044 is described, e.g., in PCT Application Publication Nos. WO 2013/170139 and WO 2017/083627, U.S.
  • the antibody molecules described herein target a highly networked, mutationally constrained epitope.
  • the antibody molecules described herein can be used for treatment of severe influenza.
  • the antibody molecules described herein comprise a modification in the Fab and Fc region for use in prophylaxis of influenza.
  • the antibody molecules, e.g., the anti-HA antibody molecules, described herein comprise mutations resulting in greater binding affinity and/or in vitro neutralization activity than a reference anti-HA antibody molecule, e.g., FX-0-1-m3.
  • the antibody molecules, e.g., the anti-HA antibody molecules, described herein comprise mutations resulting in improved half-life and/or effector functions, e.g., ADCC and ADCP activity, to a reference anti-HA antibody molecule, e.g., FX-0-1-m3.
  • an antibody molecule e.g., an anti-HA antibody molecule described herein, comprising a variable heavy chain region described herein, e.g., VH123, a variable light chain described herein, e.g., VK-65, and an Fc region described herein, e.g., FcMut215, has a binding affinity and/or in vitro neutralization capacity greater than a reference anti-HA antibody, e.g., FX-0-1-m3.
  • a reference anti-HA antibody e.g., FX-0-1-m3.
  • an antibody molecule e.g., an anti-HA antibody molecule described herein comprising a variable heavy chain described herein, e.g., VH123, a variable light chain described herein, e.g., VK-65, and an Fc region described herein, e.g., FcMut215
  • has improved half-life and/or effector function e.g., ADCC and/or ADCP activity, compare to a reference anti-HA antibody, e.g., FX-0-1-m3.
  • the antibody molecule has a circulating half-life of at least 30 days, e.g., at least 35, 40, 45, 50, 55, or 60 days.
  • the antibody molecule has a circulating half-life of at least 45 days.
  • antibody molecule refers to a polypeptide that comprises sufficient sequence from an immunoglobulin heavy chain variable region and/or sufficient sequence from an immunoglobulin light chain variable region, to provide antigen specific binding. It comprises full length antibodies as well as fragments thereof, e.g., Fab fragments, that support antigen binding.
  • an antibody molecule will comprise heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 sequence.
  • Antibody molecules include human, humanized, CDR-grafted antibodies and antigen binding fragments thereof.
  • an antibody molecule comprises a protein that comprises at least one immunoglobulin variable region segment, e.g., an amino acid sequence that provides an immunoglobulin variable domain or immunoglobulin variable domain sequence.
  • the VH or VL chain of the antibody molecule can further include all or part of a heavy or light chain constant region, to thereby form a heavy or light immunoglobulin chain, respectively.
  • the antibody molecule is a tetramer of two heavy immunoglobulin chains and two light immunoglobulin chains.
  • An antibody molecule can comprise one or both of a heavy (or light) chain immunoglobulin variable region segment.
  • the term “heavy (or light) chain immunoglobulin variable region segment,” refers to an entire heavy (or light) chain immunoglobulin variable region, or a fragment thereof, that is capable of binding antigen.
  • the ability of a heavy or light chain segment to bind antigen is measured with the segment paired with a light or heavy chain, respectively.
  • a heavy or light chain segment that is less than a full length variable region will, when paired with the appropriate chain, bind with an affinity that is at least 20, 30, 40, 50, 60, 70, 80, 90, or 95% of what is seen when the full length chain is paired with a light chain or heavy chain, respectively.
  • An immunoglobulin variable region segment may differ from a reference or consensus sequence.
  • an antibody molecule can comprise a heavy (H) chain variable region (abbreviated herein as VH), and a light (L) chain variable region (abbreviated herein as VL).
  • VH heavy chain variable region
  • L light chain variable region
  • an antibody comprises two heavy (H) chain variable regions and two light (L) chain variable regions or antibody binding fragments thereof.
  • the light chains of the immunoglobulin may be of type kappa or lambda.
  • the antibody molecule is glycosylated.
  • An antibody molecule can be functional for antibody dependent cytotoxicity and/or complement-mediated cytotoxicity, or may be non-functional for one or both of these activities.
  • An antibody molecule can be an intact antibody or an antigen-binding fragment thereof.
  • Antibody molecules include “antigen-binding fragments” of a full-length antibody, e.g., one or more fragments of a full-length antibody that retain the ability to specifically bind to an HA target of interest.
  • binding fragments encompassed within the term “antigen-binding fragment” of a full length antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab') or F(ab')2 fragment, a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the VH and CH1 domains; (iv) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR) that retains functionality.
  • a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
  • the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules known as single chain Fv (scFv).
  • scFv single chain Fv
  • Antibody molecules include diabodies.
  • an antibody refers to a polypeptide, e.g., a tetrameric or single chain polypeptide, comprising the structural and functional characteristics, particularly the antigen binding characteristics, of an immunoglobulin.
  • a human antibody comprises two identical light chains and two identical heavy chains. Each chain comprises a variable region.
  • the variable heavy (VH) and variable light (VL) regions can be further subdivided into regions of hypervariability, termed “complementarity determining regions” (“CDR”), interspersed with regions that are more conserved, termed “framework regions” (FR).
  • CDR complementarity determining regions
  • Human antibodies have three VH CDRs and three VL CDRs, separated by framework regions FR1-FR4.
  • Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the heavy and light immunoglobulin chains can be connected by disulfide bonds.
  • the heavy chain constant region typically comprises three constant domains, CH1, CH2 and CH3.
  • the light chain constant region typically comprises a CL domain.
  • the variable region of the heavy and light chains contains a binding domain that interacts with an antigen.
  • the constant regions of the antibodies typically mediate the binding of the antibody to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1q) of the classical complement system.
  • the term “immunoglobulin” comprises various broad classes of polypeptides that can be distinguished biochemically.
  • heavy chains are classified as gamma, mu, alpha, delta, or epsilon ( ⁇ , ⁇ , ⁇ , ⁇ , ⁇ ) with some subclasses among them (e.g., ⁇ 1- ⁇ 4). It is the nature of this chain that determines the “class” of the antibody as IgG, IgM, IgA IgD, or IgE, respectively.
  • the immunoglobulin subclasses e.g., IgG1, IgG2, IgG3, IgG4, IgA1, etc. are well characterized and are known to confer functional specialization.
  • Suitable antibody molecules include, but are not limited to, monoclonal antibodies, monospecific antibodies, polyclonal antibodies, polyspecific antibodies, human antibodies, primatized antibodies, chimeric antibodies, bi-specific antibodies, humanized antibodies, conjugated antibodies (i.e., antibodies conjugated or fused to other proteins, radiolabels, cytotoxins), Small Modular ImmunoPharmaceuticals (“SMIPs TM ”), single chain antibodies, cameloid antibodies, and antibody fragments.
  • an antibody molecule is a humanized antibody.
  • a humanized antibody refers to an immunoglobulin comprising a human framework region and one or more CDR's from a non-human, e.g., mouse or rat, immunoglobulin.
  • the immunoglobulin providing the CDR's is often referred to as the “donor” and the human immunoglobulin providing the framework often called the “acceptor,” though in some embodiments, no source or no process limitation is implied.
  • a humanized antibody comprises a humanized light chain and a humanized heavy chain immunoglobulin.
  • An “immunoglobulin domain” refers to a domain from the variable or constant domain of immunoglobulin molecules. Immunoglobulin domains typically contain two ⁇ -sheets formed of about seven ⁇ -strands, and a conserved disulphide bond (see, e.g., A. F. Williams and A. N. Barclay (1988) Ann. Rev. Immunol.6:381-405).
  • an “immunoglobulin variable domain sequence” refers to an amino acid sequence that can form the structure of an immunoglobulin variable domain.
  • the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain.
  • the sequence may omit one, two or more N- or C-terminal amino acids, internal amino acids, may include one or more insertions or additional terminal amino acids, or may include other alterations.
  • a polypeptide that comprises an immunoglobulin variable domain sequence can associate with another immunoglobulin variable domain sequence to form a target binding structure (or “antigen binding site”), e.g., a structure that interacts with the target antigen.
  • antibodies comprises intact monoclonal antibodies, polyclonal antibodies, single domain antibodies (e.g., shark single domain antibodies (e.g., IgNAR or fragments thereof)), multispecific antibodies (e.g., bi-specific antibodies) formed from at least two intact antibodies, and antibody fragments so long as they exhibit the desired biological activity.
  • Antibodies for use herein may be of any type (e.g., IgA, IgD, IgE, IgG, or IgM).
  • the antibody molecule can be derived from a mammal, e.g., a rodent, e.g., a mouse or rat, horse, pig, or goat.
  • the antibody molecule is produced using a recombinant cell.
  • the antibody molecule is a chimeric antibody, for example, from mouse, rat, horse, pig, or other species, bearing human constant and/or variable regions domains.
  • a binding agent as used herein, is an agent that bind, e.g., specifically binds, a target antigen, e.g., HA. Binding agents of the invention share sufficient structural relationship with anti-HA antibody molecules disclosed herein to support specific binding to HA, and in some embodiments, other functional properties of an anti-HA antibody molecule disclosed herein.
  • a binding agent will exhibit a binding affinity at of at least 10, 20, 30, 40, 50 , 60, 70, 80, or 90 % of an antibody molecule disclosed herein, e.g., an antibody molecule with which it shares, significant structural homology, e.g., CDR sequences.
  • Binding agents can be naturally occurring, e.g., as are some antibodies, or synthetic.
  • the binding agent is a polypeptide, e.g., an antibody molecule. While some binding agents are antibody molecules, other molecules, e.g., other polypeptides, can also function as binding agents.
  • Polypeptide binding agents can be monomeric or multimeric, e.g., dimeric, trimeric, or tetrameric and can be stabilized by intra- or interchain bonds, e.g., disulfide bonds. They can contain natural or non-naturally occurring amino acid residues.
  • binding agents are antibody molecules, or other polypeptides, that present one or more CDRs of antibody molecules disclosed herein or that otherwise mimic the structure of an antibody molecule disclosed herein. Binding agents can also comprise aptamers, nucleic acids or other molecular entities.
  • a binding agent can be developed in a variety of ways, e.g., by immunization, by rational design, screening of random structures, or a combination of those or other approaches.
  • a binding agent will act by making contact with substantially the same epitope as an antibody molecule disclosed herein, e.g., an antibody molecule with which it shares, significant structural homology, e.g., CDR sequences.
  • a binding agent can interact with amino acids, saccharides, or combinations thereof.
  • Polypeptides other than antibodies can be used as a scaffold to present sequence, e.g., one or more, or a complete set of heavy chain and/or light chain CDRs, disclosed herein.
  • Exemplary scaffolds include adnectin, zinc finger DNA-binding proteins.
  • a binding agent is or comprises a nucleic acid, e.g., DNA, RNA or mixtures thereof.
  • a binding agent e.g., a nucleic acid
  • a binding agent e.g., a nucleic acid, forms a structure that mimics the structure of an antibody molecule disclosed herein.
  • a broad-spectrum binding agent e.g., antibody molecule, as used herein, binds, a plurality of different HA molecules, and optionally neutralizes viruses comprising the different HA molecules. In an embodiment, it binds a first HA and binds a second HA from influenza A Group 1, and optionally neutralizes viruses comprising the first or second HA molecules. In an embodiment, it binds a first HA from an influenza A Group 1 virus and binds a second HA from an influenza A Group 2 virus, and optionally neutralizes viruses comprising the different HA molecules. In an embodiment, it binds, and in some embodiments neutralizes, at least two different clades or clusters of viruses, e.g., from different Groups.
  • a binding agent e.g., antibody molecule, binds, and in some embodiments, neutralizes: at least one strain from the Group 1 H1, e.g., H1a or H1b, cluster and at least one strain from the Group 2 H3 or H7 cluster.
  • binding agent e.g., antibody molecule
  • binding agent binds, and optionally neutralizes or mediate infection of particular hosts, e.g., avian, camel, canine, cat, civet, equine, human, mouse, swine, tiger, or other mammal or bird.
  • combination therapy refers to administration of a plurality of agents, e.g., wherein at least one binding agent, e.g., antibody molecule, disclosed herein is administered to a subject, e.g., a human subject. The introduction of the agents into the subject can be at different times.
  • an “escape mutant” is a mutated influenza strain that is resistant to neutralization by an anti-HA antibody molecule described herein.
  • an escape mutant is resistant to neutralization with a binding agent, e.g., antibody molecule, but its parent strain is neutralized by the binding agent, e.g., antibody molecule.
  • Resistance can be tested by various methods, including, but not limited to, genotypic testing (e.g., Sanger sequencing/nested PCR - baseline and last qPCR sample (Ct ⁇ 32)), and phenotypic testing (e.g., plaque reduction on primary sample, e.g., ViroSpotTM assay (e.g., virus titration – last post-baseline ⁇ 2 Log 10 TCID 50 /mL) or IC 50 single passage sample (e.g., antibody titration – last post-baseline ⁇ 1 Log10 TCID50/mL).
  • genotypic testing e.g., Sanger sequencing/nested PCR - baseline and last qPCR sample (Ct ⁇ 32)
  • phenotypic testing e.g., plaque reduction on primary sample, e.g., ViroSpotTM assay (e.g., virus titration – last post-baseline ⁇ 2 Log 10 TCID 50 /mL) or IC
  • pandemic influenza refers to a new viral strain that arises due to human adaptation of an influenza strain by mutation or by emergence of a strain by reassortment of different strains of influenza A.
  • the resulting pandemic strain is significantly different from previous strains and most people will have little or no pre-existing immunity. Symptoms and complications may be more severe and more frequent than those typical of seasonal influenza.
  • pandemic flu viruses include, e.g., the 2009 H1N1 ‘swine flu,’ the 1957-58 H2N2 ‘Asian flu’ and the 1968 H3N2 influenza strains.
  • an antibody molecule e.g., an antibody, or generally a polypeptide, obtained from a natural source
  • a polypeptide, e.g., an antibody molecule, that is isolated includes preparations of a polypeptide having less than about 30%, 20%, 10%, 5%, 2%, or 1% (by dry weight) of cellular materials and/or contaminating materials.
  • a preparation of binding agents comprises a plurality of molecules of a binding agent, e.g., antibody molecule, described herein.
  • the binding agent e.g., antibody molecule
  • binding agent is an antibody molecule which makes up at least 60, 70, 80, 90, 95, 98, 99, 99.5 or 99.9 %, of the preparation, or of the active ingredients, or polypeptide ingredients, or antibody molecules, of the preparation, by weight or number.
  • the binding agent is an antibody molecule and the preparation contains no more than 30, 20, 10, 5, 2, 1, or 0.5%, by weight or number, of a contaminant, e.g., a reactant, solvent, precursor or other species, from the source, or used in the preparation, of the antibody molecule, e.g., a species from a cell, reaction mixture, or other system used to produce the antibody molecule.
  • the term “preventing an influenza,” “prevent an influenza,” “preventing an influenza virus infection,” or “prevent an influenza virus infection” means that a subject (e.g., a human) is less likely to be infected by influenza if the subject receives the antibody molecule prior to (e.g., 1 day, 2 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 1 month, 2 months, 3 months, or more before) being exposed to an influenza virus.
  • a subject e.g., a human
  • seasonal influenza virus is a strain that is identical or closely related to strains that have been circulating in the human population in recent years and therefore most people are at least partially immune to it. Such a strain is not likely to cause severe disease.
  • Symptoms can include fever, cough, runny nose, and muscle pain, and in rare cases, death can result from complications, such as pneumonia. Outbreaks follow predictable seasonal patterns, annually, and usually in fall and winter and in temperate climates. Infection due to seasonal influenza virus is commonly referred to as the flu.
  • specific binding means that a binding agent, e.g., an antibody molecule, binds its antigen with a KD of equal to or less than 10 -5 . In some embodiments, the antibody binds its antigen with a KD of equal to or less than 10 -6 , 10 -7 , 10 -8 , 10 -9 , 10 -10 , 10 -11 , or 10 -12 .
  • the term “therapeutically effective amount” refers to an amount of a therapeutic agent, e.g., a binding agent, e.g., an antibody molecule, which results in a positive outcome for the subject. In some embodiments, it can be statistically correlated with therapeutic effect or benefit, e.g., the lessening or prevention of a manifestation of an effect or a symptom, when administered to a population of subjects. In some embodiments, it is an amount that also provides a preselected, or reasonable, benefit/risk ratio. In some embodiments, it is an amount effective to reduce the incidence and/or severity of and/or to delay onset of one or more features, symptoms, or characteristics of a disease, disorder, or condition.
  • a therapeutic agent e.g., a binding agent, e.g., an antibody molecule
  • a therapeutically effective amount is can be administered in a dosing regimen that may comprise one or multiple unit doses.
  • the term “treating an influenza,” “treat an influenza,” “treating an influenza virus infection,” or “treat an influenza virus infection” means that a subject (e.g., a human) who has been infected with an influenza virus and experiences symptoms of the influenza (e.g., the flu), will in some embodiments, suffer less severe symptoms and/or will recover faster when the antibody molecule is administered than if the antibody is never administered.
  • an assay to detect virus in the subject will detect less virus after effective treatment for the infection.
  • a diagnostic assay using an antibody molecule will detect less or no virus in a biological sample of a patient after administration of an antibody molecule for the effective treatment of the viral infection.
  • Other assays such as PCR (e.g., qPCR) can also be used to monitor treatment in a patient, to detect the presence, e.g., decreased presence (or absence) after treatment of viral infection in the patient.
  • Treatment can, e.g., partially or completely alleviate, ameliorate, relive, inhibit, reduce the severity of, and/or reduces incidence and optionally, delay onset of, one or more manifestations of the effects or symptoms, features, and/or causes of a particular disease, disorder, and/or condition (e.g., influenza).
  • a particular disease, disorder, and/or condition e.g., influenza
  • treatment is of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition.
  • treatment is of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition.
  • treatment is of a subject diagnosed as suffering from influenza.
  • sequence identity or “identity” between two sequences (the terms are used interchangeably herein) can be performed as follows.
  • the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
  • the optimal alignment is determined as the best score using the GAP program in the GCG software package with a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • Hemagglutinin (HA) Polypeptides and Influenza Influenza viruses are negative sense, single-stranded, segmented RNA envelope viruses. Two glycoproteins, a hemagglutinin (HA) polypeptide and a neuraminidase (NA) polypeptide, are displayed on the outer surface of the viral envelope.
  • Influenza A subtypes labeled according to an H number (for the type of hemagglutinin) and an N number (for the type of neuraminidase).
  • H antigens H1 to H17
  • N antigens N1 to N9
  • Influenza strains are identified by a nomenclature based on the number of the strain’s HA polypeptide and NA polypeptide subtypes, for example, H1N1, H1N2, H1N3, H1N4, H1N5, and the like.
  • HA is the major viral surface glycoprotein that mediates binding and entry of the virus into host cells and is a primary target of neutralizing antibody responses.
  • HA is a trimer of three identical monomers.
  • Each monomer is synthesized as a precursor, HA 0 , that is proteolytically processed into two disulfide-bonded polypeptide chains, HA 1 and HA 2 .
  • the ectodomain of this protein has (i) a globular head domain possessing receptor binding activity and major antigenic determinants, (ii) a hinge region, and (iii) a stem region where a sequence critical for fusion, the fusion peptide, is located.
  • the viral replication cycle is initiated when the virion attaches via its surface hemagglutinin proteins to sialylated glycan receptors on the host cell and enters the cell by endocytosis.
  • Influenza A hemagglutinin subtypes have been divided into two main groups and four smaller clades, and these are further divided into clusters. Group 1 influenza A strains are divided into 3 clades: (i) H8, H9 and H12 (“the H9 cluster”); (ii) H1, H2, H5, H6 and H17 (“the H1a cluster”); and (iii) H11, H13 and H16 (“the H1b cluster”).
  • Group 2 strains are divided into 2 clades: (i) H3, H4 and H14 (“the H3 cluster”); and (ii) H7, H10 and H15 (“the H7 cluster”).
  • the H1b and the H1a clusters are classified together as the H1 cluster.
  • the different HA subtypes do not necessarily share strong amino acid sequence identity, but their overall 3D structures are similar. Of the 17 HA polypeptide subtypes, only 3 (H1, H2 and H3) have adapted for human infection. These subtypes have in common an ability to bind alpha 2,6 sialylated glycans. In contrast, their avian counterparts preferentially bind to alpha 2,3 sialylated glycans.
  • HA polypeptides that have adapted to infect humans have been characterized by an ability to preferentially bind to ⁇ 2,6 sialylated glycans in comparison with their avian progenitors that preferentially bind to ⁇ 2,3 sialylated glycans (see, e.g., Skehel & Wiley, Annu Rev Biochem, 69:531, 2000; Rogers, & Paulson, Virology, 127:361, 1983; Rogers et al., Nature, 304:76, 1983; Sauter et al., Biochemistry, 31:9609, 1992 Further, HA polypeptides that mediate infection of humans preferentially bind to umbrella topology glycans over cone topology glycans (see, e.g., U.S.2011/0201547).
  • Mature HA polypeptides include three domains, (i) a globular domain (a.k.a., the head domain) consists mainly of the HA1 peptide and contains the receptor (sialylated glycoproteins)- binding region, (ii) a stalk domain (HA1 and HA2) where the membrane fusion peptide resides, and (iii) a transmembrane domain (HA2) that anchors hemagglutinin to the viral envelope.
  • a set of amino acids in the interface of the HA1 and HA2 peptides is highly conserved across all influenza subtypes.
  • HA1/HA2 membrane proximal region (MPER), including a canonical alpha-helix, is also highly conserved across influenza subtypes.
  • HA polypeptides interact with the surface of cells by binding to a glycoprotein receptor, known as the HA receptor. Binding of an HA polypeptide to an HA receptor is predominantly mediated by N-linked glycans on the HA receptors.
  • HA polypeptides on the surface of flu virus particles recognize sialylated glycans that are associated with HA receptors on the surface of the cellular host. Following replication of viral proteins and genome by the cellular machinery, new viral particles bud from the host to infect neighboring cells.
  • vaccines are administered to subjects, e.g., humans, to prevent the flu, e.g., to prevent infection or to minimize the effects of an infection with influenza virus.
  • Traditional vaccines contain a cocktail of antigens from various strains of influenza and are administered to humans to prevent the human from getting infected with the virus.
  • HA is the main target of influenza A- neutralizing antibodies, and HA undergoes continuous evolution driven by the selective pressure of the antibody response, which is primarily directed against the membrane-distal receptor-binding subdomain of the HA polypeptide.
  • the subject is protected only from strains that are identical to, or closely related to, the strains from which the antigens in the cocktail were derived.
  • the human is still most vulnerable to infection by other strains of the flu that were not included in the cocktail.
  • One of the advantages of the antibodies provided herein is their ability to bind an epitope of HA that is conserved across multiple strains of influenza A.
  • administration of an anti-HA antibody described herein will be more effective to protect an individual from infection from a broader spectrum of influenza (e.g., influenza A) and conditions associate thereof (e.g., secondary infections, e.g., secondary bacterial infections).
  • the antibodies are effective in treating a subject after infection has occurred.
  • Anti-HA Antibody Molecules Binding agents, and in particular, the antibody molecules described herein can bind to influenza A viruses from both Group 1 and Group 2.
  • the antibody molecules described herein can bind to an hemagglutinin (HA) polypeptide on at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11 strains from Group 1, and can also bind to an HA polypeptide on at least 1, 2, 3, 4, 5, or 6 strains from Group 2.
  • the antibody molecules described herein can bind to an HA polypeptide on an influenza strain from at least 1, 2 or 3 clades from Group 1, and can also bind to an HA polypeptide on an influenza strain from one or both clades of Group 2.
  • the antibody molecules described herein inhibit viral/endosome membrane fusion, and thus targeting an early step in the infection process.
  • the binding agents, and in particular, the antibody molecules featured in the disclosure can be effective to treat or prevent infection by seasonal or pandemic influenza strains.
  • the binding agents, and in particular the antibody molecules described herein can be characterized by their ability to prevent or treat a Group 1 or a Group 2 strain of influenza A viruses.
  • the binding agents, and in particular the antibody molecules featured in the disclosure are effective to prevent or treat infection by one or more strains of Group 1, one or more strains of Group 2.
  • the binding agent is used to treat or prevent an influenza virus infection caused by an influenza virus chose from an H1N1 virus, an H3N2 virus, an H7N9 virus, or a combination thereof.
  • the binding agents can be effective to treat or prevent an influenza virus infection, when administered prior to exposure to an influenza virus, e.g., 1 day, 2 days, 3 days, 4 days, 1 week , 2 weeks, 3 weeks, 4 weeks, 1 month, 2 months, 3 months, or more, or later after infection, or upon a first symptom experienced by the patient.
  • Strains The antibody molecules described herein are effective to treat one or more influenza strains of Group 1, and one or more influenza strains of Group 2, and specific isolates within these strains. Certain antibody molecules may be more effective for treatment of certain isolates than other isolates. Exemplary influenza strains and isolates are described in the below Table 1. Affinity can also be in reference to a particular isolate of a given Group 1 or Group 2 strain for influenza A viruses. Exemplary isolates are as provided in the above Table 1. Table 1. Exemplary Influenza Strains and Isolates
  • HA specific antibodies can inhibit infection by numerous methods, such as by blocking viral attachment to sialic acid residues on surface proteins on host cells, by interfering with the structural transition of HA that triggers fusion activity in the endosome, or by simultaneously inhibiting attachment and virus-cell fusion.
  • antibody molecules featured herein bind an epitope at the HA trimer interface. Structural changes at the trimer interface are important for fusion of the viral membrane and the endocytic membrane, and the antibody molecules described herein interfere with this critical step of infection. Assays to measure fusogenic activity of HA are known in the art.
  • one fusion assay measures syncytia formation, which occurs in cell-cell fusion events.
  • Cells that express and display an influenza viral strain HA can be used in the assay.
  • Membrane-anchored hemagglutinin in these cells is induced to convert to the fusion conformation by a brief (e.g., 3 minute) exposure to low pH (e.g., pH 5).
  • a 2-3-hour incubation period follows to allow the cells to recover and fuse to form syncytia.
  • a nuclear stain can be used to aid in the visualization of these fusion products, and their count is used as a gauge of fusion activity.
  • a candidate anti-HA antibody can be added either before or after the low pH treatment to determine at which stage of the fusion process the antibody interferes.
  • fusion assay monitors content mixing.
  • host cells e.g., erythrocytes
  • a dye e.g., Lucifer yellow
  • fusion-inducing conditions e.g., low pH, such as pH less than 6 or pH less than 5. If the dye fails to mix with the contents of the host cells, then the conclusion can be made that fusion is inhibited. See, e.g., Kemble et al., J. Virol.66:4940-4950, 1992.
  • a fusion assay is performed by monitoring lipid mixing.
  • the lipid mixing assay can be performed by labeling host cells (e.g., erythrocytes) with a fluorescent dye (e.g., R18 (octadecylrhodamine)) or dye pairs (e.g., CPT-PC/DABS-PC) (for fluorescence resonance energy transfer), exposing the host cells and HA-expressing cells to fusion-inducing conditions, and assaying for fluorescence dequenching (FDQ).
  • FDQ fluorescence dequenching
  • influenza strains will rarely if ever produce escape mutants when contacted with the featured antibody molecules. Escape mutants can be identified by methods known in the art. For example, an antibody featured in the disclosure will not produce an escape mutant when the cells are infected with the virus under prolonged or repeated exposure to anti-HA antibodies featured in the disclosure.
  • One exemplary method includes infection of cells (e.g. MDCK cells) with a fixed amount of influenza A viral particles in the presence of the antibody at a concentration known to attenuate infection rates by 50%.
  • Viral progeny collected after each passaging is used to infect a fresh cell culture in the presence of the same or greater concentration of the antibody.
  • the HA nucleotide sequence extracted from 20 viral plaque picks is evaluated for enrichment for mutations that renders the viral isolate resistant to neutralization by the antibody (an escape mutant). If no mutants with reduced sensitivity to the antibody are detected after the multiple rounds of selection, e.g., after 11 rounds, 10 rounds, or 9 rounds of selection, the antibody is determined to be resistant to escape mutations (see, e.g., Throsby et al.
  • an assay that measures minimum inhibitory concentration (MIC) of the neutralizing antibody can be used to identify escape mutants.
  • the MIC of an antibody molecule is the lowest concentration of an antibody molecule that can be mixed with virus to prevent infection of cell culture with influenza. If escape mutants arise within a viral population, then the MIC of a particular antibody will be observed to increase with increased rounds of propagation under the antibody selective pressure, as the proportion of the viral particles that carry the resistance mutation within the population increased. Influenza escape mutants rarely if ever evolve in response to an anti-HA antibody molecule described herein, and therefore the MIC will stay the same over time.
  • CPE Cytopathic Effect
  • a CPE assay monitors the ability of an antibody to neutralize (i.e., prevent infection by) an influenza strain.
  • a CPE assay provides the minimal concentration of antibody required in cell culture to neutralize the virus. If escape mutants arise, than the CPE of a particular antibody will increase over time, as the antibody becomes less effective at neutralizing the virus. Viral strains rarely if ever produce escape mutants in response to an anti-HA antibody molecule described herein, and therefore the CPE will stay essentially the same over time.
  • Quantitative polymerase chain reaction qPCR
  • qPCR is useful to monitor the ability of an antibody to neutralize (i.e., prevent infection by) an influenza strain. If an antibody effectively neutralizes a virus, then qPCR performed on cell culture samples will not detect presence of viral genomic nucleic acid. If escape mutants arise, than over time, qPCR will amplify more and more viral genomic nucleic acid. Escape mutants rarely if ever develop in response to an anti-HA antibody molecule described herein, and therefore qPCR will rarely if ever detect viral genomic nucleic acid, even after the passage of time.
  • the binding agents particularly antibody molecules, featured herein bind to two or more of the following: at least one HA polypeptide from a Group 1 influenza strain (e.g., an H1, H2, H5, H6, H8, H9 H12, H11, H13, H16 or H17 polypeptide); and at least one HA polypeptide from a Group 2 influenza strain (e.g., an H3, H4, H14, H7, H10, or H15 polypeptide).
  • a Group 1 influenza strain e.g., an H1, H2, H5, H6, H8, H9 H12, H11, H13, H16 or H17 polypeptide
  • a Group 2 influenza strain e.g., an H3, H4, H14, H7, H10, or H15 polypeptide
  • a binding agent e.g., an antibody molecule
  • a Group 1 influenza strain e.g., an H1, H2, H5, H6, H8, H9 H12, H11, H13, H16 or H17 polypeptide
  • a binding agent e.g., an antibody molecule
  • a Group 2 influenza strain e.g., an H3, H4, H14, H7, H10, or H15 polypeptide
  • a binding agent e.g., an antibody molecule
  • a binding agent e.g., an antibody molecule
  • a binding agent e.g., an antibody molecule
  • the antibody molecule binds to at least one HA polypeptide from a Group 1 influenza strain with a higher affinity than a reference anti-HA antibody, and to at least one HA polypeptide from a Group 2 influenza strain with a higher affinity than a reference anti-HA antibody.
  • exemplary reference HA antibodies include an anti-HA antibody disclosed in PCT Application Publication Nos. WO 2013/170139 (e.g., Ab 044), an anti-HA antibody disclosed in PCT Application Publication No. WO 2013/169377, FI6 (FI6, as used herein, refers to any specifically disclosed FI6 sequence in U.S. Application Publication No.2010/0080813, US Application Publication No. 2011/0274702, International Publication No.
  • the binding agent e.g., an antibody molecule, described herein, comprises a mutation that results one or more of additional contact with the HA polypeptide, improved binding, and/or improved neutralization capability.
  • the mutation is at position 75 and/or position 76 of the VH of the binding agent, e.g., an antibody molecule described herein.
  • a mutation in the VH at position 75 of a binding agent, e.g., antibody molecule, described herein results in one or more of additional contact with the HA polypeptide, improved binding, and/or improved neutralization capability.
  • a mutation in the VH at position 76 of a binding agent, e.g., antibody molecule, described herein results in one or more of additional contact with the HA polypeptide, improved binding, and/or improved neutralization capability.
  • Affinity, or relative affinity or aviditiy can be measured by methods known in the art, such as by ELISA assay (Enzyme Linked Immunosorbent Assay), Surface Plasmon Resonance (SPR, e.g., by a Biacore TM Assay), or KinExA ® assay (Sapidyne, Inc.). Relative binding affinity is expressed herein according to ELISA assay.
  • ELISA assay Enzyme Linked Immunosorbent Assay
  • SPR Surface Plasmon Resonance
  • KinExA ® assay KinExA ® assay
  • an anti-HA antibody that binds with “high affinity” to a Group 1 HA, and to a Group 2 HA can bind a Group 1 HA with a Kd less than or equal to 200 pM, e.g., less than or equal to 100 pM, as measured by ELISA, and can bind a Group 2 HA with a Kd less than or equal to 200 pM, e.g., less than or equal to 100 pM, as measured by ELISA.
  • an anti-HA antibody molecule described herein can have any combination of the heavy chain variable region and the light chain variable region described above.
  • the binding agent e.g., an anti-HA antibody molecule
  • the binding agent is a full-length tetrameric antibody, a single chain antibody (scFv), a F(ab’) 2 fragment, a Fab fragment, or an Fd fragment.
  • the heavy chain of the antibody molecule is a ⁇ 1 heavy chain
  • the light chain of the antibody molecule is a ⁇ light chain or a ⁇ light chain.
  • the anti-HA antibody molecule featured in the disclosure is an IgG1 antibody.
  • the antibody molecule binds an epitope that has one, two, three, four, five, or all of, the following properties a)-f): a) it includes one, two, or all of, H3 HA1 residues N38, I278, and D291; b) it includes H3 HA2 residue N12; c) it does not include one, two or all of, H3 HA1 residues Q327, T328, and R329; d) it does not include one, two, three, four, or all of, H3 HA2 residues G1, L2, F3, G4, and D46; e) it includes one, two, or all of, H3 HA1 residues T318, R321, and V323; or f) it includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of, H3 HA2 residues A7, E11, I18, D19, G20, W21, L38, K39, T41, Q42, A43,
  • the antibody molecule further binds an epitope that comprises one or more (2, 3, 4, 5, or all) of the following residues: Group 1 HA1 residues N41, D277, C278, T280, A288, or P290. In an embodiment, the antibody molecule further binds an epitope that comprises one or more (2, 3, 4, 5, or all) of the following residues: Group 2 HA1 residues T48, T276, C277, S279, S287, or P289 In an embodiment, the antibody molecule has properties: a) and b). In an embodiment, the antibody molecule has properties: c) and d). In an embodiment, the antibody molecule has properties: a); and c) or d).
  • the antibody molecule has properties: b); and c) or d). In an embodiment, the antibody molecule has properties: c); and a) or b). In an embodiment, the antibody molecule has properties: d); and a) or b). In an embodiment, the antibody molecule has properties: a), b), c) and d). In an embodiment, the antibody molecule has properties: a), b), c), d), e), and f).
  • the antibody molecule has a KD for H3 of equal to or less than 10 -6 , wherein said KD is increased by at least 2, 5,10, or 100 fold, by a mutation or mutations in any of: a) H3 HA1 residues N38, I278, or D291; b) H3 HA2 residue N12; c) H3 HA1 residues T318, R321, or V323; or d) H3 HA2 residues A7, E11, I18, D19, G20, W21, L38, K39, T41, Q42, A43, I45, I48, N49, L52, N53, I56, or E57.
  • the antibody molecule has a KD for H3 of equal to or less than 10 -6 , wherein said KD is increased by no more than 2, or 5 fold, by a mutation or mutations in any of: c) H3 HA1 residues Q327, T328, or R329; or d) H3 HA2 residues G1, L2, F3, G4, or D46.
  • the antibody molecule binds an epitope that has one, two, three, four, five, or all of, the following properties aa)-ff): aa) it includes one, two, or all of, H1 HA1 residues H31, N279, and S292; bb) it includes H1 HA2 residue G12; cc) it does not include one or both of H1 HA1 residues Q328 and S329; dd) it does not include one, two, three, or all of, H1 HA2 residues G1, L2, F3, or G4; ee) it includes one, two, or all of, H1 HA1 residues T319, R322, and I324 are bound by both Ab 044 and FI6; or ff) it includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of, H1 HA2 residues A7, E11, I18, D19, G20, W21, Q38, K39,
  • the antibody molecule has properties: aa) and bb). In an embodiment, the antibody molecule has properties: cc) and dd). In an embodiment, the antibody molecule has properties: aa); and cc) or dd). In an embodiment, the antibody molecule has properties: bb); and cc) or dd). In an embodiment, the antibody molecule has properties: cc); and aa) or bb). In an embodiment, the antibody molecule has properties: dd); and aa) or bb). In an embodiment, the antibody molecule has properties: aa), bb), cc) and dd).
  • the antibody molecule has properties: aa), bb), cc), dd), ee), and ff).
  • the antibody molecule has a KD for H1 of equal to or less than 10 -6 , wherein said KD is increased by at least 2, 5, 10, or 100 fold, by a mutation or mutations in any of: aa) H1 HA1 residues H31, N279, and S292; bb) H1 HA2 residue G12; cc) H1 HA1 residues T319, R322, and I324; or dd) H1 HA2 residues A7, E11, I18, D19, G20, W21, Q38, K39, T41, Q42, N43, I45, I48, T49, V52, N53, I56, and E57.
  • the antibody molecule has a KD for H1 of equal to or less than 10 -6 , wherein said KD is increased by no more than 2, or 5-fold, by a mutation or mutations in any of: cc) H1 HA1 residues Q328 and S329; or dd) H1 HA2 residues G1, L2, F3, and G4.
  • the antibody molecule has one, two, three or all of the following properties: a) and aa); b) and bb); c) and cc); or d) and dd).
  • the molecule has properties c), cc), d), and dd).
  • the binding agent e.g., an antibody molecule
  • the binding agent comprises one or both of: a heavy chain variable region comprising at least, or more than, 60, 65, 70, 75, 80, 85, 87, 90, 95, 98 or 99 percent homology with a heavy chain variable region described herein; and a light chain variable region comprising at least, or more than, 60, 65, 70, 75, 80, 85, 87, 90, 95, 98 or 99 percent homology with light chain variable region described herein.
  • the antibody molecule comprises one or both of: a) one or more framework regions (FRs) from heavy chain disclosed herein.
  • the antibody molecule comprises one or more (e.g., 2 or 3) or all of FR1, FR2, FR3, or FR4, or FR sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from a heavy chain disclosed herein; and b) one or more framework regions (FRs) from light chain disclosed herein.
  • the antibody molecule comprises one or more or all of FR1, FR2, FR3, or FR4, or FR sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from light chain disclosed herein.
  • an anti-HA antibody molecule featured in the disclosure, or preparation, or isolated preparation thereof comprises: (a) a heavy chain immunoglobulin variable domain comprising a sequence at least 60, 70, 80, 85, 87, 90, 95, 97, 98, or 99, e.g., 90%, homologous, to a heavy chain consensus sequence provided herein; and (b) a light chain immunoglobulin variable domain comprising a sequence at least 60, 70, 80, 85, 87, 90, 95, 97, 98, or 99, e.g., 95%, homologous, to a light chain consensus sequence provided herein.
  • the 1, 2, 3, 4, 5, 6, 8, 10, 11, 12, 13, 14, 15 or 16 amino acid differences, e.g., conservative amino acid differences, in the heavy chain immunoglobulin variable region are in the FR regions of the heavy chain immunoglobulin variable domain.
  • the 1, 2, 3, 4 or 5 amino acid differences, e.g., conservative amino acid differences, in the light chain immunoglobulin variable domain are in the FR regions of the light chain immunoglobulin variable domain.
  • the amino acid differences in the heavy chain immunoglobulin variable region, or in the light chain immunoglobulin variable region are conservative amino acid changes.
  • the binding agent e.g., an antibody molecule
  • binds to an epitope e.g., it has an epitope that overlaps with or is the same as, of an antibody disclosed herein, e.g., as determined by mutational analysis or crystal structure analysis.
  • the antibody molecule comprises one or both of: a) one or more framework regions (FRs) from heavy chain consensus sequence disclosed herein.
  • the antibody molecule comprises one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from heavy chain consensus sequence disclosed herein; and b) one or more framework regions (FRs) from light chain consensus sequence disclosed herein.
  • the antibody molecule comprises one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from light chain consensus disclosed herein.
  • an antibody molecule e.g., an antibody featured in the disclosure has a variable heavy chain immunoglobulin domain that is at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to a heavy chain disclosed herein, and has a variable light chain immunoglobulin domain that is at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%
  • An exemplary anti-HA binding antibody has one or more CDRs, e.g., all three heavy chain (HC) CDRs and/or all three light chain (LC) CDRs of a particular antibody disclosed herein, or CDRs that are, in sum, at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to such an antibody.
  • the H1 and H2 hypervariable loops have the same canonical structure as those of an antibody described herein.
  • the L1 and L2 hypervariable loops have the same canonical structure as those of an antibody described herein.
  • the amino acid sequence of the HC and/or LC variable domain sequence is at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to the amino acid sequence of the HC and/or LC variable domain of an antibody described herein.
  • the amino acid sequence of the HC and/or LC variable domain sequence can differ by at least one amino acid, but no more than ten, eight, six, five, four, three, or two amino acids from the corresponding sequence of an antibody described herein.
  • the differences may be primarily or entirely in the framework regions.
  • the amino acid differences are conservative amino acid differences (e.g., conservative amino acid substitutions).
  • a “conservative” amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue comprising a similar side chain. Families of amino acid residues comprising similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
  • beta-branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • amino acid sequences of the HC and LC variable domain sequences can be encoded by a nucleic acid sequence that hybridizes under high stringency conditions to a nucleic acid sequence described herein or one that encodes a variable domain or an amino acid sequence described herein.
  • the amino acid sequences of one or more (e.g., 2, 3, or 4) framework regions (e.g., FR1, FR2, FR3, and/or FR4) of the HC and/or LC variable domain are at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to corresponding framework regions of the HC and LC variable domains of an antibody described herein.
  • one or more heavy or light chain framework regions are at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to the sequence of corresponding framework regions from a human germline antibody.
  • the antibodies featured in the disclosure are useful for validating a vaccine based on a particular epitope.
  • an epitope that is the target of an antibody featured in the disclosure can be assessed by computation methods to identify a peptide framework suitable for supporting the epitope conformation, such as to stabilize an epitope that is transient or minimally accessible in nature.
  • Computational abstraction of the epitope and framework properties allows automated screening of databases to identify candidate acceptor peptide scaffolds.
  • the acceptor scaffold can have a particular tertiary structure that includes, for example, one or more of a beta sheet, a beta sandwich, a loop, or an alpha or beta helix.
  • the candidate epitope-scaffold antigens can be assayed in vitro, such as to identify binding properties with an antibody featured in the disclosure, e.g., binding affinity or structure analysis of the epitope-scaffold/antibody complex, or in vitro neutralization.
  • the ability of the epitope-scaffold to generate an immune response e.g., to generate antibodies
  • an animal e.g., in a mammal, such as a rat, a mouse, a guinea pig, or a rabbit
  • sera for the presence of anti-epitope-scaffold antibodies e.g., by ELISA assay.
  • an antibody featured in the disclosure can provide validation that the epitope is functionally important and that targeting the epitope will provide protection from infection with a Group 1 or Group 2 influenza strain, or both types of strains.
  • the nucleic acids encoding an antibody molecule generated by a method described herein can be sequenced, and all or part of the nucleic acids can be cloned into a vector that expresses all or part of the nucleic acids.
  • the nucleic acids can include a fragment of the gene encoding the antibody, such as a single chain antibody (scFv), a F(ab’)2 fragment, a Fab fragment, or an Fd fragment.
  • the disclosure also provides host cells comprising the nucleic acids encoding an antibody or fragment thereof as described herein.
  • the host cells can be, for example, prokaryotic or eukaryotic cells, e.g., mammalian cells, or yeast cells, e.g., Pichia (see, e.g., Powers et al. (2001) J. Immunol. Methods 251:123-35), Hanseula, or Saccharomyces.
  • Antibody molecules particularly full-length antibody molecules, e.g., IgGs, can be produced in mammalian cells.
  • Exemplary mammalian host cells for recombinant expression include Chinese Hamster Ovary (CHO) cells (including dhfr- CHO cells, described in Urlaub and Chasin (1980) Proc. Natl. Acad. Sci.
  • lymphocytic cell lines e.g., NS0 myeloma cells and SP2 cells, COS cells, K562, and a cell from a transgenic animal, e.g., a transgenic mammal.
  • the cell is a mammary epithelial cell.
  • the recombinant expression vectors may carry additional nucleic acid sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
  • the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see e.g., U.S. Patent Nos.4,399,216; 4,634,665; and 5,179,017).
  • Exemplary selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in dhfr- host cells with methotrexate selection/amplification) and the neo gene (for G418 selection).
  • DHFR dihydrofolate reductase
  • a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain is introduced into dhfr- CHO cells by calcium phosphate-mediated transfection.
  • the antibody heavy and light chain genes are each operatively linked to enhancer/promoter regulatory elements (e.g., derived from SV40, CMV, adenovirus and the like, such as a CMV enhancer/AdMLP promoter regulatory element or an SV40 enhancer/AdMLP promoter regulatory element) to drive high levels of transcription of the genes.
  • the recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification.
  • the selected transformant host cells are cultured to allow for expression of the antibody heavy and light chains and intact antibody molecule is recovered from the culture medium.
  • Standard molecular biology techniques are used to prepare the recombinant expression vector, to transfect the host cells, to select for transformants, to culture the host cells, and to recover the antibody from the culture medium.
  • some antibodies can be isolated by affinity chromatography with a Protein A or Protein G.
  • purified antibodies can be concentrated to about 100 mg/mL to about 200 mg/mL using protein concentration techniques that are known in the art.
  • Antibody molecules can also be produced by a transgenic animal.
  • U.S. Patent No.5,849,992 describes a method for expressing an antibody molecule in the mammary gland of a transgenic mammal.
  • a transgene is constructed that includes a milk-specific promoter and nucleic acid sequences encoding the antibody molecule of interest, e.g., an antibody described herein, and a signal sequence for secretion.
  • the milk produced by females of such transgenic mammals includes, secreted therein, the antibody of interest, e.g., an antibody described herein.
  • the antibody molecule can be purified from the milk, or for some applications, used directly.
  • Antibody molecules can also be expressed in vivo, following administration of a vector containing nucleic acids encoding the antibody heavy chain and the antibody light chain.
  • Vector mediated gene-transfer is then used to engineer secretion of the anti-HA antibody into circulation.
  • an anti-HA antibody heavy chain and an anti-HA antibody light chain as described herein are cloned into an adeno-associated virus (AAV)-based vector, and each of the anti-HA antibody heavy chain and the anti-HA antibody light chain are under control of a promoter, such as a cytomegalovirus (CMV) promoter.
  • AAV adeno-associated virus
  • CMV cytomegalovirus
  • Binding agents, e.g., antibody molecules can be modified to have numerous properties, e.g., to have altered, e.g., extended half-life, to be associated with, e.g., covalently bound to detectable moieties, e.g., labels, to be associated with, e.g., covalently bound to toxins, or to have other properties, e.g., altered immune functions.
  • Antibody molecules may include modifications, e.g., modifications that alter Fc function, e.g., to decrease or remove interaction with an Fc receptor or with C1q, or both.
  • the human IgG1 constant region can be mutated at one or more residues.
  • the antibody production system may be designed to synthesize antibody molecules in which the Fc region is glycosylated.
  • the Fc domain can be produced in a mammalian expression system that appropriately glycosylates the residue corresponding to asparagine 297.
  • the Fc domain can also include other eukaryotic post-translational modifications.
  • Other suitable Fc domain modifications include those described in WO2004/029207.
  • the Fc domain can be an XmAb ® Fc (Xencor, Monrovia, CA).
  • the Fc domain, or a fragment thereof can have a substitution in an Fc ⁇ Receptor (Fc ⁇ R) binding region, such as the domains and fragments described in WO05/063815.
  • the Fc domain, or a fragment thereof has a substitution in a neonatal Fc Receptor (FcRn) binding region, such as the domains and fragments described in WO05047327.
  • the Fc domain is a single chain, or fragment thereof, or modified version thereof, such as those described in WO2008143954. Other suitable Fc modifications are known and described in the art.
  • Antibody molecules can be modified, e.g., with a moiety that improves its stabilization and/or retention in circulation, e.g., in blood, serum, lymph, bronchoalveolar lavage, or other tissues, e.g., by at least 1.5, 2, 5, 10, or 50-fold.
  • an antibody molecule generated by a method described herein can be associated with a polymer, e.g., a substantially non-antigenic polymer, such as a polyalkylene oxide or a polyethylene oxide. Suitable polymers will vary substantially by weight. Polymers comprising molecular number average weights ranging from about 200 to about 35,000 Daltons (or about 1,000 to about 15,000, and 2,000 to about 12,500) can be used.
  • an antibody molecule generated by a method described herein can be conjugated to a water-soluble polymer, e.g., a hydrophilic polyvinyl polymer, e.g. polyvinylalcohol or polyvinylpyrrolidone.
  • a water-soluble polymer e.g., a hydrophilic polyvinyl polymer, e.g. polyvinylalcohol or polyvinylpyrrolidone.
  • a non-limiting list of such polymers include polyalkylene oxide homopolymers such as polyethylene glycol (PEG) or polypropylene glycols, polyoxyethylenated polyols, copolymers thereof and block copolymers thereof, provided that the water solubility of the block copolymers is maintained.
  • Additional useful polymers include polyoxyalkylenes such as polyoxyethylene, polyoxypropylene, and block copolymers of polyoxyethylene and polyoxypropylene (Pluronics); polymethacrylates; carbomers; branched or unbranched polysaccharides that comprise the saccharide monomers D-mannose, D- and L-galactose, fucose, fructose, D-xylose, L-arabinose, D- glucuronic acid, sialic acid, D-galacturonic acid, D-mannuronic acid (e.g.
  • polymannuronic acid or alginic acid
  • D-glucosamine D-galactosamine
  • D-glucose and neuraminic acid including homopolysaccharides and heteropolysaccharides such as lactose, amylopectin, starch, hydroxyethyl starch, amylose, dextrane sulfate, dextran, dextrins, glycogen, or the polysaccharide subunit of acid mucopolysaccharides, e.g. hyaluronic acid; polymers of sugar alcohols such as polysorbitol and polymannitol; heparin or heparan.
  • Binding agents e.g., antibody molecules, as disclosed herein, can by conjugated to another entity or moiety (e.g., to a cytotoxic or cytostatic moiety, a label or detectable moiety, or a therapeutic moiety).
  • another entity or moiety e.g., to a cytotoxic or cytostatic moiety, a label or detectable moiety, or a therapeutic moiety.
  • moieties include: a cytotoxic or cytostatic agent, e.g., a therapeutic agent, a drug, a compound emitting radiation, molecules of plant, fungal, or bacterial origin, or a biological protein (e.g., a protein toxin) or particle (e.g., a recombinant viral particle, e.g., via a viral coat protein), a detectable agent; a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • a cytotoxic or cytostatic agent e.g., a therapeutic agent, a drug, a compound emitting radiation, molecules of plant, fungal, or bacterial origin, or a biological protein (e.g., a protein toxin) or particle (e.g., a recombinant viral particle, e.g., via a viral coat protein), a detect
  • a binding agent e.g., an antibody molecule, as disclosed herein, can be functionally linked by any suitable method (e.g., chemical coupling, genetic fusion, covalent binding, noncovalent association or otherwise) to one or more other molecular entities.
  • Binding agents e.g., antibody molecules, disclosed herein can be conjugated with a detectable moiety, e.g., a label or imaging agent.
  • Such moieties can include enzymes (e.g., horseradish peroxidase, beta-galactosidase, luciferase, alkaline phosphatase, acetylcholinesterase, glucose oxidase and the like), radiolabels (e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I and the like), haptens, fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors, fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin and the like), phosphorescent molecules, chemiluminescent molecules, chromophores, luminescent molecules, photoaffinity molecules, colored particles or affinity ligands, such as biotin, predetermined polypeptide epitop
  • a moiety e.g., a detectable moiety, e.g., a label
  • a binding agent e.g., antibody molecule, disclosed herein
  • a detectable enzyme is derivatized with a detectable enzyme and is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product. For example, when the detectable agent horseradish peroxidase is present, the addition of hydrogen peroxide and diaminobenzidine leads to a colored reaction product, which is detectable.
  • a binding agent e.g., antibody molecule, disclosed herein, may also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin).
  • a prosthetic group e.g., streptavidin/biotin and avidin/biotin.
  • an antibody may be derivatized with biotin, and detected through indirect measurement of avidin or streptavidin binding.
  • the moiety comprises paramagnetic ions and NMR-detectable substances, among others.
  • a paramagnetic ion is one or more of chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II),neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III), erbium (III), lanthanum (III), gold (III), lead (II), and/or bismuth (III).
  • Binding agents e.g., antibody molecules, as disclosed herein, can be modified to be associated with, e.g., conjugated to, a therapeutic agent, e.g., an agent comprising anti-viral activity, anti-inflammatory activity, or cytotoxic activity, etc.
  • therapeutic agents can treat symptoms or causes of influenza infection (e.g., for example, anti-viral, pain-relief, anti-inflammatory, immunomodulatory, sleep-inducing activities, etc.).
  • binding agents and in particular antibody molecules (e.g., anti-hemagglutinin (HA) antibody molecules) comprising an Fc region or a fragment thereof, e.g., an Fc region, or a fragment thereof (e.g., a functional fragment thereof), described herein.
  • the binding agent particularly the antibody molecule, e.g., the anti- hemagglutinin (HA) antibody described herein comprises an Fc region described herein.
  • the anti-HA antibody described herein comprises an Fc region described herein.
  • the Fc region comprises one or more mutations described herein.
  • a fragment crystallizable region, or Fc region refers to a region of an immunoglobulin that interacts with an Fc receptor.
  • the Fc region interacts with a protein of the complement system.
  • the naturally-occurring Fc region generally comprises two identical protein fragments, derived from the second and third constant domains of the antibody’s two heavy chains.
  • Naturally-occurring IgM and IgE Fc regions generally comprise three heavy chain constant domains (C H domains 2–4) in each polypeptide chain.
  • the Fc regions of IgGs can contain a highly conserved N-glycosylation site (Stadlmann et al. (2008). Proteomics 8 (14): 2858–2871; Stadlmann (2009) Proteomics 9 (17): 4143–4153). While not wishing to be bound by theory, it is believed that in an embodiment, glycosylation of the Fc fragment contributes to Fc receptor-mediated activities (Peipp et al. (2008) Blood 112 (6): 2390–2399). In an embodiment, the N-glycans attached to this site are predominantly core-fucosylated diantennary structures of the complex type.
  • small amounts of these N-glycans also contain bisecting GlcNAc and/or ⁇ -2,6 linked sialic acid residues.
  • An exemplary fragment of an Fc region amino acid sequence from human IgG1 is provided in SEQ ID NO: 40 and is shown below: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSPGK (SEQ ID NO: 40)
  • the first amino acid residue in this sequence is referred to as position 221 herein.
  • a binding agent e.g., an antibody, e.g., an anti-hemagglutinin (HA) antibody comprising an Fc region or fragment thereof described herein can have one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more) of mutations or combinations of mutations described in Table 2 (based on EU numbering, e.g., as described in www.imgt.org/IMGTScientificChart/Numbering/Hu_IGHGnber.html). Table 2. Exemplary Fc mutations _
  • the Fc region comprises FcMut001. In an embodiment, the Fc region comprises FcMut002. In an embodiment, the Fc region comprises FcMut003. In an embodiment, the Fc region comprises FcMut004. In an embodiment, the Fc region comprises FcMut005. In an embodiment, the Fc region comprises FcMut006. In an embodiment, the Fc region comprises FcMut007. In an embodiment, the Fc region comprises FcMut008. In an embodiment, the Fc region comprises FcMut009. In an embodiment, the Fc region comprises FcMut010. In an embodiment, the Fc region comprises FcMut011.
  • the Fc region comprises FcMut012. In an embodiment, the Fc region comprises FcMut013. In an embodiment, the Fc region comprises FcMut014. In an embodiment, the Fc region comprises FcMut015. In an embodiment, the Fc region comprises FcMut016. In an embodiment, the Fc region comprises FcMut017. In an embodiment, the Fc region comprises FcMut018. In an embodiment, the Fc region comprises FcMut019. In an embodiment, the Fc region comprises FcMut020. In an embodiment, the Fc region comprises FcMut021. In an embodiment, the Fc region comprises FcMut022.
  • the Fc region comprises FcMut023. In an embodiment, the Fc region comprises FcMut024. In an embodiment, the Fc region comprises FcMut026. In an embodiment, the Fc region comprises FcMut027. In an embodiment, the Fc region comprises FcMut028. In an embodiment, the Fc region comprises FcMut029. In an embodiment, the Fc region comprises FcMut030. In an embodiment, the Fc region comprises FcMut031. In an embodiment, the Fc region comprises FcMut032. In an embodiment, the Fc region comprises FcMut033. In an embodiment, the Fc region comprises FcMut034.
  • the Fc region comprises FcMut035. In an embodiment, the Fc region comprises FcMut036. In an embodiment, the Fc region comprises FcMut037. In an embodiment, the Fc region comprises FcMut038. In an embodiment, the Fc region comprises FcMut039. In an embodiment, the Fc region comprises FcMut040. In an embodiment, the Fc region comprises FcMut041. In an embodiment, the Fc region comprises FcMut042. In an embodiment, the Fc region comprises FcMut043. In an embodiment, the Fc region comprises FcMut044. In an embodiment, the Fc region comprises FcMut045.
  • the Fc region comprises FcMut046. In an embodiment, the Fc region comprises FcMut047. In an embodiment, the Fc region comprises FcMut048. In an embodiment, the Fc region comprises FcMut049. In an embodiment, the Fc region comprises FcMut050. In an embodiment, the Fc region comprises FcMut051. In an embodiment, the Fc region comprises FcMut052. In an embodiment, the Fc region comprises FcMut053. In an embodiment, the Fc region comprises FcMut067. In an embodiment, the Fc region comprises FcMut068. In an embodiment, the Fc region comprises FcMut069.
  • the Fc region comprises FcMut070. In an embodiment, the Fc region comprises FcMut071. In an embodiment, the Fc region comprises FcMut072. In an embodiment, the Fc region comprises FcMut073. In an embodiment, the Fc region comprises FcMut074. In an embodiment, the Fc region comprises FcMut075. In an embodiment, the Fc region comprises FcMut076. In an embodiment, the Fc region comprises FcMut077. In an embodiment, the Fc region comprises FcMut078. In an embodiment, the Fc region comprises FcMut079. In an embodiment, the Fc region comprises FcMut080.
  • the Fc region comprises FcMut081. In an embodiment, the Fc region comprises FcMut082. In an embodiment, the Fc region comprises FcMut083. In an embodiment, the Fc region comprises FcMut084. In an embodiment, the Fc region comprises FcMut085. In an embodiment, the Fc region comprises FcMut086. In an embodiment, the Fc region comprises FcMut087. In an embodiment, the Fc region comprises FcMut088. In an embodiment, the Fc region comprises FcMut089. In an embodiment, the Fc region comprises FcMut090. In an embodiment, the Fc region comprises FcMut091.
  • the Fc region comprises FcMut093. In an embodiment, the Fc region comprises FcMut094. In an embodiment, the Fc region comprises FcMut095. In an embodiment, the Fc region comprises FcMut096. In an embodiment, the Fc region comprises FcMut097. In an embodiment, the Fc region comprises FcMut098. In an embodiment, the Fc region comprises FcMut099. In an embodiment, the Fc region comprises FcMut100. In an embodiment, the Fc region comprises FcMut101. In an embodiment, the Fc region comprises FcMut102. In an embodiment, the Fc region comprises FcMut103.
  • the Fc region comprises FcMut104. In an embodiment, the Fc region comprises FcMut105. In an embodiment, the Fc region comprises FcMut106. In an embodiment, the Fc region comprises FcMut107. In an embodiment, the Fc region comprises FcMut108. In an embodiment, the Fc region comprises FcMut109. In an embodiment, the Fc region comprises FcMut110. In an embodiment, the Fc region comprises FcMut111. In an embodiment, the Fc region comprises FcMut112. In an embodiment, the Fc region comprises FcMut113. In an embodiment, the Fc region comprises FcMut114. In an embodiment, the Fc region comprises FcMut115.
  • the Fc region comprises FcMut116. In an embodiment, the Fc region comprises FcMut117. In an embodiment, the Fc region comprises FcMut118. In an embodiment, the Fc region comprises FcMut119. In an embodiment, the Fc region comprises FcMut120. In an embodiment, the Fc region comprises FcMut121. In an embodiment, the Fc region comprises FcMut122. In an embodiment, the Fc region comprises FcMut123. In an embodiment, the Fc region comprises FcMut124. In an embodiment, the Fc region comprises FcMut125. In an embodiment, the Fc region comprises FcMut126. In an embodiment, the Fc region comprises FcMut127.
  • the Fc region comprises FcMut128. In an embodiment, the Fc region comprises FcMut129. In an embodiment, the Fc region comprises FcMut130. In an embodiment, the Fc region comprises FcMut131. In an embodiment, the Fc region comprises FcMut132. In an embodiment, the Fc region comprises FcMut133. In an embodiment, the Fc region comprises FcMut134. In an embodiment, the Fc region comprises FcMut135. In an embodiment, the Fc region comprises FcMut136. In an embodiment, the Fc region comprises FcMut137. In an embodiment, the Fc region comprises FcMut138.
  • the Fc region comprises FcMut139. In an embodiment, the Fc region comprises FcMut140. In an embodiment, the Fc region comprises FcMut141. In an embodiment, the Fc region comprises FcMut142. In an embodiment, the Fc region comprises FcMut143. In an embodiment, the Fc region comprises FcMut144. In an embodiment, the Fc region comprises FcMut145. In an embodiment, the Fc region comprises FcMut146. In an embodiment, the Fc region comprises FcMut147. In an embodiment, the Fc region comprises FcMut148. In an embodiment, the Fc region comprises FcMut149. In an embodiment, the Fc region comprises FcMut150.
  • the Fc region comprises FcMut151. In an embodiment, the Fc region comprises FcMut152. In an embodiment, the Fc region comprises FcMut153. In an embodiment, the Fc region comprises FcMut154. In an embodiment, the Fc region comprises FcMut155. In an embodiment, the Fc region comprises FcMut156. In an embodiment, the Fc region comprises FcMut157. In an embodiment, the Fc region comprises FcMut158. In an embodiment, the Fc region comprises FcMut159. In an embodiment, the Fc region comprises FcMut160. In an embodiment, the Fc region comprises FcMut161. In an embodiment, the Fc region comprises FcMut162.
  • the Fc region comprises FcMut163. In an embodiment, the Fc region comprises FcMut164. In an embodiment, the Fc region comprises FcMut165. In an embodiment, the Fc region comprises FcMut166. In an embodiment, the Fc region comprises FcMut167. In an embodiment, the Fc region comprises FcMut168. In an embodiment, the Fc region comprises FcMut169. In an embodiment, the Fc region comprises FcMut170. In an embodiment, the Fc region comprises FcMut171. In an embodiment, the Fc region comprises FcMut172. In an embodiment, the Fc region comprises FcMut173.
  • the Fc region comprises FcMut174. In an embodiment, the Fc region comprises FcMut175. In an embodiment, the Fc region comprises FcMut176. In an embodiment, the Fc region comprises FcMut177. In an embodiment, the Fc region comprises FcMut178. In an embodiment, the Fc region comprises FcMut179. In an embodiment, the Fc region comprises FcMut180. In an embodiment, the Fc region comprises FcMut181. In an embodiment, the Fc region comprises FcMut182. In an embodiment, the Fc region comprises FcMut183. In an embodiment, the Fc region comprises FcMut184. In an embodiment, the Fc region comprises FcMut185.
  • the Fc region comprises FcMut186. In an embodiment, the Fc region comprises FcMut187. In an embodiment, the Fc region comprises FcMut188. In an embodiment, the Fc region comprises FcMut189. In an embodiment, the Fc region comprises FcMut190. In an embodiment, the Fc region comprises FcMut191. In an embodiment, the Fc region comprises FcMut192. In an embodiment, the Fc region comprises FcMut193. In an embodiment, the Fc region comprises FcMut194. In an embodiment, the Fc region comprises FcMut195. In an embodiment, the Fc region comprises FcMut196. In an embodiment, the Fc region comprises FcMut197.
  • the Fc region comprises FcMut198. In an embodiment, the Fc region comprises FcMut199. In an embodiment, the Fc region comprises FcMut200. In an embodiment, the Fc region comprises FcMut201. In an embodiment, the Fc region comprises FcMut202. In an embodiment, the Fc region comprises FcMut203. In an embodiment, the Fc region comprises FcMut204. In an embodiment, the Fc region comprises FcMut205. In an embodiment, the Fc region comprises FcMut206. In an embodiment, the Fc region comprises FcMut207. In an embodiment, the Fc region comprises FcMut208. In an embodiment, the Fc region comprises FcMut209.
  • the Fc region comprises FcMut210. In an embodiment, the Fc region comprises FcMut211. In an embodiment, the Fc region comprises FcMut212. In an embodiment, the Fc region comprises FcMut213. In an embodiment, the Fc region comprises FcMut214. In an embodiment, the Fc region comprises FcMut215. In an embodiment, the Fc region comprises FcMut216. In an embodiment, the Fc region comprises FcMut217. In an embodiment, the Fc region comprises FcMut218. In an embodiment, the Fc region comprises FcMut219. In an embodiment, the Fc region comprises FcMut220.
  • the Fc region comprises FcMut221. In an embodiment, the Fc region comprises FcMut222. In an embodiment, the Fc region comprises FcMut223. In an embodiment, the Fc region comprises FcMut224. In an embodiment, the Fc region comprises FcMut225. In an embodiment, the Fc region comprises FcMut226. In an embodiment, the Fc region comprises FcMut227. In an embodiment, the Fc region comprises FcMut228. In an embodiment, the Fc region comprises FcMut229. In an embodiment, the Fc region comprises FcMut230. In an embodiment, the Fc region comprises FcMut231.
  • the Fc region comprises FcMut232. In an embodiment, the Fc region comprises FcMut233. In an embodiment, the Fc region comprises FcMut234. In an embodiment, the Fc region comprises FcMut242. In an embodiment, the Fc region comprises FcMut243. In an embodiment, the Fc region comprises FcMut244.
  • the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or more) of mutations or combinations of mutations chosen from FcMut045, FcMut171, FcMut183, FcMut186, FcMut190, FcMut197, FcMut213, FcMut215, FcMut216, FcMut219, FcMut222, FcMut223, FcMut224, FcMut226, FcMut227, FcMut228, or FcMut229.
  • FcMut045 FcMut171, FcMut183, FcMut186, FcMut190, FcMut197, FcMut213, FcMut215, FcMut216, FcMut219, FcMut222, FcMut223, FcMut224,
  • the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, or all) of mutations or combinations of mutations chosen from FcMut045, FcMut183, FcMut197, FcMut213, FcMut215, FcMut228, or FcMut156. In another embodiment, the Fc region comprises one or more (e.g., 2, 3, 4, 5, or all) of mutations or combinations of mutations chosen from FcMut183, FcMut197, FcMut213, FcMut215, FcMut228, or FcMut229.
  • the Fc region does not comprise one or more (e.g., 2, 3, 4, or all) of mutations or combinations of mutations chosen from FcMut018, FcMut021, FcMut050, FcMut102, or YTE.
  • the Fc region comprises one or more (e.g., 2, 3, 4, or all) of mutations or combinations of mutations chosen from FcMut018, FcMut021, FcMut050, FcMut102, or YTE, and one or more other mutations or combinations of mutations described in Table 2.
  • the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more) of mutations or combinations of mutations described in Table 2 that result in a synergistic effect (e.g., binding affinity or circulating half-life) as described herein.
  • the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, or 7) mutations in residues chosen from T256, H285, N286, T307, Q311, N315, or A378.
  • the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, or 7) mutations chosen from T256D, H285N, N286D, T307Q, Q311V, N315D, or A378V.
  • the Fc region comprises mutations in the residues T307, Q311, and A378.
  • the Fc region comprises the mutations T307Q, Q311V, and A378V.
  • the Fc region comprises a half-life enhancing mutation, a mutation that is capable of enhancing Fc effector function, or both.
  • the Fc region comprises a half- life enhancing mutation, a mutation that is capable of maintaining Fc effector function, or both.
  • the Fc region comprises one or more mutations or combinations of mutations described herein, e.g., chosen from M252W, V308F/N434Y, R255Y, P257L/N434Y, V308F, P257N/M252Y, G385N, P257N/V308Y, N434Y, M252Y/S254T/T256E (“YTE”), M428L/N434S (“LS”), or any combination thereof.
  • the Fc region comprises (a) one or more (e.g., 2, 3, 4, 5, or all) combinations of mutations chosen from: T256D/Q311V/A378V, H285N/T307Q/N315D, H285D/T307Q/A378V, T307Q/Q311V/A378V, T256D/N286D/T307R/Q311V/A378V, or T256D/T307R/Q311V. Additional Fc enhancements are described, for example, in PCT Publication No. WO 2018/052556 (incorporated by reference herein in its entirety).
  • the Fc region comprises the Fc region of human IgG4, human IgG4 containing S228P mutation, and/or R409K mutation, and/or other mutations of the Fc region of human IgG4, or a fragment thereof.
  • SEQ ID NO: 44 An exemplary fragment of an Fc region amino acid sequence from human IgG4 is provided in SEQ ID NO: 44 and is shown below: E219SKYGPPCPP228CPAPEFLGGPSV240FLFPPKPKDT250LMISRTPEVT260CVVVD VSQED 270 PEVQFNWYVD 280 GVEVHNAKTK 290 PREEQFNSTY 300 RVVSVLT 307 VLHQ 311 DWLN GKEYK320CKVSNKGLPS330SIEKTISKAK340GQPREPQVYT350LPPSQEEMTK360NQVSLTC LVK370GFYPSDIA378VEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSC SVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 44) In SEQ ID NO: 44, the first amino acid residue in this sequence is referred to as position 219 herein.
  • Mutations described to extend the half-life of human IgG1 can be applied to human IgG4 Fc.
  • Mut215 corresponds to mutations T307Q/Q311V/A378V in SEQ ID NO: 44.
  • the Fc region can bind to various cell receptors (e.g., Fc receptors) and complement proteins.
  • the Fc region can also mediate different physiological effects of antibody molecules, e.g., detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes.
  • FcR Fc receptors
  • There are several different types of Fc receptors (FcR) which can be classified based on the type of antibody that they recognize.
  • Fc ⁇ receptors belong to the immunoglobulin superfamily, and are involved, e.g., in inducing phagocytosis of opsonized microbes.
  • This family includes several members, Fc ⁇ RI (CD64), Fc ⁇ RIIA (CD32), Fc ⁇ RIIB (CD32), Fc ⁇ RIIIA (CD16a), Fc ⁇ RIIIB (CD16b), which differ in their antibody affinities due to their different molecular structure.
  • Fc ⁇ RI can bind to IgG more strongly than Fc ⁇ RII or Fc ⁇ RIII does.
  • Fc ⁇ RI also has an extracellular portion comprising three immunoglobulin (Ig)-like domains, one more domain than Fc ⁇ RII or Fc ⁇ RIII has.
  • Ig immunoglobulin
  • Fc ⁇ RI also has an extracellular portion comprising three immunoglobulin (Ig)-like domains, one more domain than Fc ⁇ RII or Fc ⁇ RIII has.
  • This property allows Fc ⁇ RI to bind a sole IgG molecule (or monomer), but Fc ⁇ receptors generally need to bind multiple IgG molecules within an immune complex to be activated.
  • the Fc ⁇ receptors differ in their affinity for IgG and the different IgG subclasses can have unique affinities for each of the Fc ⁇ receptors. These interactions can be further tuned by the glycan (oligosaccharide) at certain position of IgG.
  • FcRn is also involved in transferring IgG from a mother either via the placenta to her fetus or in milk to her suckling infant. This receptor may also play a role in the homeostasis of IgG serum levels.
  • Fc ⁇ RI (or CD89) belongs to the Fc ⁇ R subgroup. Fc ⁇ RI is found on the surface of neutrophils, eosinophils, monocytes, macrophages (including Kupffer cells), and dendritic cells. It comprises two extracellular Ig-like domains and is a member of both the immunoglobulin superfamily and the multi-chain immune recognition receptor (MIRR) family. It signals by associating with two FcR ⁇ signaling chains.
  • MIRR multi-chain immune recognition receptor
  • Fc-alpha/mu receptor is a type I transmembrane protein. It can bind IgA, although it has higher affinity for IgM (Shibuya and Honda (2006) Springer Seminars in Immunopathology 28 (4): 377–82). With one Ig-like domain in its extracellular portion, this Fc receptor is also a member of the immunoglobulin superfamily. There are two known types of Fc ⁇ R. The high-affinity receptor Fc ⁇ RI is a member of the immunoglobulin superfamily (it has two Ig-like domains). Fc ⁇ RI is found on epidermal Langerhans cells, eosinophils, mast cells and basophils. This receptor can play a role in controlling allergic responses.
  • Fc ⁇ RI is also expressed on antigen-presenting cells, and controls the production of immune mediators, e.g., cytokines that promote inflammation (von Bubnoff et al. (2003) Clinical and Experimental Dermatology 28 (2): 184–7).
  • the low-affinity receptor Fc ⁇ RII (CD23) is a C-type lectin.
  • Fc ⁇ RII has multiple functions as a membrane-bound or soluble receptor. It can also control B cell growth and differentiation and blocks IgE-binding of eosinophils, monocytes, and basophils (Kikutani et al. (1989) Ciba Foundation Symposium 147: 23–31).
  • the Fc region can be engineered to contain an antigen-binding site to generate an Fcab fragment (Wozniak-Knopp et al. (2010) Protein Eng Des 23 (4): 289–297).
  • Fcab fragments can be inserted into a full immunoglobulin by swapping the Fc region, thus obtaining a bispecific antibody (with both Fab and Fcab regions containing distinct binding sites).
  • the binding and recycling of FcRn can be illustrated below.
  • IgG and albumin are internalized into vascular endothelial cells through pinocytosis. The pH of the endosome is 6.0, facilitating association with membrane-bound FcRn.
  • endosomes can be processed in one of two ways: either recycling back to the apical cell membrane or transcytosis from the apical to the basolateral side.
  • IgG not associated with FcRn is degraded by lysosomes. While not wishing to be bound by theory, it is believed that FcRn interaction with IgG is mediated through Fc.
  • the binding of Fc to FcRn is pH specific, e.g., no significant binding at pH 7.4 and strong binding in acidic environment. Structure of FcRn in complex with Fc domain of IgG1 molecule is described, e.g., in FIG.1 of International Application Publication No. WO2018/052556 or U.S. Application Publication No.
  • Each FcRn molecule generally binds to an Fc- monomer.
  • Fab domains can also influence binding of IgG to FcRn, e.g., have either a negative or no influence on the affinity of the IgG for FcRn.
  • FcRn binds proximal to the linker region between CH2 and CH3 domains of a Fc region.
  • Modifications to the linker can impact Fc engagement with Fc ⁇ receptors. Modifications on the Fc region can impact thermal stability and aggregation properties of the polypeptide.
  • the polypeptide (e.g., antibody molecule or fusion protein) described herein has the same affinity function, or does not substantially alter (e.g., decrease by more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) an effector function (e.g., an effector function described herein).
  • the effector function is not associated with the binding between an Fc region and an FcRn.
  • the amino acid residues to be mutated can be selected, at least in part, based on the structural or functional properties of one or more binding sites on the Fc region.
  • binding sites include, but are not limited to, a Protein A binding site, a C1q binding site, an Fc ⁇ RI binding site, an Fc ⁇ RIIa binding site, an Fc ⁇ RIIIa binding site, or an FcRn binding site.
  • the binding sites can also include a TRIM21 binding site, e.g., one or more residues chosen from loop 308-316, loop 252-256, or loop 429-436 of an IgG.
  • the linker region between the CH2 and CH3 domain can influence the dynamics of the CH2 domain which impinges on Fc ⁇ R binding.
  • the polypeptide increases an effector function, e.g., by more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%. In an embodiment, the polypeptide increases an effector function, e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold. In an embodiment, the increased effector function comprises, e.g., one or more (e.g., two, three, or all) of a complement dependent cytotoxicity (CDC), an antibody dependent cell mediated cytotoxicity (ADCC), an antibody dependent cell mediated phagocytosis (ADCP), or an antibody dependent intracellular neutralization (ADIN), e.g., compared to a reference polypeptide.
  • CDC complement dependent cytotoxicity
  • ADCC antibody dependent cell mediated cytotoxicity
  • ADCP antibody dependent cell mediated phagocytosis
  • ADIN antibody dependent intracellular neutralization
  • the polypeptide has the same effector function, or does not substantially alter (e.g., decreases or increases by more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) an effector function, or increases an effector function (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), e.g., one or more (e.g., two, three, or all) of a complement dependent cytotoxicity (CDC), an antibody dependent cell mediated cytotoxicity (ADCC), an antibody dependent cell mediated phagocytosis (ADCP), or an antibody dependent intracellular neutralization (ADIN), compared to a reference polypeptide.
  • CDC complement dependent cytotoxicity
  • ADCC antibody dependent cell mediated cytotoxicity
  • ADCP antibody dependent cell mediated phagocytosis
  • ADIN antibody dependent intracellular neutralization
  • the polypeptide (e.g., antibody molecule or fusion protein) comprises a mutation in residue H310, a mutation in residue H433, or both.
  • One or more residues adjacent to residues H310 and/or H433 can also be mutated.
  • the polypeptide can also include a compensating or beneficial mutation, e.g., a mutation that compensates, or beneficial, for any of the aforesaid mutations, e.g., to reduce a negative consequence of that mutation (e.g., polar vs. non-polar, charged vs. no charge, positively-charged (basic) vs. negatively charged (acidic), or hydrophobic vs. hydrophilic).
  • P247D can be a compensating or beneficial mutation.
  • protonation of histidine can result in additional conformational changes including, e.g., movement/displacement of the linker/CH2/CH3 interface residues.
  • Design considerations for optimizing FcRn binding the polypeptide (e.g., antibody molecule or fusion protein) described herein can be designed for optimizing Fc-FcRn binding.
  • the polypeptide having a mutation in the Fc region has a pH-specific affinity enhancement, compared to a reference polypeptide (e.g., an otherwise identical polypeptide without the mutation).
  • affinity enhancement is achieved by increasing van der Waal interaction.
  • affinity enhancement is not achieved by introduction of hydrogen bonds and/or electrostatic interaction.
  • the mutation does not alter, or has reduced or minimal perturbation to, the conformation of the linker region between the CH2 and CH3 domains.
  • the polypeptide comprises a plurality of mutations across both domains (four quadrants). In an embodiment, the polypeptide does not contain a large cluster of hydrophobic or aromatic residues on the surface. In an embodiment, the polypeptide comprises a mutation that enhances the strength of interaction between an Fc region and FcRn or reduces the dissociation constant (K d ) for FcRn, e.g., at an acidic pH.
  • the polypeptide comprises a mutation that reduces the rate of dissociation (k off ) for FcRn, e.g., at an acidic pH. In an embodiment, the polypeptide comprises a mutation that increases the rate of association (k on ) for FcRn, e.g., at an acidic pH. In an embodiment, the polypeptide comprises a mutation that reduces the rate of dissociation (k off ) for FcRn, and increases the rate of association (k on ) for FcRn, e.g., at an acidic pH.
  • the polypeptide comprises a mutation that reduces the rate of dissociation (k off ) for FcRn, and does not, or does not significantly, affect the rate of association (k on ) for FcRn, e.g., at an acidic pH.
  • the reduction of the dissociation constant K d for FcRn is primarily resulted from the reduction of the rate of dissociation (k off ) for FcRn, rather than the increase of the rate of association (k on ).
  • the binding agents e.g., antibody molecules, featured in the disclosure, can be used to treat a subject, e.g., a subject, e.g., a human subject, infected with, or at risk for becoming infected with, an influenza virus.
  • the antibody molecule is for therapeutic use.
  • the antibody molecule is for prophylactic use. Any human is candidate to receive an antibody molecule featured in the disclosure for treatment or prevention of an infection by an influenza virus. Humans at high risk of infection, such as immunocompromised individuals, and humans who are at high risk of exposure to influenza virus are particularly suited to receive treatment with the antibody molecule.
  • Immunocompromised individuals include the elderly (65 years and older) and children (e.g., 6 months to 18 years old), and people with chronic medical conditions. People at high risk of exposure include heath care workers, teachers and emergency responders (e.g., firefighters, policemen).
  • the subject is hospitalized. In an embodiment, the subject is not hospitalized.
  • the antibody molecules described herein can also be used to prevent or reduce (e.g., minimize) secondary infection (e.g., secondary bacterial infection) or a risk of comprising secondary infection associated with influenza, or any effects (e.g., symptoms or complications) thereof on a subject.
  • Opportunistic secondary bacterial infections contribute significantly to the overall morbidity and mortality associated with seasonal and pandemic influenza infections.
  • the antibody molecules described herein can be used to prevent or reduce (e.g., minimize) the complications from secondary, opportunistic infections (e.g., bacterial infections) in a subject.
  • An antibody molecule can be administered to a subject, e.g., a human subject, by a variety of methods. For many applications, the route of administration is one of: intravenous injection or infusion, subcutaneous injection, or intramuscular injection.
  • An antibody molecule can be administered as a fixed dose, or in a mg/kg dose.
  • the antibody molecule can be administered intravenously (IV) or subcutaneously (SC).
  • IV intravenously
  • SC subcutaneously
  • the antibody molecule can be administered at a fixed unit dose of between about 50-600 mg IV, e.g., every 4 weeks, or between about 50-100 mg SC (e.g., 75 mg), e.g., at least once a week (e.g., twice a week).
  • the antibody molecule is administered IV at a fixed unit dose of 50 mg, 60 mg, 80 mg, 100 mg, 120 mg, 130 mg, 140 mg, 150 mg, 160 mg, 180 mg, 200 mg, 300 mg, 400 mg, 500 mg, or 600 mg or more.
  • An anti-HA antibody molecule featured in the disclosure can also be administered intravenously, such as a fixed unit dose between 500 mg and 5000 mg, e.g., between 500 mg and 4000 mg, between 500 mg and 3000 mg, between 1000 mg and 3000 mg, between 1500 mg and 3000 mg, between 2000 mg and 3000 mg, between 1800 mg and 2500 mg, between 2500 mg and 3000 mg, between 500 mg and 2500 mg, between 500 mg and 2000 mg, between 500 mg and 1500 mg, between 500 mg and 1000 mg, between 1000 mg and 2500 mg, between 1500 mg and 2000 mg, or between 2000 mg and 2500 mg, e.g., 1500 mg, 1600 mg, 1700 mg, 1800 mg, 1900 mg, 2000 mg, 2100 mg, 2200 mg, 2300 mg, 2400 mg, 2500 mg, 2600 mg, 2700 mg, 2800 mg, 2900 mg, 3000 mg, 3100 mg, 3
  • the antibody molecule is administered intravenously over a period of 1-3 hours, e.g., 1-2 hours or 2 to 3 hours, e.g., 2 hours.
  • the antibody molecule is administered as a single dose.
  • the antibody molecule is administered subcutaneously at a fixed unit dose of 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 100 mg, or 120 mg or more.
  • Administration of the SC dose can be once or twice or three times or more per week, or once every two, three, four, or five weeks, or less frequently.
  • An anti-HA antibody molecule featured in the disclosure can also be administered by inhalation, such as by intranasal or by oral inhalation, such as at a fixed unit dose of 50 mg, 60 mg, 80 mg, 100 mg, 120 mg, 130 mg, 140 mg, 150 mg, 160 mg, 180 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg, 1000 mg, 1100 mg, 1200 mg, 1300 mg, 1400 mg, 1500 mg, 1600 mg, 1700 mg, 1800 mg, 1900 mg, 2000 mg, 2100 mg, 2200 mg, 2300 mg, 2400 mg, 2500 mg, or more.
  • inhalation such as by intranasal or by oral inhalation, such as at a fixed unit dose of 50 mg, 60 mg, 80 mg, 100 mg, 120 mg, 130 mg, 140 mg, 150 mg, 160 mg, 180 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg, 1000 mg, 1100 mg, 1200 mg
  • the antibody molecule is administered in an amount that does not cause an ADE in the subject, e.g., as determined by a method described herein. In an embodiment, the antibody molecule is administered in an amount that does not cause viral resistance, e.g., as determined by a method described herein.
  • an anti-HA antibody is administered to a subject via vector-mediated gene transfer, such as through the delivery of a vector encoding the heavy chain and the light chain of an anti-HA antibody, and the antibody is expressed from the heavy chain and light chain genes in the body.
  • nucleic acids encoding a heavy chain and a light chain can be cloned in a AAV vector, such as a self-complementary AAV vector, the scAAV vector administered to a human by injection, such as by IM injection, and the antibody is expressed and secreted into the circulation of the human.
  • a AAV vector such as a self-complementary AAV vector
  • the scAAV vector administered to a human by injection, such as by IM injection, and the antibody is expressed and secreted into the circulation of the human.
  • An antibody molecule can also be administered in a bolus at a dose of between about 1 and 50 mg/kg, e.g., between about 1 and 10 mg/kg, between about 1 and 25 mg/kg or about 25 and 50 mg/kg, e.g., about 50 mg/kg, 25 mg/kg, 10 mg/kg, 6.0 mg/kg, 5.0 mg/kg, 4.0 mg/kg, 3.0 mg/kg, 2.0 mg/kg, 1.0 mg/kg, or less.
  • a dose of between about 1 and 50 mg/kg e.g., between about 1 and 10 mg/kg, between about 1 and 25 mg/kg or about 25 and 50 mg/kg, e.g., about 50 mg/kg, 25 mg/kg, 10 mg/kg, 6.0 mg/kg, 5.0 mg/kg, 4.0 mg/kg, 3.0 mg/kg, 2.0 mg/kg, 1.0 mg/kg, or less.
  • Modified dose ranges include a dose that is less than about 3000 mg/subject, about 1500 mg/subject, about 1000 mg/subject, about 600 mg/subject, about 500 mg/subject, about 400 mg/subject, about 300 mg/subject, about 250 mg/subject, about 200 mg/subject, or about 150 mg/subject, typically for administration every fourth week or once a month.
  • the antibody molecule can be administered, for example, every three to five weeks, e.g., every fourth week, or monthly. Dosing can be adjusted according to a patient’s rate of clearance of a prior administration of the antibody. For example, a patient may not be administered a second or follow-on dose before the level of antibodies in the patient’s system has dropped below a pre-determined level.
  • a sample from a patient e.g., plasma, serum, blood, urine, or cerebrospinal fluid (CSF)
  • CSF cerebrospinal fluid
  • the antibody may be prepared with a carrier that will protect the drug against rapid release, such as a controlled release formulation, including implants, and microencapsulated delivery systems.
  • a controlled release formulation including implants, and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known. See, e.g., Controlled Drug Delivery (Drugs and the Pharmaceutical Sciences), Second Edition, J. Robinson and V. H. L. Lee, eds., Marcel Dekker, Inc., New York, 1987. Pharmaceutical compositions can be administered with a medical device.
  • compositions can be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Patent Nos.5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556.
  • a needleless hypodermic injection device such as the devices disclosed in U.S. Patent Nos.5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556.
  • Examples of well-known implants and modules are discussed in, e.g., U.S. Patent No.4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Patent No.4,486,194, which discloses a therapeutic device for administering medicaments through the skin; U.S.
  • Patent No.4,447,233 which discloses a medication infusion pump for delivering medication at a precise infusion rate
  • U.S. Patent No.4,447,224 which discloses a variable flow implantable infusion apparatus for continuous drug delivery
  • U.S. Patent No.4,439,196 which discloses an osmotic drug delivery system comprising multi-chamber compartments
  • U.S. Patent No.4,475,196 which discloses an osmotic drug delivery system.
  • many other such implants, delivery systems, and modules are also known.
  • the binding agent e.g., an antibody molecule
  • the binding agent is administered buccally, orally, or by nasal delivery, e.g., as a liquid, spray, or aerosol, e.g., by topical application, e.g., by a liquid or drops, or by inhalation.
  • An antibody molecule described herein can be administered with one or more additional therapeutic agents, e.g., a second drug, for treatment of a viral infection, or a symptom of the infection.
  • the antibody molecule and the one or more second or additional agents can be formulated together, in the same formulation, or they can be in separate formulations, and administered to a patient simultaneously or sequentially, in either order.
  • Dosage regimens are adjusted to provide the desired response, such as a therapeutic response or a combinatorial therapeutic effect.
  • any combination of doses (either separate or co- formulated) of an antibody molecule and a second or additional agent can be used in order to provide a subject with both agents in bioavailable quantities.
  • Dosage unit form or “fixed dose” as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier and optionally in association with another agent.
  • a pharmaceutical composition may include a “therapeutically effective amount” of an agent described herein.
  • an agent may also vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the compound to elicit a desired response in the individual, such as amelioration of at least one infection parameter, or amelioration of at least one symptom of the infection, such as chills, fever, sore throat, muscle pain, headache, coughing, weakness, fatigue and general discomfort.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the composition are outweighed by the therapeutically beneficial effects.
  • administration of a binding agent e.g., antibody molecule, provided, e.g., as a pharmaceutical preparation
  • administration of a binding agent is by one of the following routes: oral, intravenous, intramuscular, intra-arterial, subcutaneous, intraventricular, transdermal, intradermal, rectal, intravaginal, intraperitoneal, topical (as by liquids, powders, ointments, creams, sprays, or drops), mucosal, nasal, buccal, enteral, sublingual; intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol.
  • routes is by one of the following routes: oral, intravenous, intramuscular, intra-arterial, subcutaneous, intraventricular, transdermal, intradermal, rectal, intravaginal, intraperitoneal, topical (as by liquids, powders, ointments, creams, sprays, or drops), muco
  • the method described herein further comprises determining the presence or absence of an anti-drug antibody (ADA) in the subject.
  • the subject is selected for administration of an antibody molecule described herein on the basis of the absence of an ADA in the subject.
  • ADA can be detected, e.g., by ELISA, in a sample from the subject.
  • Combination Treatments and Exemplary Second or Additional Agents Binding agents, e.g., antibody molecules, provided e.g., as pharmaceutical compositions, can be administered either alone or in combination with one or more other therapy, e.g., the administration of a second or additional therapeutic agent.
  • the combination can result in a lower dose of the antibody molecule or of the other therapy being needed, which, in some embodiments, can reduce side effects. In some embodiments, the combination can result in enhanced delivery or efficacy of one or both agents.
  • the agents or therapies can be administered at the same time (e.g., as a single formulation that is administered to a patient or as two separate formulations administered concurrently) or sequentially in any order.
  • Such second or additional agents include vaccines, anti-viral agents, and/or additional antibodies. In typical embodiments the second or additional agent is not co-formulated with the binding agent, e.g., antibody molecule, though in others it is.
  • the binding agent e.g., antibody molecule
  • the second or additional agent are administered such that one or more of the following is achieved: therapeutic levels, or therapeutic effects, of one overlap the other; detectable levels of both are present at the same time; or the therapeutic effect is greater than what would be seen in the absence of either the binding agent, e.g., antibody molecule, or the second or additional agent.
  • each agent will be administered at a dose and on a time schedule determined for that agent.
  • the second or additional agent can be, for example, for treatment or prevention of influenza.
  • the binding agents e.g., antibody molecules, e.g., therapeutic antibodies, provided herein can be administered in combination with a vaccine, e.g., a vaccine described herein or a mixture (a.k.a. a cocktail) of influenza peptides to stimulate the patient’s immune system to prevent infection with particular strains of influenza A.
  • a vaccine e.g., a vaccine described herein or a mixture (a.k.a. a cocktail) of influenza peptides to stimulate the patient’s immune system to prevent infection with particular strains of influenza A.
  • the second or additional agent is an anti-viral agent (e.g., an anti-NA or anti-M2 agent), a pain reliever, an anti-inflammatory, an antibiotic, a steroidal agent, a second therapeutic antibody molecule (e.g., an anti-HA antibody), an adjuvant, a protease or glycosidase (e.g., sialidase), etc.
  • an anti-viral agent e.g., an anti-NA or anti-M2 agent
  • a pain reliever e.g., an anti-inflammatory
  • an antibiotic e.g., a steroidal agent
  • a second therapeutic antibody molecule e.g., an anti-HA antibody
  • an adjuvant e.g., a protease or glycosidase (e.g., sialidase)
  • a protease or glycosidase e.g., sialidase
  • NAIs neuraminidase inhibitors
  • Baloxavir marboxil may also be used for treating hospitalized patients with influenza.
  • anti-viral agents include, e.g., vaccines, neuraminidase inhibitors or nucleoside analogs.
  • Exemplary anti-viral agents can include, e.g., zidovudine, gangcyclovir, vidarabine, idoxuridine, trifluridine, foscarnet, acyclovir, ribavirin, amantadine, remantidine, saquinavir, indinavir, ritonavir, alpha-interferons and other interferons, a neuraminidase inhibitor (e.g., zanamivir (Relenza®), oseltamivir (Tamiflu®), laninamivir, peramivir), rimantadine, a PB2 inhibitor (e.g., pimodivir), and an endonuclease inhibitor (e.g., the cap-dependent endonuclease inhibitor, e.g., baloxavir marboxil).
  • zidovudine gangcyclovir
  • vidarabine idoxuridine
  • trifluridine
  • the antiviral agent is an endonuclease (e.g., cap-dependent endonuclease (CEN) inhibitor or an PA (viral RNA polymerase PA subunit) inhibitor.
  • the endonuclease inhibitor or PA inhibitor is baloxavir. Baloxavir is described, e.g., in Antiviral Res.2018; 160: 109-117, the content of which is incorporated by reference in its entirety.
  • Cap- dependent endonuclease (CEN) resides in the PA subunit of the influenza virus and mediates the critical "cap-snatching" step of viral RNA transcription.
  • Baloxavir acid is generally considered to be an active form of baloxavir marboxil (BXM). Without wishing to be bound by theory, it is believed that in an embodiment, BXA can inhibit both viral RNA transcription via selective inhibition of CEN activity and viral replication.
  • the antiviral agent is an inhibitor of influenza virus basic protein 2 (PB2), a component of the viral RNA replication complex.
  • PB2 inhibitor is pimodivir. Pimodivir is described, e.g., in Nucleic Acids Res.2018; 46(2): 956–971, the content of which is incorporated by reference in its entirety.
  • Influenza RNA-dependent RNA polymerase is typically a heterotrimer with subunits PA, PB1 and PB2.
  • RNA genome segments binds the conserved 3′ and 5′ ends of each of the eight negative-sense RNA genome segments and is responsible for transcription and replication of the genomic RNA in the nucleus of infected cells. Transcription is typically initiated by short capped primers originated from nascent host Pol II transcripts, and therefore a host sequence of 10-14 nucleotides in length precede the virally encoded sequences in the resultant chimeric viral mRNA.
  • Exemplary second antibody molecules include, for example, Ab 67-11 (U.S. Provisional application number 61/645,453, FI6 (U.S. Application Publication No.2010/0080813), FI28 (U.S.
  • Ab 044 can be used in combination of any of those antibodies.
  • two or more binding agents e.g., antibody molecules disclosed herein, can be administered in combination, e.g., Ab 044 can be administered in combination with Ab 032.
  • two agents can be administered as part of the same dosage unit or administered separately.
  • Other exemplary agents useful for treating the symptoms associated with influenza infection are acetaminophen, ibuprofen, aspirin, and naproxen.
  • the antibody molecule and the second or additional agent are provided as a co-formulation, and the co-formulation is administered to the subject. It is further possible, e.g., at least 24 hours before or after administering the co-formulation, to administer separately one dose of the antibody formulation and then one dose of a formulation containing a second or additional agent.
  • the antibody molecule and the second or additional agent are provided as separate formulations, and the step of administering includes sequentially administering the antibody molecule and the second or additional agent.
  • the sequential administrations can be provided on the same day (e.g., within one hour of one another or at least 3, 6, or 12 hours apart) or on different days.
  • the antibody molecule and the second or additional agent are each administered as a plurality of doses separated in time.
  • the antibody molecule and the second or additional agent are generally each administered according to a regimen.
  • the regimen for one or both may have a regular periodicity.
  • the regimen for the antibody molecule can have a different periodicity from the regimen for the second or additional agent, e.g., one can be administered more frequently than the other.
  • one of the antibody molecule and the second or additional agent is administered once weekly and the other once monthly.
  • one of the antibody molecule and the second or additional agent is administered continuously, e.g., over a period of more than 30 minutes but less than 1, 2, 4, or 12 hours, and the other is administered as a bolus.
  • sequential administrations are administered.
  • the time between administration of the one agent and another agent can be minutes, hours, days, or weeks.
  • the use of an antibody molecule described herein can also be used to reduce the dosage of another therapy, e.g., to reduce the side-effects associated with another agent that is being administered.
  • a combination can include administering a second or additional agent at a dosage at least 10, 20, 30, or 50% lower than would be used in the absence of the antibody molecule.
  • the antibody molecule and the second or additional agent can be administered by any appropriate method, e.g., subcutaneously, intramuscularly, or intravenously.
  • each of the antibody molecule and the second or additional agent is administered at the same dose as each is prescribed for monotherapy.
  • the antibody molecule is administered at a dosage that is equal to or less than an amount required for efficacy if administered alone.
  • the second or additional agent can be administered at a dosage that is equal to or less than an amount required for efficacy if administered alone.
  • the formulations described herein include one or more second or additional agents, or are administered in combination with a formulation containing one or more second or additional agents.
  • a binding agent e.g., antibody molecule, provided, e.g., as a pharmaceutical preparation, is administered by inhalation or aerosol delivery of a plurality of particles, e.g., particles comprising a mean particle size of 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 microns.
  • Pharmaceutical Compositions The binding agents, e.g., antibody molecules, featured in the disclosure can be formulated as pharmaceutical compositions, such as for the treatment or prevention of influenza.
  • a pharmaceutical composition typically includes a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • pharmaceutically acceptable salt refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S.M., et al. (1977) J. Pharm. Sci.66:1-19). Examples of such salts include acid addition salts and base addition salts.
  • Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
  • Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N'- dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
  • alkaline earth metals such as sodium, potassium, magnesium, calcium and the like
  • nontoxic organic amines such as N,N'- dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
  • compositions are a well-established art, and is further described in Gennaro (ed.), Remington: The Science and Practice of Pharmacy, 20 th ed., Lippincott, Williams & Wilkins (2000) (ISBN: 0683306472); Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7 th Ed., Lippincott Williams & Wilkins Publishers (1999) (ISBN: 0683305727); and Kibbe (ed.), Handbook of Pharmaceutical Excipients American Pharmaceutical Association, 3 rd ed. (2000) (ISBN: 091733096X). Pharmaceutical compositions may be in a variety of forms.
  • liquid, semi-solid and solid dosage forms such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories.
  • liquid solutions e.g., injectable and infusible solutions
  • dispersions or suspensions tablets, pills, powders, liposomes and suppositories.
  • the form can depend on the intended mode of administration and therapeutic application.
  • compositions for the agents described herein are in the form of injectable or infusible solutions.
  • Such compositions can be administered by a parenteral mode (e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection).
  • parenteral administration and “administered parenterally” as used herein mean modes of administration other than enteral and topical administration, usually by injection, and include, without limitation, intravenous, intramuscular (IM), intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and by intrasternal injection or by infusion.
  • Pharmaceutical compositions may be provided in a sterile injectable form (e.g., a form that is suitable for subcutaneous injection or intravenous infusion).
  • compositions are provided in a liquid dosage form that is suitable for injection or topical application.
  • pharmaceutical compositions are provided as in dry form, e.g., as powders (e.g. lyophilized and/or sterilized preparations).
  • the Pharmaceutical composition can be provided under conditions that enhance stability, e.g., under nitrogen or under vacuum. Dry material can be reconstituted with an aqueous diluent (e.g., water, buffer, salt solution, etc.) prior to injection.
  • the pharmaceutical composition containing an anti-HA antibody is administered intranasally.
  • the pharmaceutical composition containing an anti-HA antibody is administered by inhalation, such as by oral or by nasal inhalation.
  • the pharmaceutical composition is suitable for buccal, oral or nasal delivery, e.g., as a liquid, spray, or aerosol, e.g., by topical application, e.g., by a liquid or drops, or by inhalation).
  • a pharmaceutical preparation comprises a plurality of particles, suitable, e.g., for inhaled or aerosol delivery. In some embodiments, the mean particle size of 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 microns.
  • a pharmaceutical preparation is formulated as a dry powder, suitable, e.g., for inhaled or aerosol delivery.
  • a pharmaceutical preparation is formulated as a wet powder, through inclusion of a wetting agent, e.g., water, saline, or other liquid of physiological pH.
  • a pharmaceutical preparation is provided as drops, suitable, e.g., for delivery to the nasal or buccal cavity.
  • the pharmaceutical composition is disposed in a delivery device, e.g., a syringe, a dropper or dropper bottle, an inhaler, or a metered dose device, e.g., an inhaler.
  • a pharmaceutical composition contains a vector, such as an adenovirus- associated virus (AAV)-based vector, that encodes a heavy chain of an anti-HA antibody molecule, and a light chain of an anti-HA antibody molecule featured in the disclosure.
  • the composition containing the vector can be administered to a subject, such as a patient, such as by injection, e.g., IM injection.
  • Genes encoding the anti-HA antibody under control of, for example, cytomegalovirus (CMV) promoters are expressed in the body, and the recombinant anti-HA antibody molecule is introduced into the circulation. See, e.g., Balazs et al., Nature 30:481:81-84, 2011.
  • CMV cytomegalovirus
  • compositions typically should be sterile and stable under the conditions of manufacture and storage. A pharmaceutical composition can also be tested to insure it meets regulatory and industry standards for administration.
  • the composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
  • Sterile injectable solutions can be prepared by incorporating an agent described herein in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating an agent described herein into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • sterile powders for the preparation of sterile injectable solutions typical methods of preparation are vacuum drying and freeze-drying that yields a powder of an agent described herein plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • a pharmaceutical composition may be provided, prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
  • a bulk preparation will contain at least 2, 5, 10, 20, 50, or 100 unit doses.
  • a unit dose is typically the amount introduced into the patient in a single administration. In some embodiments, only a portion of a unit dose is introduced. In some embodiments, a small multiple, e.g., as much as 1.5, 2, 3, 5, or 10 times a unit dose is administered.
  • the amount of the active ingredient is generally equal to a dose which would be administered to a subject and/or a convenient fraction of such a dose such as, for example, one-half or one-third of such a dose.
  • the pharmaceutical composition comprises an antibody molecule as described herein, e.g., at a concentration greater than about 100 mg/mL (e.g., greater than about 100, 110, 120, 130, 140, 148, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, or 250 mg/mL).
  • an antibody molecule as described herein is formulated at a concentration greater than about 100 mg/mL (e.g., greater than about 100, 110, 120, 130, 140, 148, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, or 250 mg/mL).
  • Epitope HAs exist in nature as homotrimers of proteolytically processed mature subunits. Each subunit of the trimer is synthesized as a precursor. A precursor molecule is proteolytically processed into two disulfide bonded polypeptide chains to form a mature HA polypeptide.
  • the mature HA polypeptide includes two domains: (1) a core HA-1 domain that extends from the base of the molecule through the fibrous stem to the membrane distal head region that contains the glycan receptor binding domain, returning to fibrous region ending in the cleavage site, and (2) HA-2 domain that includes the stem region and the transmembrane domain of HA.
  • HA-1 includes a glycan binding site.
  • the glycan binding site may be responsible for mediating binding of HA to the HA-receptor.
  • the HA-2 domain acts to present the HA-1 domain.
  • the HA trimer can be stabilized by polar and non-polar interactions between the three long HA alpha-helices of the stem of HA monomers.
  • HA sequences from all influenza subtypes share a set of amino acids in the interface of the HA-1 and HA-2 domains that are well conserved.
  • the HA-1/HA-2 interface membrane proximal epitope region (MPER) that includes the canonical ⁇ -helix and residues in its vicinity are also conserved across a broad spectrum of subtypes.
  • the antibody molecules described herein can have high affinity for HA’s from Group 1 and Group 2. They typically bind a conformational epitope that is broadly conserved across a plurality of influenza strains. Numerous amino acid residues distributed along the linear sequences of HA from different strains/subtypes contribute the conformational epitope.
  • the antibody molecule binds to a conserved and constrained epitope on HA (e.g., in the stem or stalk region), e.g., a region that is associated with the structural and functional integrity, common across multiple influenza strains, and/or resistant to mutations.
  • the antibody molecule binds to the same, or essentially the same, epitope as FX-0-1-m3.
  • FX-0-1-m3 also known as Ab 044 is described, e.g., in PCT Application Publication Nos. WO 2013/170139 and WO 2017/083627, U.S.
  • binding agents e.g., antibody molecules
  • a biological sample e.g., a patient sample, such as a fluid sample, e.g., a blood, serum, saliva, mucous, or urine sample, or a tissue sample, such as a biopsy.
  • a patient sample is contacted with a binding agent, e.g., an antibody molecule, featured in the disclosure, and binding is detected.
  • Binding can be detected with a number of formats and means of detection, e.g., with an antigen capture assay, such as an ELISA assay or Western blot, or an immunohistochemistry assay.
  • the binding agent e.g., an antibody molecule
  • the binding agent is provided, e.g., coupled to an insoluble matrix, e.g., a bead or other substrate, and a detection molecule used to detect binding of HA.
  • Binding of binding agent, e.g., antibody molecule, to HA can be detected with a reagent comprising a detectable moiety, e.g., a reagent, e.g., an antibody, which binds the binding agent, e.g., antibody molecule.
  • a reagent e.g., an antibody
  • the binding agent e.g., antibody molecule
  • Suitable detectable moieties include enzymes (e.g., horseradish peroxidase, beta- galactosidase, luciferase, alkaline phosphatase, acetylcholinesterase, glucose oxidase and the like), radiolabels (e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I), haptens, fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors, fluorescein, fluorescein isothiocyanate, rhodamine, 5- dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin and the like), phosphorescent molecules, chemiluminescent molecules, chromophores, luminescent molecules, photoaffinity molecules, colored particles or affinity ligands, such as biotin, predetermined polypeptide epitopes
  • labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
  • a human is tested for presence of influenza virus be a method described herein, and if the test is positive, binding agents, e.g., antibody molecules, e.g., an antibody provided herein, is administered.
  • the binding agents, e.g., antibody molecules, e.g., an antibody, provided herein can be used for cytology assays, such as to identify an HA in a cell.
  • the assay can be a colorimetric assay.
  • a biological sample from a normal (non-infected) individual is used as a control.
  • the diagnostic assay can be performed in vitro.
  • the diagnostic assay can also be performed to determine infection of cells in culture, e.g., of mammalian cells in culture.
  • the antibody molecules can be used in in vitro assays. Because the antibody molecules featured herein bind a broad spectrum of HA subtypes, the diagnostic assays featured in the disclosure can detect the presence of influenza virus in patients infected with a variety of distinct strains of influenza. A patient sample can be further tested with subtype specific antibodies, or other assays (e.g., RFLP (Restriction Fragment Length Polymorphism), PCR (Polymerase Chain Reaction), RT-PCR (Reverse Transcription coupled to Polymerase Chain Reaction), Northern blot, Southern blot or DNA sequencing) to further determine the particular strain of virus.
  • RFLP Restriction Fragment Length Polymorphism
  • PCR Polymerase Chain Reaction
  • RT-PCR reverse Transcription coupled to Polymerase Chain Reaction
  • Northern blot Southern blot or DNA sequencing
  • a patient determined to be infected with influenza A can be further administered an antibody molecule featured in the disclosure, to treat the infection.
  • solid substrates e.g., beads, dipsticks, arrays, and the like, on which is disposed a binding agent, e.g., antibody molecule.
  • Kits A binding agent, e.g., an antibody molecule, disclosed herein, e.g., generated by the methods described herein, can be provided in a kit, e.g., for use in a method described herein.
  • the kit can include one or more other components, e.g., containers, buffers or other diluents, delivery devices, and the like.
  • the kit includes materials for administering an antibody molecule to a subject, such as for treatment or prevention of infection by influenza viruses.
  • the kit can include one or more or all of: (a) a container that contains a composition that includes an antibody molecule, optionally (b) a container that contains a composition that includes a second therapeutic agent, and optionally (c) informational material.
  • the kit includes materials for using an antibody molecule in a diagnostic assay, such as for detection of HA in a biological sample.
  • the kit can include one or more or all of: (a) a container that contains a composition that includes an antibody molecule, optionally (b) a container that contains a reagents, e.g., labeled with a detectable moiety, to detect the antibody, e.g., for use in an ELISA or immunohistochemistry assay, and optionally (c) informational material.
  • the kit comprises a binding agent, e.g., antibody molecule, comprising a detectable moiety.
  • the kit comprises a solid substrate, e.g., bead, dipstick, array, and the like, on which is disposed a binding agent, e.g., antibody molecule.
  • the informational material can be descriptive, instructional, marketing or other material that relates to the methods described herein and/or the use of the agents for therapeutic benefit, or for a diagnostic assay.
  • the informational material of the kits is not limited in its form.
  • the informational material can include information about production of the antibody, concentration, date of expiration, batch or production site information, and so forth.
  • the informational material relates to methods of administering the antibody, e.g., in a suitable dose, dosage form, or mode of administration (e.g., a dose, dosage form, or mode of administration described herein), to treat a subject who has an infection, e.g., viral infection or secondary infection (e.g., secondary bacterial infection).
  • the informational material relates to methods for using the antibody molecule for a diagnostic assay, e.g., to detect the presence of influenza viruses in a biological sample.
  • the information can be provided in a variety of formats, including printed text, computer readable material, video recording, or audio recording, or information that provides a link or address to substantive material.
  • the composition in the kit can include other ingredients, such as a solvent or buffer, a stabilizer, or a preservative.
  • the agent can be provided in any form, e.g., a liquid, dried or lyophilized form, and substantially pure and/or sterile. When the agents are provided in a liquid solution, the liquid solution typically is an aqueous solution.
  • the kit can include one or more containers for the composition or compositions containing the agents.
  • the kit contains separate containers, dividers or compartments for the composition and informational material.
  • the composition can be contained in a bottle, vial, or syringe, and the informational material can be contained in a plastic sleeve or packet.
  • the separate elements of the kit are contained within a single, undivided container.
  • the composition is contained in a bottle, vial or syringe that has attached thereto the informational material in the form of a label.
  • the kit includes a plurality (e.g., a pack) of individual containers, each containing one or more units of dosage forms (e.g., a dosage form described herein) of the agents.
  • the containers can include a combination unit dosage, e.g., a unit that includes both the antibody molecule and the second or additional agent, such as in a desired ratio.
  • the kit can include a plurality of syringes, ampoules, foil packets, blister packs, or medical devices each containing, for example, a single combination unit dose.
  • kits can be airtight, waterproof (e.g., impermeable to changes in moisture or evaporation), and/or light-tight.
  • the kit optionally includes a device suitable for administering the composition, e.g., a syringe or device for delivering particles or aerosols, e.g., an inhaler, a spray device, or a dropper or other suitable delivery device.
  • the device can be provided pre-loaded with one or both of the agents or can be empty but suitable for loading.
  • the antibody molecule described herein can be encoded by a nucleic acid molecule, e.g., an isolated nucleic acid molecule.
  • the nucleic acid molecule comprises a nucleotide sequence that encodes a heavy chain immunoglobulin variable region segment featured in the disclosure.
  • the nucleic acid molecule comprises a nucleotide sequence encoding a light chain immunoglobulin variable region segment featured in the disclosure.
  • the nucleic acid molecule comprises a nucleotide sequence that encodes a heavy chain immunoglobulin variable region segment featured in the disclosure and a light chain immunoglobulin variable region segment featured in the disclosure.
  • the nucleic acid molecule is present in a vector, e.g., a recombinant vector (e.g., an expression vector).
  • the vector comprises a nucleic acid molecule that comprises a nucleotide sequence that encodes a heavy chain immunoglobulin variable region segment featured in the disclosure, a nucleotide sequence that encodes a light chain immunoglobulin variable region segment featured in the disclosure, or both.
  • the antibody molecule described herein is produced from a cell containing a recombinant vector featured in the disclosure, such as a recombinant vector comprising a nucleic acid sequence that encodes a heavy chain immunoglobulin variable region, or a recombinant vector comprising a nucleic acid sequence that encodes a light chain immunoglobulin variable region.
  • the cell contains a recombinant vector comprising a nucleic acid sequence that encodes a heavy chain immunoglobulin variable region, and a recombinant vector comprising a nucleic acid sequence that encodes a light chain immunoglobulin variable region.
  • the cell contains a recombinant vector comprising a nucleic acid sequence that encodes a heavy chain immunoglobulin variable region, and a nucleic acid sequence that encodes a light chain immunoglobulin variable region.
  • the antibody molecule is produced, e.g., by providing a host cell comprising a nucleic acid sequence expressing a heavy chain segment and a nucleic acid sequence expressing a light chain segment and expressing the nucleic acids in the host cell.
  • the nucleic acid sequence expressing the heavy chain segment and the nucleic acid sequence expressing the light chain segment are on the same recombinant expression vector.
  • nucleic acid sequence expressing the heavy chain segment and the nucleic acid sequence expressing the light chain segment are on separate recombinant expression vectors.
  • a pharmaceutical composition containing an antibody molecule featured in the disclosure, and a pharmaceutically acceptable carrier, is used in a method described herein.
  • the method described herein treats or prevents an infection with an influenza virus (e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004, in a subject, e.g., a human subject, that comprises: administering a binding agent, e.g., an antibody molecule, featured in the disclosure to a subject, e.g., human subject, in need thereof.
  • a binding agent e.g., an antibody molecule
  • influenza A virus is an H1, H5, H9, H3 or H7 strain, such as an H1N1 strain, an H3N2 strain, or an H5N1 strain of influenza A virus.
  • the administration results in, or correlates with, one or more of a reduction in the incidence or severity of a symptom or manifestation of an influenza infection, or the delay or onset of a symptom or manifestation of an influenza infection.
  • the administration results in, or correlates with, one or more of a reduction in the incidence or severity of a symptom or manifestation of a secondary infection, or the delay or onset of a symptom or manifestation of a secondary infection.
  • the subject e.g., a human subject
  • the method comprises, administering, or recommending the administration of, a second or additional therapy.
  • the antibody molecule is administered in combination with a second or additional agent or therapy.
  • the second or additional therapy comprises administration of a vaccine or an anti-viral therapy, e.g., an anti-NA or an anti-M2 therapy.
  • the second or additional therapy comprises an administration of a vaccine, e.g., a vaccine described herein or a mixture (a.k.a. a cocktail) of influenza peptides to stimulate the patient’s immune system to prevent infection with particular strains of influenza A.
  • the second or additional agent comprises administering an anti-viral agent, a pain reliever, an anti- inflammatory, an antibiotic, a steroidal agent, a second therapeutic antibody molecule (e.g., an anti- HA antibody), an adjuvant, a protease or glycosidase (e.g., sialidase).
  • the second or additional agent comprises, acyclovir, ribavirin, amantadine, rimantadine, a neuraminidase inhibitor (e.g., zanamivir (Relenza®), oseltamivir (Tamiflu®), laninamivir, peramivir), or rimantadine.
  • the second or additional agent comprises a second antibody molecule, e.g., an anti-HA antibody disclosed in PCT Application Publication Nos. WO 2013/170139 (e.g., Ab 044), an anti-HA antibody disclosed in PCT Application Publication No. WO 2013/169377, FI6 (U.S. Application Publication No.2010/0080813), FI28 (U.S. Application Publication No.2010/0080813), C179 (Okuno et al., J. Virol.67:2552-8, 1993), F10 (Sui et al., Nat. Struct. Mol.
  • a second antibody molecule e.g., an anti-HA antibody disclosed in PCT Application Publication Nos. WO 2013/170139 (e.g., Ab 044), an anti-HA antibody disclosed in PCT Application Publication No. WO 2013/169377, FI6 (U.S. Application Publication No.2010/0080813), FI28 (U.S. Application Publication
  • the second or additional agent comprises a second or additional binding agent, e.g., antibody molecule, e.g., an anti-HA antibody, e.g., an anti-HA antibody disclosed herein.
  • a second or additional binding agent e.g., antibody molecule, e.g., an anti-HA antibody, e.g., an anti-HA antibody disclosed herein.
  • two agents can be administered as part of the same dosage unit or administered separately.
  • the binding agent e.g., an antibody molecule
  • the binding agent is administered to a human subject suffering from or susceptible to an influenza infection.
  • the binding agent e.g., an antibody molecule
  • the binding agent is administered prior to known exposure to influenza, or to particular influenza subtypes or strains.
  • the binding agent e.g., an antibody molecule
  • the binding agent e.g., an antibody molecule
  • the binding agent is administered after known exposure to influenza, or to particular influenza subtypes or strains.
  • the binding agent e.g., an antibody molecule
  • the binding agent e.g., an antibody molecule
  • the binding agent is administered in response to, or to treat or prevent, a manifestation of an effect or a symptom of influenza infection, e.g., inflammation, fever, nausea, weight loss, loss of appetite, rapid breathing, increase heart rate, high blood pressure, body aches, muscle pain, eye pain, fatigue, malaise, dry cough, runny nose, and/or sore throat.
  • the method further comprises, testing the human subject for the influenza virus, e.g., with a method disclosed herein.
  • the administration is responsive to a positive test for influenza.
  • the method described herein treats a subject, e.g., a human subject, an infected with an influenza virus (e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004, by administering a binding agent, e.g., an antibody molecule, featured in the disclosure.
  • an influenza virus e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009
  • an H5N1 strain e.
  • influenza A virus is an H1, H5, H9, H3 or H7 strain, such as an H1N1 strain, an H3N2 strain, or an H5N1 strain of influenza A virus.
  • a binding agent e.g., an anti-HA antibody, described herein is administered instead of a vaccine for prevention of influenza.
  • the binding agent e.g., anti-HA antibody molecule, is administered in combination with (simultaneously or sequentially with) a vaccine for prevention of the flu.
  • the method further comprises detecting influenza (e.g., influenza A) virions in a biological sample, such as by contacting the sample with a binding agent, e.g., an antibody molecule, featured in the disclosure, and then detecting the binding of the antibody molecule to the sample.
  • influenza virus e.g., influenza A virus
  • the method of detecting the influenza virus is performed in vitro.
  • the method further includes: (a) providing a sample from a patient; (b) contacting the sample with a binding agent, e.g., an antibody molecule, featured in the disclosure, and (c) determining whether the binding agent, e.g., an antibody molecule, featured in the disclosure binds a polypeptide in the sample, where if the binding agent, e.g., an antibody molecule, binds a polypeptide in the sample, then the patient is determined to be infected with an influenza virus (e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004).
  • an influenza virus e.g., an influenza A
  • the patient is determined to be infected with an influenza virus (e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004), and the patient is further administered a binding agent, e.g., an antibody molecule, disclosed herein, e.g., the binding agent, e.g., an antibody molecule, with which the test was performed.
  • an influenza virus e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California
  • the administration results in, or correlates with, one or more of: a reduction in the chance of an infection, a reduction in the incidence or severity of a symptom or manifestation of an influenza infection, or the delay or onset of a symptom or manifestation of an influenza infection. In an embodiment, the administration results in, or correlates with, one or more of: a reduction in the incidence or severity of a symptom or manifestation of a secondary infection, or the delay or onset of a symptom or manifestation of a secondary infection.
  • the subject e.g., a human subject, has been administered, or the method comprises, administering, or recommending the administration of, a second or additional therapy.
  • the broad range vaccine is administered in combination with a second or additional agent or therapy.
  • the second or additional agent comprises administration of another vaccine or another anti-viral therapy, e.g., an anti-NA or an anti-M2 therapy.
  • the second or additional agent comprises administration of a vaccine comprising a mixture (a.k.a. a cocktail) of influenza peptides to stimulate the patient’s immune system to prevent infection with particular strains of influenza A.
  • the second or additional agent comprises administering an anti-viral agent, a pain reliever, an anti-inflammatory, an antibiotic, a steroidal agent, a second therapeutic antibody molecule (e.g., an anti-HA antibody), an adjuvant, a protease or glycosidase (e.g., sialidase).
  • the second or additional agent comprises, acyclovir, ribavirin, amantadine, rimantadine, a neuraminidase inhibitor (e.g., zanamivir (Relenza®), oseltamivir (Tamiflu®), laninamivir, peramivir), or rimantadine.
  • the second or additional agent comprises an antibody molecule, e.g., an anti-HA antibody disclosed in PCT Application Publication Nos. WO 2013/170139 (e.g., Ab 044), an anti-HA antibody disclosed in PCT Application Publication No. WO 2013/169377, FI6 (U.S. Application Publication No.2010/0080813), FI28 (U.S. Application Publication No.2010/0080813), C179 (Okuno et al., J. Virol.67:2552-8, 1993), F10 (Sui et al., Nat. Struct. Mol.
  • an antibody molecule e.g., an anti-HA antibody disclosed in PCT Application Publication Nos. WO 2013/170139 (e.g., Ab 044), an anti-HA antibody disclosed in PCT Application Publication No. WO 2013/169377, FI6 (U.S. Application Publication No.2010/0080813), FI28 (U.S. Application Publication No.2010/
  • the second or additional agent comprises an antibody molecule disclosed herein, e.g., an antibody molecule selected from Ab-044, Ab 069, Ab 032, and Ab 031 antibody molecules.
  • two agents can be administered as part of the same dosage unit or administered separately.
  • Other exemplary second or additional agents useful for treating the symptoms associated with influenza infection are acetaminophen, ibuprofen, aspirin, and naproxen.
  • the method further comprises, testing the human subject for the influenza virus, e.g., with a method disclosed herein.
  • the administration is responsive to a positive test for influenza.
  • the method further comprises reducing the severity of influenza in a population.
  • the method includes administering a broad range vaccine, or broad range immunogen, to sufficient individuals in the population to prevent or decrease the chance of influenza virus transmission to another individual in the population. Additional aspects and embodiments are provided in the numbered paragraphs below. 1.
  • An anti-hemagglutinin (HA) antibody molecule (e.g., an isolated anti-HA antibody molecule) comprising (a) one, two, or all of CDR1, CDR2, or CDR3 of a heavy chain variable region segment described herein (e.g., one, two, or all of CDR1, CDR2, or CDR3 of the heavy chain variable region of any one of VH1 through VH184); (b) one, two, or all of CDR1, CDR2, or CDR3 of a light chain variable region segment described herein (e.g., one, two, or all of CDR1, CDR2, or CDR3 of the light chain variable region of any one of VK-1 through VK-111); or (c) both (a) and (b), provided that the antibody molecule does not comprises all of CDR1, CDR2, or CDR3 of the heavy chain variable region VH0 and all of CDR1, CDR2, or CDR3 of a light chain variable region the light chain variable region VK-0.
  • the antibody molecule of paragraph 1 comprising CDR1, CDR2, and CDR3 of the heavy chain variable region segment and CDR1, CDR2, and CDR3 of the light chain variable region segment. 3.
  • the antibody molecule of paragraph 1 or 2 comprising the heavy chain variable region segment, the light chain variable region segment, or both.
  • 4. The antibody molecule of any of paragraphs 1-3, comprising the heavy chain variable region segment and the light chain variable region segment. 5.
  • the antibody molecule of any of paragraphs 1-4 comprising (a) a heavy chain variable region segment comprising the CDR1, CDR2, and CDR3 of the heavy chain variable region VH123, VH148, or VH175; and (b) a light chain variable region segment comprising the CDR1, CDR2, or CDR3 of the light chain variable region VK-65.
  • the antibody molecule of any of paragraphs 1-5 further comprising an Fc region.
  • the antibody molecule of paragraph 6, wherein the Fc region comprises a mutation.
  • 8. The antibody molecule of any of paragraphs 1-7 comprising an Fc region comprising the mutations of FcMut215.
  • the antibody molecule of any of paragraphs 1-8, wherein the heavy chain variable region segment comprises the CDR1, CDR2, and CDR3 of the heavy chain variable region VH123. 10. The antibody molecule of any of paragraphs 1-8, wherein the heavy chain variable region segment comprises the CDR1, CDR2, and CDR3 of the heavy chain variable region VH148. 11. The antibody molecule of any of paragraphs 1-8, wherein the heavy chain variable region segment comprises the CDR1, CDR2, and CDR3 of the heavy chain variable region VH175. 12. The antibody molecule of any of paragraphs 1-11, comprising the amino acid sequence of heavy chain variable region VH123, VH148, or VH175, or an amino acid sequence at least 85%, 90%, 95%, 98%, or 99% identical thereto. 13.
  • the antibody molecule of paragraph 12 comprising the amino acid sequence of heavy chain variable region VH123, or an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical thereto or differing by no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids therefrom. 14.
  • the antibody molecule of paragraph 12 comprising the amino acid sequence of heavy chain variable region VH148, or an amino acid sequence at least 85%, 90%, 95%, 98%, or 99% identical thereto or differing by no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids therefrom. 15.
  • the antibody molecule of paragraph 12 comprising the amino acid sequence of heavy chain variable region VH175, or an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical thereto or differing by no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids therefrom.
  • the antibody molecule of any of paragraphs 1-15 comprising the amino acid sequence of light chain variable region VK-65, or an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical thereto or differing by no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids therefrom. 17.
  • An anti-hemagglutinin (HA) antibody molecule comprising (a) CDR1, CDR2, and CDR3 of the heavy chain variable region VH123; (b) CDR1, CDR2, or CDR3 of the light chain variable region VK-65; and optionally, (c) an Fc region comprising FcMut215. 18.
  • An anti-hemagglutinin (HA) antibody molecule comprising (a) CDR1, CDR2, and CDR3 of the heavy chain variable region VH148; (b) CDR1, CDR2, or CDR3 of the light chain variable region VK-65; and optionally, (c) an Fc region comprising FcMut215. 19.
  • An anti-hemagglutinin (HA) antibody molecule comprising (a) CDR1, CDR2, and CDR3 of the heavy chain variable region VH175; (b) CDR1, CDR2, or CDR3 of the light chain variable region VK-65; and optionally, (c) an Fc region comprising FcMut215.
  • An anti-hemagglutinin (HA) antibody molecule comprising (a) the heavy chain variable region VH123; (b) the light chain variable region VK-65; and optionally, (c) an Fc region comprising FcMut215. 21.
  • An anti-hemagglutinin (HA) antibody molecule comprising (a) the heavy chain variable region VH148; (b) the light chain variable region VK-65; and optionally, (c) an Fc region comprising FcMut215.
  • An anti-hemagglutinin (HA) antibody molecule comprising (a) the heavy chain variable region VH175; (b) the light chain variable region VK-65; and optionally, (c) an Fc region comprising FcMut215.
  • a pharmaceutical composition comprising the antibody molecule of any of paragraphs 1- 22 and a pharmaceutically acceptable carrier.
  • a nucleic acid e.g., an isolated nucleic acid
  • a vector comprising the nucleic acid of paragraph 24.
  • a cell e.g., an isolated cell
  • a method of producing an antibody molecule comprising culturing the cell of paragraph 26 under conditions that allow production of the antibody molecule, thereby producing the antibody molecule.
  • a kit comprising the antibody molecule of any of paragraphs 1-22 and instructions for use. 29.
  • a method of treating or preventing an influenza virus infection, or a symptom thereof, in a subject comprising administering to the subject an effective amount of the antibody molecule of any of paragraphs 1-22.
  • the method of paragraph 29, which prevents an influenza virus infection optionally wherein the method prevents an influenza virus infection for at least 5, 10, 15, 20, 25, 30, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200 days or more.
  • the subject is at risk of having an influenza infection, e.g., a subject 65 years and older or younger than 2 years old, a subject having asthma, a neurologic and neurodevelopment condition, a blood disorder (e.g., sickle cell disease), a chronic lung disease (e.g., chronic obstructive pulmonary disease (COPD) or cystic fibrosis), an endocrine disorder (e.g., diabetes mellitus), a heart disease (e.g., a congenital heart disease, a congestive heart failure, or a coronary artery disease), a kidney disease, a liver disorder, or a metabolic disorder (e.g., an inherited metabolic disorder or a mitochondrial disorder), a subject who is obese with a body mass index (BMI) of 40 or higher, a subject younger than 19 years old on a long-term aspirin- or salicylate-containing medication, a subject with a weakened immune system due to disease (e.g., a subject 65 years and older or younger
  • Example 1 Design and functional characterization of an exemplary anti-HA antibody molecule As shown in FIGS.1-3, an exemplary anti-HA antibody molecule showed potent binding and neutralization activity, while significantly enhancing half-life in relevant animal model.
  • Fc and Fab engineering e.g., Fc mutations T307Q/Q311V/A378V
  • Fc mutations T307Q/Q311V/A378V enhanced effector functions such as ADCC and ADCP for further improvement in overall potency.
  • Re-scaffolding FX-0-1-m3 to improve half-life for prophylactic use Grafting FX-0-1-m3 specificity determining regions (SDRs) into alternative germline scaffolds Because alternative germlines can improve antibody half-life, the SDRs of the anti- hemagglutinin (HA) antibody, FX-0-1-m3, were re-scaffolded. Grafting was performed in a manner similar to humanization of antibodies. Multiple scaffolds were identified that retained binding to H1 and H3 that also demonstrated improved biophysical properties. Re-scaffolding design based on the VH-169 germline significantly improved the PK of the antibody (FIG.4A-4B).
  • Predicted Hydrophobic Clusters and CDR Sites on FX-0-1-m3 Surface Four potential aggregation sites with surface hydrophobic residues were identified in FX-0-1-m3 by in silico analysis. As shown in FIG.5A, Site I was the largest hydrophobic cluster found on the surface of FX-0-1-m3, composed of five amino acids in the HCDR3 and is important for HA binding. Site II was located at the HCDR3 torso domain formed by the L98 residue of HCDR3 and the Y32 residue of HCDR1. Site III was a hydrophobic cluster located on the light chain in LCDR1, and is composed of three residues (F27d, Y29, and Y92).
  • Site IV (a minor site) was located on the light chain in LCDR2 and contains a single amino acid, Y53. As depicted in FIG.5B, the four sites converge primarily in the HCDR3 and LCDR1 regions.
  • Affinity Enhancement by Engineering Framework of the VH The VH:FWR3 (framework 3) region of the FX-0-1-m3 antibody (residues 73-76, also called HCDR4) is in close proximity with the HA1 domain of the HA polypeptide. Increasing antibody interface area could improve hydrophobic shape and complementarity.
  • Example 2 Engineering a human antibody molecule for prophylactic use against influenza A virus infection
  • FX-0-1-m3 an exemplary antibody molecule having particular designed attributes was engineered.
  • an exemplary human antibody with broad neutralization activity against influenza A virus was engineered to have properties amenable to prophylactic administration.
  • the Fab and Fc regions were engineered to extend half-life to at least 45 days and to enhance the affinity of the antibody for H3 HA protein.
  • the engineered antibody was also evaluated for its amenability for subcutaneous administration, e.g., for season-long protection against influenza A infection.
  • FX-0-1-m3 in sera retained binding to HA at least 42 days past final dosing. Further, formulation studies showed that it could be formulated at concentrations as high as 148 mg/mL while maintaining a low viscosity ( ⁇ 10 cP), supporting SubQ/IM administration. It was readily soluble at high concentrations (>100 mg/mL), dynamic light scattering studies showed that the exemplary antibody exists as dimers at higher concentrations (>25mg/mL). FX-0-1-m3 was modified to further enhance pharmacokinetics, physicochemical properties, and affinity for group 2 HA (in particular, H3), while maintaining the desirable properties of the exemplary antibody molecule.
  • Modified antibody molecules were generated as described below.
  • Candidate antibody molecules were assigned an identifier of the format “FX-XXX-YY-ZZZ,” in which the XXX indicated the heavy chain sequence (e.g., as described herein), YY indicated the light chain sequence (e.g., as described herein), and ZZZ indicated the Fc domain variant (e.g., as described herein).
  • Fc Engineering A structural- and network-based framework was developed to interrogate the interaction of the Fc domain with FcRn at neutral and acidic pH. Multiple Fc variants were identified that confer enhancement in half-life and retain or enhance effector functions such as ADCC and CDC.
  • DF215 (also known as FcMut215 herein) is one such Fc domain variant (comprising Fc mutations Q307/V311/V378), which was shown to enhance half-life of a control antibody by greater than 3-fold in cynomolgus monkeys.
  • DF215 was thermally stable and has been shown to enhance ADCC activity.
  • DF215 was combined with the Fab of the exemplary antibody to produce antibody molecule FX-0-1-215.
  • FX-0-1-215 When the pharmacokinetic properties of FX-0-1-215 were assessed in Tg276 transgenic mice, it persisted in sera for significantly longer than the parental FX-0-1-m3 mAb (FIG. 7).
  • DF215 Fc domain was chosen for incorporation into lead candidates for half-life extension.
  • Fab engineering for improved biophysical properties
  • the Fab domain of an antibody can influence circulating half-life through a variety of factors including, e.g., (i) interaction with serum and cell components, (ii) influencing the rate of fluid phase pinocytosis, (iii) receptor-mediated endocytosis (for antibodies targeting endogenous target), (iv) presence of anti-drug antibodies, and (v) influencing the Fc-FcRn interaction.
  • half- life can be extended by incorporating the DF215 mutation.
  • Fab engineering provides an additional opportunity to further enhance half-life.
  • the Fab unfolding temperature varies widely between antibodies.
  • full-length FX-0-1-m3 showed a single unfolding signal at about 69°C when assessed in DSF (Table 3).
  • Table 3 Table 3.
  • Tm values for FX-0-1-m3 Fab and full-length antibody FX-0-1-m3 An assessment of polyreactivity of FX-0-1-m3 was performed using a biolayer interferometry (BLI) polyreactivity assay. Briefly, polyclonal human IgG was immobilized onto anti-human CH1 biosensors followed by exposure to a panel of test antibodies. Excessive binding of the test antibodies to the loaded biosensors resulted in a shift in mass on the biosensor and thus an increase in BLI signal. An increase in BLI signal would indicate that the antibody nonspecifically binds to polyclonal human IgG.
  • BLI biolayer interferometry
  • Table 4 summarizes the maximum signals for FX-0-1-m3 and a control antibody, where higher maximum signals suggest more nonspecific binding to human polyclonal antibody on the anti-human CH1 biosensors.
  • FX-0-1-m3 exhibited relatively high polyreactivity in this assay.
  • Table 4. Maximum signal measurements (binding response) for polyreactivity for a variety of antibodies as measured by BLI
  • an AC-SINS assay was carried out to quantify the propensity of the FX-0-1-m3 to self-aggregate.
  • the AC-SINS assay involves concentrating dilute solutions of mAbs around gold nanoparticles pre-coated with polyclonal capture antibodies.
  • Antibodies with the propensity to self-interact demonstrate red-shifted plasmon wavelengths (detected as change in wavelength maximum absorbance). Table 5 shows both the parabola vertex as well as vertex shift from baseline at 530 nm for FX-0-1-m3 and a control mAb. Antibodies with higher vertex shift values have higher self-interaction proclivity. FX-0-1-m3 exhibited a high propensity to self- aggregate with a vertex shift greater than 20 nm.
  • Both the framework region as well as the CDRs can influence many biophysical properties.
  • the impact of modifying both the FWRs and CDRs of FX-0-1-m3 was assessed with respect to the impact on biophysical and pharmacokinetic properties.
  • Re-scaffolding FX-0-1-m3 CDR residues onto alternative human germlines The CDRs of antibody molecule FX-0-1-m3 were rescaffolded onto alternate human VH and VL germlines and evaluated for their impact on antigen binding and biophysical properties.
  • the original VH and VL scaffolds of FX-0-1-m3 are from human VH3-30*01 and V ⁇ 4-1 germlines, respectively, which have generally good biophysical properties.
  • VH1-69*04 germline many HA stem binding antibodies belong to VH1-69*04 germline and the VH-CDRs of FX-0-1-m3 were grafted onto VH1- 69*04 as well as the other germlines frameworks including VH3-30*01, VH3-30*02, VH3-30-03*03 and VH1-8*01.
  • the V ⁇ - CDRs were grafted on to V ⁇ 1-39*01, V ⁇ 4-1*01 and V ⁇ 3-15*01 germline frameworks.
  • variants of these germline frameworks with selected framework mutations at Vernier residues were also tested.
  • Ten VHs and six VLs were designed representing three VH germlines and three VL germlines (Table 6). Table 6. Germline usage for rescaffolded FX-0-1-m3 variants
  • VH- and VL-containing plasmids were assessed in a combinatorial manner and a total of 60 antibodies were expressed in small scale Expi293 cultures.
  • Supernatant was harvested 4 days post- transfection and antibody expression was measured by Octet (FIG.9A). Most combinations expressed well except for all antibodies containing heavy chain FX-VH-11 and most antibodies containing FX-VH-12.
  • the supernatant was used in an HA binding ELISA to test for the binding properties of the newly designed antibodies against H1 (A/CA/03/2007) and H3 (A/Brisbane/10/2007) (FIGS.9B-9C). All combinations bound to H1 HA; however, differential binding was observed with H3 HA.
  • SAP site calculation was performed using Discovery Studio and Aggrescan3D software.
  • a static model of the exemplary anti-HA antibody molecule FX-0-1-m3 was used to identify four hydrophobic sites/patches (I to IV) involving CDR residues (FIG.5A).
  • Site I was the largest hydrophobic cluster found on the surface of FX-0-1-m3, composed of five amino acids in the HCDR3. This site was important for HA binding.
  • This site was mutated in the light chain of VK design 3 and VK design 4 to a serine and threonine, respectively. These two light chains were found in antibodies FX-8-3-m3 and FX-9-4- m3, both of which exhibited improved developability profiles and maintained H3 binding.
  • the presence of this bulky N-glycan may cause steric hindrance to antibody binding and be responsible for the reduced affinity of broadly reactive mAbs.
  • other significant sequence differences between group 1 and group 2 HAs may also have contributed to the reduction in affinity.
  • the charged HA residues in and around the antibody interface were identified and two deemed to be unpaired basic charged HA residues (HA1:R315 and HA2: K39) near the mAb-HA interface. Sulfate ions can interact with these basic residues.
  • N76L and K75W mutations were selected as affinity enhancing mutations and combined to create VH148 (VH123 + S76L) and VH175 (VH123 + K75W/S76L).
  • Pharmacokinetic properties of select antibody designs One of the main goals for engineering the Fab and Fc region of FX-0-1-m3 was to improve in vivo half-life.
  • Fc domain variant DF215 when incorporated with the Fab of FX-0-1-m3, extended serum persistence.
  • the Fab region was re-engineered by rescaffolding the CDRs on alternate germlines or by making specific mutations in identified hydrophobic patches.
  • the engineered constructs were initially evaluated for their biophysical properties and binding to HA. Select constructs that were identified to have improvement in biophysical properties were assessed for their pharmacokinetics in Tg276 transgenic mice that contains human FcRn.
  • the antibodies evaluated in Tg276 mice are listed in Tables 13-14 and the data from the different transgenic mice studies are shown in FIGS.13-14. Table 13. Antibody constructs studied in Tg276 transgenic mice Table 14. Antibody constructs studied in abbreviated PK study Tg276 transgenic mice
  • FX-9-4-215 The incorporation of the DF215 Fc domain in each case enhanced persistence of all antibodies in Tg276 mice. Rescaffolding of FX-0-1-m3 CDRs onto VH1-69 germline enhanced half- life (FX-9-4-215). In the case of FX-9-4-215, some of the enhancement was attributed to incorporation of HCDR3 changes (N101D/P102Y encoded by the J-gene). FX-123-4-215, which retained the original HCDR3, also displayed enhanced persistence as compared to FX-0-1-215, however its half-life was lower than FX-9-4-215. Additionally, FX-123-14-215 and FX-123-24-215 which incorporated site III mutations in the light chain had a half-life comparable to FX-9-4-215.
  • FX-123-24-215 had binding to H1 and H3 HA that was comparable to FX-0-1-215.
  • FX-123-24-215 had binding to H1 and H3 HA that was comparable to FX-0-1-215.
  • FX-123-24-215 was significantly less potent as compared to FX-0-1-215 (FIG.15).
  • An affinity-enhanced version of FX-123-24-215, FX-174-24- 215 retained the potency of FX-0-1-215 while still conferring enhanced persistence in serum.
  • FX-123-65-215 containing Q27D/S27aE affinity-enhancing mutations in LCDR1 also enhanced half- life.
  • FX-175-24-215 which combines affinity enhancing heavy chain with engineered mutations on LCDR1 (S27, N29d) showed improved half-life in Tg276 mice while maintaining the preferred physicochemical and biological properties. Additionally, FX-123-65-215 contains acidic residues on LCDR1 (E27, D27a) that improve half-life and retains potent neutralization with the addition of the affinity enhancing mutations. Further, FX-123-65-215 shows enhanced ADCC activity and ADCP activity (FIG.16).
  • VH107 VH3-30-3*02
  • VH123 (1-69*06
  • VH148 (1-69*06
  • VH175 (1-69*06)
  • VH176 VH3-30-3*02
  • VL24 VK1-39*01
  • VL65 VK1-39*01
  • VL83 VK1-39*01
  • VL107 VK1-39*01
  • VL110 VK1-39*01
  • VL111 (VK1-39*01) antibodies were selected for further development.
  • Antibody combination FX-123-65-215 had binding affinity and in vitro neutralization activity (FIG.15) comparable to the original anti-HA antibody molecule, but significantly improved effector functions (ADCC and ADCP activity; FIG.16) as well as significantly enhanced half-life (FIG.13).
  • VH148 and VH175 are affinity-enhanced versions of VH123, and when combined with VL65, exhibited more potent in vitro neutralization activity for both H1 and H3 viruses. Based on the available PK data of other combinations of VH148 and VH175, FX-148-65-215 and FX-175-65-215 are expected to retain the improved half-life exhibited by VH123 while enhancing potency.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Pulmonology (AREA)
  • Communicable Diseases (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Zoology (AREA)
  • Oncology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2020/064573 2019-12-11 2020-12-11 Compositions and methods for treating and preventing influenza Ceased WO2021119467A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
IL293804A IL293804A (en) 2019-12-11 2020-12-11 Anti-hemagglutinin (ha) antibody molecules, preparations containing them and their uses
KR1020227023210A KR20220113749A (ko) 2019-12-11 2020-12-11 인플루엔자를 치료하고 예방하는 조성물 및 방법
AU2020403133A AU2020403133A1 (en) 2019-12-11 2020-12-11 Compositions and methods for treating and preventing influenza
CA3164230A CA3164230A1 (en) 2019-12-11 2020-12-11 Compositions and methods for treating and preventing influenza
JP2022535124A JP2023506156A (ja) 2019-12-11 2020-12-11 インフルエンザを処置または予防するための組成物および方法
BR112022011350A BR112022011350A2 (pt) 2019-12-11 2020-12-11 Composições e métodos para tratamento e prevenção da influenza
US17/783,966 US20230257449A1 (en) 2019-12-11 2020-12-11 Compositions and methods for treating and preventing influenza
CN202080096260.7A CN115551885A (zh) 2019-12-11 2020-12-11 用于治疗和预防流感的组合物和方法
MX2022007207A MX2022007207A (es) 2019-12-11 2020-12-11 Composiciones y metodos para tratar y prevenir la influenza.
EP20829493.4A EP4073107A1 (en) 2019-12-11 2020-12-11 Compositions and methods for treating and preventing influenza

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201962946772P 2019-12-11 2019-12-11
US62/946,772 2019-12-11
US202062985623P 2020-03-05 2020-03-05
US62/985,623 2020-03-05
US202063028938P 2020-05-22 2020-05-22
US63/028,938 2020-05-22

Publications (1)

Publication Number Publication Date
WO2021119467A1 true WO2021119467A1 (en) 2021-06-17

Family

ID=74046215

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/064573 Ceased WO2021119467A1 (en) 2019-12-11 2020-12-11 Compositions and methods for treating and preventing influenza

Country Status (12)

Country Link
US (1) US20230257449A1 (cg-RX-API-DMAC7.html)
EP (1) EP4073107A1 (cg-RX-API-DMAC7.html)
JP (1) JP2023506156A (cg-RX-API-DMAC7.html)
KR (1) KR20220113749A (cg-RX-API-DMAC7.html)
CN (1) CN115551885A (cg-RX-API-DMAC7.html)
AU (1) AU2020403133A1 (cg-RX-API-DMAC7.html)
BR (1) BR112022011350A2 (cg-RX-API-DMAC7.html)
CA (1) CA3164230A1 (cg-RX-API-DMAC7.html)
CL (1) CL2022001545A1 (cg-RX-API-DMAC7.html)
IL (1) IL293804A (cg-RX-API-DMAC7.html)
MX (1) MX2022007207A (cg-RX-API-DMAC7.html)
WO (1) WO2021119467A1 (cg-RX-API-DMAC7.html)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11230593B2 (en) 2019-03-25 2022-01-25 Visterra, Inc. Compositions and methods for treating and preventing influenza
US12024552B2 (en) 2012-05-10 2024-07-02 Visterra, Inc. Ha binding agents
CN118388650A (zh) * 2024-06-28 2024-07-26 杭州赛基生物科技有限公司 一种抗CD235a单克隆抗体及其制备方法和应用
US12202885B2 (en) 2016-02-24 2025-01-21 Visterra, Inc. Formulations of antibody molecules to influenza virus

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN119901847B (zh) * 2025-04-01 2025-06-27 天津辰欣药物研究有限公司 一种抗病毒新药中间体中相关异构体杂质的质量控制方法

Citations (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4439196A (en) 1982-03-18 1984-03-27 Merck & Co., Inc. Osmotic drug delivery system
US4447233A (en) 1981-04-10 1984-05-08 Parker-Hannifin Corporation Medication infusion pump
US4447224A (en) 1982-09-20 1984-05-08 Infusaid Corporation Variable flow implantable infusion apparatus
US4475196A (en) 1981-03-06 1984-10-02 Zor Clair G Instrument for locating faults in aircraft passenger reading light and attendant call control system
US4486194A (en) 1983-06-08 1984-12-04 James Ferrara Therapeutic device for administering medicaments through the skin
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
US5849992A (en) 1993-12-20 1998-12-15 Genzyme Transgenics Corporation Transgenic production of antibodies in milk
WO2004029207A2 (en) 2002-09-27 2004-04-08 Xencor Inc. Optimized fc variants and methods for their generation
WO2005047327A2 (en) 2003-11-12 2005-05-26 Biogen Idec Ma Inc. NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO
WO2005063815A2 (en) 2003-11-12 2005-07-14 Biogen Idec Ma Inc. Fcϝ receptor-binding polypeptide variants and methods related thereto
WO2008073161A2 (en) 2006-08-14 2008-06-19 Massachusetts Institute Of Technology Hemagglutinin polypeptides, and reagents and methods relating thereto
WO2008143954A2 (en) 2007-05-14 2008-11-27 Biogen Idec Ma Inc. Single-chain fc (scfc) regions, binding polypeptides comprising same, and methods related thereto
US20090081193A1 (en) 2006-08-14 2009-03-26 Massachusetts Institute Of Technology Hemagglutinin polypeptides, and reagents and methods relating thereto
US20090269342A1 (en) 2006-08-14 2009-10-29 Massachusetts Institute Of Technology Hemagglutinin Polypeptides, and Reagents and Methods Relating Thereto
US20100080813A1 (en) 2008-07-25 2010-04-01 Institute For Research In Biomedicine Neutralizing anti-influenza a virus antibodies and uses thereof
US20110038935A1 (en) * 2007-12-06 2011-02-17 Marasco Wayne A Antibodies against influenza virus and methods of use thereof
US20110201547A1 (en) 2010-01-27 2011-08-18 Massachusetts Institute Of Technology Engineered polypeptide agents for targeted broad spectrum influenza neutralization
US20110274702A1 (en) 2008-07-25 2011-11-10 Institute For Research In Biomedicine Neutralizing anti-influenza a virus antibodies and uses thereof
WO2013011347A1 (en) 2011-07-18 2013-01-24 Institute For Research In Biomedicine Neutralizing anti-influenza a virus antibodies and uses thereof
US20130302349A1 (en) 2012-05-10 2013-11-14 Visterra, Inc. Novel ha binding agents
WO2013169377A1 (en) 2012-05-10 2013-11-14 Massachusetts Institute Of Technology Agents for influenza neutralization
WO2017083627A1 (en) 2015-11-13 2017-05-18 Visterra, Inc. Compositions and methods for treating and preventing influenza
US20180037634A1 (en) 2016-08-02 2018-02-08 Visterra, Inc. Engineered polypeptides and uses thereof
US20180099040A1 (en) * 2015-04-08 2018-04-12 Dana-Farber Cancer Institute, Inc. Humanized influenza monoclonal antibodies and methods of use thereof

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012072788A1 (en) * 2010-12-02 2012-06-07 Mab-Factory Gmbh Vaccine against influenza h5n1 viruses, medicament and treatment of h5n1 viral infections
ES2833230T3 (es) * 2014-05-13 2021-06-14 Univ Pennsylvania Composiciones que comprenden AVV que expresan construcciones y usos de doble anticuerpo del mismo

Patent Citations (43)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4475196A (en) 1981-03-06 1984-10-02 Zor Clair G Instrument for locating faults in aircraft passenger reading light and attendant call control system
US4447233A (en) 1981-04-10 1984-05-08 Parker-Hannifin Corporation Medication infusion pump
US4439196A (en) 1982-03-18 1984-03-27 Merck & Co., Inc. Osmotic drug delivery system
US4447224A (en) 1982-09-20 1984-05-08 Infusaid Corporation Variable flow implantable infusion apparatus
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US4486194A (en) 1983-06-08 1984-12-04 James Ferrara Therapeutic device for administering medicaments through the skin
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
US5399163A (en) 1992-07-24 1995-03-21 Bioject Inc. Needleless hypodermic injection methods and device
US5849992A (en) 1993-12-20 1998-12-15 Genzyme Transgenics Corporation Transgenic production of antibodies in milk
WO2004029207A2 (en) 2002-09-27 2004-04-08 Xencor Inc. Optimized fc variants and methods for their generation
WO2005047327A2 (en) 2003-11-12 2005-05-26 Biogen Idec Ma Inc. NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO
WO2005063815A2 (en) 2003-11-12 2005-07-14 Biogen Idec Ma Inc. Fcϝ receptor-binding polypeptide variants and methods related thereto
WO2008073161A2 (en) 2006-08-14 2008-06-19 Massachusetts Institute Of Technology Hemagglutinin polypeptides, and reagents and methods relating thereto
US20090081193A1 (en) 2006-08-14 2009-03-26 Massachusetts Institute Of Technology Hemagglutinin polypeptides, and reagents and methods relating thereto
US20090269342A1 (en) 2006-08-14 2009-10-29 Massachusetts Institute Of Technology Hemagglutinin Polypeptides, and Reagents and Methods Relating Thereto
US20100061990A1 (en) 2006-08-14 2010-03-11 Massachusetts Institute Of Technology Hemagglutinin Polypeptides, and Reagents and Methods Relating Thereto
US20080241918A1 (en) 2006-08-14 2008-10-02 Ram Sasisekharan Hemagglutinin polypeptides, and reagents and methods relating thereto
WO2008143954A2 (en) 2007-05-14 2008-11-27 Biogen Idec Ma Inc. Single-chain fc (scfc) regions, binding polypeptides comprising same, and methods related thereto
US20110038935A1 (en) * 2007-12-06 2011-02-17 Marasco Wayne A Antibodies against influenza virus and methods of use thereof
US20100080813A1 (en) 2008-07-25 2010-04-01 Institute For Research In Biomedicine Neutralizing anti-influenza a virus antibodies and uses thereof
US20110274702A1 (en) 2008-07-25 2011-11-10 Institute For Research In Biomedicine Neutralizing anti-influenza a virus antibodies and uses thereof
US20110201547A1 (en) 2010-01-27 2011-08-18 Massachusetts Institute Of Technology Engineered polypeptide agents for targeted broad spectrum influenza neutralization
US20170204167A1 (en) * 2011-07-18 2017-07-20 Institute For Research In Biomedicine Neutralizing anti-influenza a virus antibodies and uses thereof
WO2013011347A1 (en) 2011-07-18 2013-01-24 Institute For Research In Biomedicine Neutralizing anti-influenza a virus antibodies and uses thereof
US20130302349A1 (en) 2012-05-10 2013-11-14 Visterra, Inc. Novel ha binding agents
WO2013170139A1 (en) 2012-05-10 2013-11-14 Visterra, Inc. Novel ha binding agents
US8877200B2 (en) 2012-05-10 2014-11-04 Visterra, Inc. HA binding agents
US9096657B2 (en) 2012-05-10 2015-08-04 Visterra, Inc. HA binding agents
WO2013169377A1 (en) 2012-05-10 2013-11-14 Massachusetts Institute Of Technology Agents for influenza neutralization
US9969794B2 (en) 2012-05-10 2018-05-15 Visterra, Inc. HA binding agents
US20180099040A1 (en) * 2015-04-08 2018-04-12 Dana-Farber Cancer Institute, Inc. Humanized influenza monoclonal antibodies and methods of use thereof
WO2017083627A1 (en) 2015-11-13 2017-05-18 Visterra, Inc. Compositions and methods for treating and preventing influenza
US10513553B2 (en) 2015-11-13 2019-12-24 Visterra, Inc. Compositions and methods for treating and preventing influenza
US20180037634A1 (en) 2016-08-02 2018-02-08 Visterra, Inc. Engineered polypeptides and uses thereof
WO2018052556A1 (en) 2016-08-02 2018-03-22 Visterra, Inc. Engineered polypeptides and uses thereof

Non-Patent Citations (46)

* Cited by examiner, † Cited by third party
Title
"Controlled Drug Delivery (Drugs and the Pharmaceutical Sciences", 1987, MARCEL DEKKER, INC.
"Handbook of Pharmaceutical Excipients American Pharmaceutical Association", 2000, LIPPINCOTT, WILLIAMS & WILKINS
A. F. WILLIAMSA. N. BARCLAY, ANN. REV. IMMUNOL., vol. 6, 1988, pages 381 - 405
ANSEL ET AL.: "Pharmaceutical Dosage Forms and Drug Delivery Systems", 1999, LIPPINCOTT WILLIAMS & WILKINS PUBLISHERS
ANTIVIRAL RES, vol. 160, 2018, pages 109 - 117
BALAZS ET AL., NATURE, vol. 30, no. 481, 2011, pages 81 - 84
BERGE, S.M. ET AL., J. PHARM. SCI., vol. 66, 1977, pages 1 - 19
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BOOTH ET AL., MABS, vol. 10, no. 7, 2018, pages 1098 - 1110
BRIAN J. BOOTH ET AL: "Extending human IgG half-life using structure-guided design", MABS, 27 June 2018 (2018-06-27), US, pages 1 - 13, XP055732351, ISSN: 1942-0862, DOI: 10.1080/19420862.2018.1490119 *
CARR ET AL., PROC. NATL. ACAD. SCI., vol. 94, 1997, pages 14306 - 14313
CHOTHIA, C. ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CORTI ET AL., SCIENCE, vol. 333, 28 July 2011 (2011-07-28), pages 850 - 856
DOYLE ET AL., MMWR MORB MORTAL WKLY REP, vol. 68, no. 6, 2019, pages 135 - 139
DREYFUS ET AL., SCIENCE, vol. 337, no. 1343, 2012, pages 1343
DREYFUS ET AL., SCIENCE, vol. 337, no. 6100, 9 August 2012 (2012-08-09), pages 1343 - 1348
EKIERT ET AL., SCIENCE, vol. 324, 26 February 2009 (2009-02-26), pages 246 - 251
EKIERT ET AL., SCIENCE, vol. 324, no. 5924, 2009, pages 246
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES
KAUFMANSHARP, MOL. BIOL., vol. 159, 1982, pages 601 - 621
KEMBLE ET AL., J. VIROL., vol. 66, 1992, pages 4940 - 4950
KIKUTANI ET AL., CIBA FOUNDATION SYMPOSIUM, vol. 147, 1989, pages 23 - 31
KILE ET AL., MMWR MORB MORTAL WKLY REP, vol. 66, no. 35, 2017, pages 928 - 932
LAMBERTFAUCI, N ENGL J MED, vol. 363, no. 21, 2010, pages 2036 - 2044
MAVERAKIS ET AL., JOURNAL OF AUTOIMMUNITY, vol. 57, no. 6, 2015, pages 1 - 13
NUCLEIC ACIDS RES., vol. 46, no. 2, 2018, pages 956 - 971
OKUNO ET AL., J. VIROL., vol. 67, 1993, pages 2552 - 1558
PEIPP ET AL., BLOOD, vol. 112, no. 6, 2008, pages 2390 - 2399
POWERS ET AL., J. IMMUNOL. METHODS, vol. 251, 2001, pages 123 - 35
ROGERS ET AL., NATURE, vol. 304, 1983, pages 76
ROGERSPAULSON, VIROLOGY, vol. 127, 1983, pages 361
SAUTER ET AL., BIOCHEMISTRY, vol. 31, 1992, pages 9609
See also references of EP4073107A1
SHIBUYAHONDA, SPRINGER SEMINARS IN IMMUNOPATHOLOGY, vol. 28, no. 4, 2006, pages 377 - 82
SKEHELWILEY, ANNU REV BIOCHEM, vol. 69, 2000, pages 531
STADLMANN ET AL., PROTEOMICS, vol. 8, no. 14, 2008, pages 2858 - 2871
STADLMANN, PROTEOMICS, vol. 9, no. 17, 2009, pages 4143 - 4153
SUI ET AL., NAT STRUCT MOL BIOL, vol. 16, no. 3, 2009, pages 265
SUI ET AL., NAT. STRUCT. MOL. BIOL., vol. 16, 2009, pages 265
THROSBY ET AL., PLOS ONE, vol. 3, 2008, pages e3942
URLAUBCHASIN, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 4220
VON BUBNOFF ET AL., CLINICAL AND EXPERIMENTAL DERMATOLOGY, vol. 28, no. 2, 2003, pages 184 - 7
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546
WOZNIAK-KNOPP ET AL., PROTEIN ENG DES, vol. 23, no. 4, 2010, pages 289 - 297
ZHU ET AL., JOURNAL OF IMMUNOLOGY, vol. 166, no. 5, 2001, pages 3266 - 76

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12024552B2 (en) 2012-05-10 2024-07-02 Visterra, Inc. Ha binding agents
US12202885B2 (en) 2016-02-24 2025-01-21 Visterra, Inc. Formulations of antibody molecules to influenza virus
US11230593B2 (en) 2019-03-25 2022-01-25 Visterra, Inc. Compositions and methods for treating and preventing influenza
CN118388650A (zh) * 2024-06-28 2024-07-26 杭州赛基生物科技有限公司 一种抗CD235a单克隆抗体及其制备方法和应用

Also Published As

Publication number Publication date
AU2020403133A1 (en) 2022-06-23
IL293804A (en) 2022-08-01
CL2022001545A1 (es) 2023-03-24
EP4073107A1 (en) 2022-10-19
CN115551885A (zh) 2022-12-30
JP2023506156A (ja) 2023-02-15
KR20220113749A (ko) 2022-08-16
MX2022007207A (es) 2022-07-12
CA3164230A1 (en) 2021-06-17
BR112022011350A2 (pt) 2022-08-23
US20230257449A1 (en) 2023-08-17

Similar Documents

Publication Publication Date Title
US12024552B2 (en) Ha binding agents
US20230257449A1 (en) Compositions and methods for treating and preventing influenza
JP2022110149A (ja) インフルエンザウイルスに対する抗体分子の製剤
US11230593B2 (en) Compositions and methods for treating and preventing influenza
HK40035221A (en) Novel ha binding agents
HK1208619B (en) Novel ha binding agents

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20829493

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2022535124

Country of ref document: JP

Kind code of ref document: A

Ref document number: 3164230

Country of ref document: CA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022011350

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2020403133

Country of ref document: AU

Date of ref document: 20201211

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20227023210

Country of ref document: KR

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020829493

Country of ref document: EP

Effective date: 20220711

ENP Entry into the national phase

Ref document number: 112022011350

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20220609

WWW Wipo information: withdrawn in national office

Ref document number: 2020829493

Country of ref document: EP