WO2021102055A1 - Anti-ror-2 antibodies and methods of use - Google Patents
Anti-ror-2 antibodies and methods of use Download PDFInfo
- Publication number
- WO2021102055A1 WO2021102055A1 PCT/US2020/061130 US2020061130W WO2021102055A1 WO 2021102055 A1 WO2021102055 A1 WO 2021102055A1 US 2020061130 W US2020061130 W US 2020061130W WO 2021102055 A1 WO2021102055 A1 WO 2021102055A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- ror2
- set forth
- cdr
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/15—Natural-killer [NK] cells; Natural-killer T [NKT] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
- G01N33/5759—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/50—Colon
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
Definitions
- Receptor tyrosine kinase-like orphan receptor 2 is a developmental ly restricted receptor for Wnt5a.
- Human ROR2 is a 943 amino acid single-pass type I membrane protein with a calculated molecular weight of 104.8 kDa. It is highly conserved across several species with a 92% amino acid identity between the mouse and human proteins. ROR2 can repress transcription of Wnt target genes and modulate Wnt signaling by sequestering canonical Wnt ligands, thereby serving as a tumor suppressor in different cell contexts.
- ROR2 has been implicated in progression of numerous cancers including breast, ovarian, pancreatic, cervical, gastric, renal, head and neck, bone, skin and prostate. Therefore, there is a need for antibodies, antibody fragments, bispecific antibodies and chimeric antigen receptors that specifically target human ROR2, inhibit its function and thereby serve as effective therapeutics and diagnostics.
- the compositions and methods provided herein address these and other needs in the art.
- an anti-tyrosine k ase-like orphan receptor 2 (ROR2) antibody including a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26 and a CDR H3 as set forth in SEQ ID NO:27; and wherein the light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:28, a CDR L2 as set forth in SEQ ID NO:29, and a CDR L3 as set forth in SEQ ID NO:30.
- ROR2 anti-tyrosine k ase-like orphan receptor 2
- an anti-tyrosine kinase-like orphan receptor 2 (ROR2) antibody including a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32 and a CDR H3 as set forth in SEQ ID NO:33; and wherein the light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35, and a CDR L3 as set forth in SEQ ID NO:36.
- ROR2 anti-tyrosine kinase-like orphan receptor 2
- an anti-tyrosine kinase-like orphan receptor 2 (ROR2) antibody including a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:37, a CDR H2 as set forth in SEQ ID NO:38 and a CDR H3 as set forth in SEQ ID NO:39; and wherein the light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO:41, and a CDR L3 as set forth in SEQ ID NO:42.
- ROR2 anti-tyrosine kinase-like orphan receptor 2
- an anti-ty rosine kinase-hke orphan receptor 2 (ROR2) antibody including a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44 and a CDR H3 as set forth in SEQ ID NO:45; and wherein the light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47, and a CDR L3 as set forth in SEQ ID NO:48.
- ROR2 anti-ty rosine kinase-hke orphan receptor 2
- a method of treating cancer in a subject in need thereof including administering to a subject a therapeutically effective amount of an antibody provided herein including embodiments thereof.
- a method of inhibiting metastasis of a ROR2 expressing cancer in a subject in need thereof including administering to a subject a therapeutically effective amount of an antibody provided herein, including embodiments thereof.
- a method of detecting a ROR2 expressing cell including (i) contacting a ROR2-expressing cell with an antibody provided herein including embodiments thereof; and (ii) detecting binding of the antibody to a ROR2 protein expressed by the cell.
- a method of delivering a therapeutic agent to a ROR2 expressing cell including contacting a ROR2 expressing cell with an antibody provided herein including embodiments thereof, wherein the antibody is attached to a therapeutic agent.
- a method of inhibiting migration of a ROR2-expressing cell including contacting a ROR2 expressing cell with an antibody provided herein including embodiments thereof.
- a anti-ROR2 antibody wherein the anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain including: a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26 and a CDR H3 as set forth in SEQ ID NO:27; and a light chain variable domain including: a CDR LI as set forth in SEQ ID NO:28, a CDR L2 as set forth in SEQ ID NO:29, and a CDR L3 as set forth in SEQ ID NO: 30.
- a heavy chain variable domain including: a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26 and a CDR H3 as set forth in SEQ ID NO:27
- a light chain variable domain including: a CDR LI as set forth in SEQ ID NO:28, a CDR L2 as set forth in SEQ ID NO:
- a anti-ROR2 antibody wherein the anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain of SEQ ID:2; and a light chain variable domain of SEQ ID NO:4.
- an anti-ROR2 antibody wherein the anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID:1; and a light chain variable domain encoded by the nucleic acid sequence of SEQ ID:3.
- an anti-ROR2 antibody wherein the anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain including: a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32 and a CDR H3 as set forth in SEQ ID NO:33; and a light chain variable domain including: a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35, and a CDR L3 as set forth in SEQ ID NO: 36.
- a heavy chain variable domain including: a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32 and a CDR H3 as set forth in SEQ ID NO:33
- a light chain variable domain including: a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35
- an anti-ROR2 antibody wherein the anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain of SEQ ID: 6; and a light chain variable domain of SEQ ID NO: 8.
- an anti-ROR2 antibody wherein the anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID:5; and a light chain variable domain encoded by the nucleic acid sequence of SEQ ID:7.
- an anti-ROR2 antibody wherein the anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain including: a CDR HI as set forth in SEQ ID NO: 37, a CDR H2 as set forth in SEQ ID NO: 38 and a CDR H3 as set forth in SEQ ID NO:39; and a light chain variable domain including: a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO:41, and a CDR L3 as set forth in SEQ ID NO: 42.
- a heavy chain variable domain including: a CDR HI as set forth in SEQ ID NO: 37, a CDR H2 as set forth in SEQ ID NO: 38 and a CDR H3 as set forth in SEQ ID NO:39
- a light chain variable domain including: a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO:41
- an anti-ROR2 antibody wherein the anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain of SEQ ID: 10; and a light chain variable domain of SEQ ID NO: 12.
- an anti-ROR2 antibody wherein the anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID:9; and a light chain variable domain encoded by the nucleic acid sequence of SEQ ID:11.
- an anti-ROR2 antibody wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain including: a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44 and a CDR H3 as set forth in SEQ ID NO:45; and a light chain variable domain including: a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47, and a CDR L3 as set forth in SEQ ID NO:48.
- a heavy chain variable domain including: a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44 and a CDR H3 as set forth in SEQ ID NO:45
- a light chain variable domain including: a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47
- an anti-ROR2 antibody wherein the anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain of SEQ ID: 14; and a light chain variable domain of SEQ ID NO: 16.
- an anti-ROR2 antibody wherein the anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID: 13; and a light chain variable domain encoded by the nucleic acid sequence of SEQ ID: 15.
- a chimeric antigen receptor including: (i) an antibody region including: (a) a light chain variable domain including a CDR LI as set forth in SEQ ID NO: 28, a CDR L2 as set forth in SEQ ID NO:29 and a CDR L3 as set forth in SEQ ID NO:30; and (b) a heavy chain variable region domain including a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26, and a CDR H3 as set forth in SEQ ID NO:27; and (ii) a transmembrane domain.
- a chimeric antigen receptor including: (i) an antibody region including: (a) a light chain variable domain including a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35 and a CDR L3 as set forth in SEQ ID NO:36; and (b) a heavy chain variable region domain including a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32, and a CDR H3 as set forth in SEQ ID NO:33; and (ii) a transmembrane domain.
- a chimeric antigen receptor including: (i) an antibody region including: (a) a light chain variable domain including a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO:41 and a CDR L3 as set forth in SEQ ID NO:42; and (b) a heavy chain variable region domain including a CDR HI as set forth in SEQ ID NO:37, a CDR H2 as set forth in SEQ ID NO:38, and a CDR H3 as set forth in SEQ ID NO:39; and (ii) a transmembrane domain.
- a chimeric antigen receptor including: (i) an antibody region including: (a) a light chain variable domain including a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47 and a CDR L3 as set forth in SEQ ID NO:48; and (b) a heavy chain variable region domain including a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44, and a CDR H3 as set forth in SEQ ID NO:45; and (ii) a transmembrane domain.
- a method of treating cancer in a subject in need thereof including, administering a therapeutically effective amount of a chimeric antigen receptor provided herein including embodiments thereof to a subject.
- an anti-receptor tyrosine kinase-like orphan receptor 2 (ROR2) antibody capable of binding an extracellular domain of ROR2 including an amino acid sequence of SEQ ID NO:22.
- FIG. 1 Comparison of the extracellular regions of human and mouse ROR2.
- FIG.s 2A-2D Amino acid sequence and alignment to the closest mouse IGHV (upper sequence) or IGKV (lower sequence) germline gene depicted for each of the four mouse anti human ROR2 hybridomas, designated (FIG. 2A) 6E6, (FIG. 2B) 4G9, (FIG. 2C) 5C11 and (FIG. 2D) 5G3.
- the upper sequence depicts the amino acid sequence of the heavy or light chain variable region beginning at the first codon of the first framework region and ending with the last codon of the fourth framework region.
- the lower sequence depicts the amino acid sequence of the heavy or light chain variable region of the most homologous mouse IGHV or IGKV germline gene.
- the framework (FR) and complementarity determining (CDR) regions are marked above the sequences, and the differences between the two sequences are noted below the aligned sequences, and are designated as single letter amino acid codons in bold font.
- FIG. 3 Assessment of binding of anti-ROR2 mAh to recombinant human ROR2 at varying amounts of immobilized protein and concentrations of soluble mAh.
- Wells were coated overnight with recombinant human ROR2-extracellular domain (ROR2-ECD), at 27, 9, 3 and 1 nM, washed and blocked with sample buffer (IX BBS+1% BSA) at 37° C for 90 minutes.
- sample buffer IX BBS+1% BSA
- FIG.s 4A and 4B Affinity measurement of binding of the 6E6 and 4G9 mAh to recombinant ROR2 protein.
- FIG. 4A Analysis was performed using a KinExA 3200 instrument. The proportion of anti-human ROR2 mAh bound to particles coated with ROR2 protein (y-axis) in the presence of increasing molar (M) concentration of soluble ROR2 competitor (x-axis) is shown for 6E6 (upper panel) and 4G9 (lower panel).
- FIG. 4B Illustration of the 95% confidence interval for the measured Kd of 6E6 (upper panel) and 4G9 (lower panel) for binding to human ROR2.
- FIG. 5 Identification of the binding regions of anti-human ROR2 mAh by assessment of binding to chimeric human/house recombinant ROR2 protein.
- the left panel shows schematics of the chimeric constructs of the extracellular portion of ROR2 used to map the binding region of each of the four ROR2 mAh.
- the dark regions of each construct indicate human ROR2 and the hatched portions regions of mouse ROR2.
- hl-111 and hi -160 refer to the first 111 and 160 amino acids of human ROR2, respectively.
- hCRD and hKringle contain the cysteine rich domain and the Kringle domain of human ROR2.
- Each recombinant protein was transferred onto nylon membrane, probed with the the 6E6, 4G9, 5C11, 5G3 or anti -his tag mAh, and detected with an anti-mouse IgG antibody conjugated with horse radish peroxidase, as shown in the right panel.
- the 6E5 and 5C11 mAbs bind to ROR2 recombinant proteins that contain the human kringle domain.
- the 4G9 and 5G3 mAbs bind to ROR2 recombinant proteins within the first 111 aa of human ROR2, which includes the Ig-like domain.
- FIG. 6 Identification of amino acids required for binding of anti-human ROR2 mAh to the Kringle domain of human ROR2. Binding of 6E6, 4G9 and 5C11 mAh was assessed using recombinant human ROR2 proteins in which one amino acid that differs between human and mouse ROR2 within the kringle domain was replaced with the corresponding amino acid of mouse ROR2. Each recombinant protein was transferred onto nylon membrane, probed with the the 6E6, 4G9, or 5C11 mAh, and detected with an anti-mouse IgG antibody conjugated with horse radish peroxidase, as shown in the top panel. Alignment of the protein sequences of the kringle domain of human and mouse ROR2 are shown in the lower panel, and the boxed amino acids indicate the amino acids changes made for each recombinant protein.
- FIG.s 7A and 7B 6E6 and 4G9 anti -human ROR2 mAh specifically bind human ROR2.
- FIG. 7A Binding of the 6E6 and 4G9 mAh to human ROR was assessed by flow cytometric staining and analysis of several cell lines known to express ROR2. Cells were stained on ice for 20 minutes with 10 ug/ml of 6E6 or 4G9 anti -human ROR2-Alexa647 conjugated mAh (shaded histograms) or equal amounts of isotype matched control mAh (open histograms), washed and analyzed. Histograms depict the relative fluorescence intensity (x axis) of viable cells as determined by light scatter characteristics.
- FIG. 7B Specificity was validated by the absence of binding to HCT116 colorectal cancer cells and HEK293 cells in which ROR2 expression was eliminated using CRISPR-cas9, compared to parental cell lines.
- BR1936 and BR1367 (ROR2 negative) breast cancer PDX cells were stained with 10 ug/ml of 6E6 or 4G9 anti -human ROR2-Alexa647 conjugated mAb (shaded histograms) or equal amounts of isotype matched control mAh (open histograms). Cells were stained on ice for 20 minutes, washed and analyzed by flow cytometry. Histograms depict the relative fluorescence intensity (x axis) of viable cells as determined by light scatter characteristics. Both 6E6 and 4G9 bind to BR1936 cells, but not BR1367 cells that do not express human ROR2.
- PBMC peripheral blood mononuclear cells
- PBMC peripheral blood mononuclear cells
- Cells were stained with 5 ug/ml of 6E6 or 4G9 anti -human ROR2-Alexa647 conjugated mAb (shaded histograms) or equal amounts of isotype matched control mAb (open histograms) on ice for 20 minutes, washed and analyzed by flow cytometry. Histograms depict staining of live viable mononuclear cells or lymphocytes as determined by light scatter characteristics. Staining of K562 cells was performed as a positive control.
- FIG.s 10A and 10B 6E6 and 4G9 anti-human ROR2 mAb are internalized by K562 but not JEKO cells.
- K562 and JEKO (ROR2 negative) cells were stained with 10 ug/ml of 6E6 or 4G9 anti-human ROR2-pHrodo conjugated mAb on ice for 30 minutes, washed and aliquoted into four fractions. One plate was kept on ice, and the other three transferred to 37°C for 30, 60 or 120 minutes. Following incubation, cells were washed and analyzed by flow cytometry.
- FIG. 10A Histograms depict the relative fluorescence intensity (x axis) of viable cells as determined by light scatter characteristics.
- ⁇ MFI is the mean fluorescence intensity of K562 cells stained with either pHrodo conjugated mAh incubated at 37°C minus the mean fluorescence intensity of an aliquot of the same stained cells incubated at 4°C for the equivalent amount of time.
- FIG.s 11A and 11B 6E6 and 4G9 anti -human ROR2 mAh inhibit Wnt5a induced invasion of MCF7-ROR breast cancer cells.
- MCF7 breast cancer cells transfected with either control vector or ROR2-expression vector were cultured overnight in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 0.5% fetal bovine serum (FBS) without growth factors.
- DMEM Dulbecco’s modified Eagle’s medium
- FBS fetal bovine serum
- FIG.s 12A and 12B Affinity measurement and binding specificity of the 6E6 single chain variable fragment (scFv) for human ROR2. Analysis was performed using a KinExA 3200 instrument.
- FIG. 12A The proportion of the 6E6 anti-human ROR2 scFv bound to particles coated with recombinant ROR2 protein (y-axis) in the presence of increasing molar (M) concentration of soluble ROR2 competitor (x-axis) is shown.
- FIG. 12B Illustration of the 95% confidence interval for the measured Kd of 6E6 scFv for binding to recombinant human ROR2.
- Binding of the 6E6 scFv to ROR2 was assessed by flow cytometric staining and analysis of K562 (ROR2 positive) and JEKO (ROR2 negative) cells. Cells were stained on ice for 20 minutes with ⁇ 1 ug/ml of 6E6 anti-human ROR2 scfv, washed, stained for an additional 20 minutes on ice with phycoerythrin (PE)-conjugated anti -human IgGl antibody, washed and analyzed by flow cytometry.
- PE phycoerythrin
- Shaded histograms depict the relative fluorescence intensity (x axis) of viable cells, as determined by light scatter characteristics, stained with 6E6 scfv compared to viable cells stained with the anti -human IgGl-PE antibody only (open histograms).
- the 6E6 scFv binds to K562 cells, but not JEKO cells that do not express human ROR2.
- FIG. 13 6E6 and 4G9 anti-human ROR2 chimeric antigen receptors (CAR) bind specifically to recombinant human ROR2 protein.
- HEK293 cells were transfected with either a 6E6 or 4G9 anti-human ROR2 chimeric antigen receptor construct or an anti-human ROR1 CAR construct. All cells were assessed after 48 hours by flow cytometry for binding of recombinant human ROR2-Ig protein comprised of the ROR2 extracellular domain and the CH2-CH3 constant region domains of human IgGl.
- HEK293 cells transfected with either 6E6 or 4G9 CAR constructs bind ROR2-Ig (upper panels), but not RORl-Ig, which is comprised of the same human IgG domains fused to the extracellular region of human ROR1.
- ROR1 CAR transfected cells bind only to RORl-Ig.
- Nucleic acid refers to nucleotides (e.g., deoxyribonucleotides or ribonucleotides) and polymers thereof in either single-, double- or multiple-stranded form, or complements thereof; or nucleosides (e.g., deoxyribonucleosides or ribonucleosides). In embodiments, “nucleic acid” does not include nucleosides.
- polynucleotide oligonucleotide,” “oligo” or the like refer, in the usual and customary sense, to a linear sequence of nucleotides.
- nucleoside refers, in the usual and customary sense, to a glycosylamine including a nucleobase and a five-carbon sugar (ribose or deoxyribose).
- nucleosides include, cytidine, uridine, adenosine, guanosine, thymidine and inosine.
- nucleotide refers, in the usual and customary sense, to a single unit of a polynucleotide, i.e., a monomer. Nucleotides can be ribonucleotides, deoxyribonucleotides, or modified versions thereof.
- polynucleotides contemplated herein include single and double stranded DNA, single and double stranded RNA, and hybrid molecules having mixtures of single and double stranded DNA and RNA.
- nucleic acid e.g. polynucleotides contemplated herein include any types of RNA, e.g. mRNA, siRNA, miRNA, and guide RNA and any types of DNA, genomic DNA, plasmid DNA, and minicircle DNA, and any fragments thereof.
- duplex in the context of polynucleotides refers, in the usual and customary sense, to double strandedness. Nucleic acids can be linear or branched.
- nucleic acids can be a linear chain of nucleotides or the nucleic acids can be branched, e.g., such that the nucleic acids comprise one or more arms or branches of nucleotides.
- the branched nucleic acids are repetitively branched to form higher ordered structures such as dendrimers and the like.
- Nucleic acids can include one or more reactive moieties.
- the term reactive moiety includes any group capable of reacting with another molecule, e.g., a nucleic acid or polypeptide through covalent, non-covalent or other interactions.
- the nucleic acid can include an amino acid reactive moiety that reacts with an amio acid on a protein or polypeptide through a covalent, non-covalent or other interaction.
- the terms also encompass nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non- naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides.
- Examples of such analogs include, without limitation, phosphodiester derivatives including, e.g., phosphoramidate, phosphorodiamidate, phosphorothioate (also known as phosphothioate having double bonded sulfur replacing oxygen in the phosphate), phosphorodithioate, phosphonocarboxylic acids, phosphonocarboxylates, phosphonoacetic acid, phosphonoformic acid, methyl phosphonate, boron phosphonate, or O-methylphosphoroamidite linkages (see Eckstein, OLIGONUCLEOTIDES AND ANALOGUES: A PRACTICAL APPROACH, Oxford University Press) as well as modifications to the nucleotide bases such as in 5-methyl cytidine or pseudouridine.; and peptide nucleic acid backbones and linkages.
- phosphodiester derivatives including, e.g., phosphoramidate, phosphorodiamidate, phosphorothioate (also known as phosphothio
- nucleic acids include those with positive backbones; non-ionic backbones, modified sugars, and non-ribose backbones (e.g. phosphorodiamidate morpholino oligos or locked nucleic acids (LNA) as known in the art), including those described in U.S. Patent Nos. 5,235,033 and 5,034,506, and Chapters 6 and 7, ASC Symposium Series 580, CARBOHYDRATE MODIFICATIONS IN ANTISENSE RESEARCH, Sanghui & Cook, eds. Nucleic acids containing one or more carbocyclic sugars are also included within one definition of nucleic acids.
- LNA locked nucleic acids
- Modifications of the ribose-phosphate backbone may be done for a variety of reasons, e.g., to increase the stability and half-life of such molecules in physiological environments or as probes on a biochip.
- Mixtures of naturally occurring nucleic acids and analogs can be made; alternatively, mixtures of different nucleic acid analogs, and mixtures of naturally occurring nucleic acids and analogs may be made.
- the intemucleotide linkages in DNA are phosphodiester, phosphodiester derivatives, or a combination of both.
- Nucleic acids can include nonspecific sequences.
- nonspecific sequence refers to a nucleic acid sequence that contains a series of residues that are not designed to be complementary to or are only partially complementary to any other nucleic acid sequence.
- a nonspecific nucleic acid sequence is a sequence of nucleic acid residues that does not function as an inhibitory nucleic acid when contacted with a cell or organism.
- a polynucleotide is typically composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); and thymine (T) (uracil (U) for thymine (T) when the polynucleotide is RNA).
- A adenine
- C cytosine
- G guanine
- T thymine
- U uracil
- T thymine
- polynucleotide sequence is the alphabetical representation of a polynucleotide molecule; alternatively, the term may be applied to the polynucleotide molecule itself. This alphabetical representation can be input into databases in a computer having a central processing unit and used for bioinformatics applications such as functional genomics and homology searching.
- Polynucleotides may optionally include one or more non-standard nucleotide(s), nucleotide analog(s) and/or modified nucleo
- complement refers to a nucleotide (e.g., RNA or DNA) or a sequence of nucleotides capable of base pairing with a complementary nucleotide or sequence of nucleotides.
- a complement may include a sequence of nucleotides that base pair with corresponding complementary nucleotides of a second nucleic acid sequence.
- the nucleotides of a complement may partially or completely match the nucleotides of the second nucleic acid sequence. Where the nucleotides of the complement completely match each nucleotide of the second nucleic acid sequence, the complement forms base pairs with each nucleotide of the second nucleic acid sequence. Where the nucleotides of the complement partially match the nucleotides of the second nucleic acid sequence only some of the nucleotides of the complement form base pairs with nucleotides of the second nucleic acid sequence.
- Examples of complementary sequences include coding and a non-coding sequences, wherein the non-coding sequence contains complementary nucleotides to the coding sequence and thus forms the complement of the coding sequence.
- a further example of complementary sequences are sense and antisense sequences, wherein the sense sequence contains complementary nucleotides to the antisense sequence and thus forms the complement of the antisense sequence.
- sequences may be partial, in which only some of the nucleic acids match according to base pairing, or complete, where all the nucleic acids match according to base pairing.
- two sequences that are complementary to each other may have a specified percentage of nucleotides that are the same (i.e., about 60% identity, preferably 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, g-carboxyglutamate, and O-phosphoserine.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i. e..
- R group e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
- Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
- non-naturally occurring amino acid” and “unnatural amino acid” refer to amino acid analogs, synthetic amino acids, and amino acid mimetics which are not found in nature.
- Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
- polypeptide refers to a polymer of amino acid residues, wherein the polymer may In embodiments be conjugated to a moiety that does not consist of amino acids.
- the terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
- a “fusion protein” refers to a chimeric protein encoding two or more separate protein sequences that are recombinantly expressed as a single moiety.
- amino acid or nucleotide base "position" is denoted by a number that sequentially identifies each amino acid (or nucleotide base) in the reference sequence based on its position relative to the N-terminus (or 5'-end). Due to deletions, insertions, truncations, fusions, and the like that must be taken into account when determining an optimal alignment, in general the amino acid residue number in a test sequence determined by simply counting from the N- terminus will not necessarily be the same as the number of its corresponding position in the reference sequence. For example, in a case where a variant has a deletion relative to an aligned reference sequence, there will be no amino acid in the variant that corresponds to a position in the reference sequence at the site of deletion.
- a protein e.g., ROR-1
- identity and location of residues corresponding to specific positions of the protein are identified in other protein sequences aligning to the protein.
- a selected residue in a selected protein corresponds to glutamic acid at position 138 when the selected residue occupies the same essential spatial or other structural relationship as a glutamic acid at position 138.
- the position in the aligned selected protein aligning with glutamic acid 138 is the to correspond to glutamic acid 138.
- a three dimensional structural alignment can also be used, e.g., where the structure of the selected protein is aligned for maximum correspondence with the glutamic acid at position 138, and the overall structures compared.
- an amino acid that occupies the same essential position as glutamic acid 138 in the structural model is the to correspond to the glutamic acid 138 residue.
- Constantly modified variants applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, “conservatively modified variants” refers to those nucleic acids that encode identical or essentially identical amino acid sequences. Because of the degeneracy of the genetic code, a number of nucleic acid sequences will encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are "silent variations,” which are one species of conservatively modified variations.
- Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid.
- each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
- TGG which is ordinarily the only codon for tryptophan
- amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the disclosure.
- nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 60% identity, preferably 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI web site http://www.ncbi.nlm.nih.gov/BLAST/ or the like).
- sequences are then said to be “substantially identical.”
- This definition also refers to, or may be applied to, the compliment of a test sequence.
- the definition also includes sequences that have deletions and/or additions, as well as those that have substitutions.
- the preferred algorithms can account for gaps and the like.
- identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides in length.
- Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
- a “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of, e.g., a full length sequence or from 20 to 600, about 50 to about 200, or about 100 to about 150 amino acids or nucleotides in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math.
- This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence.
- T is referred to as the neighborhood word score threshold (Altschul et al. , supra).
- a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787).
- BLAST algorithm One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
- nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, as described below.
- a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
- Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below.
- Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequence.
- Antibodies are large, complex molecules (molecular weight of -150,000 or about 1320 amino acids) with intricate internal structure.
- a natural antibody molecule contains two identical pairs of polypeptide chains, each pair having one light chain and one heavy chain.
- Each light chain and heavy chain in turn consists of two regions: a variable (“V”) region, involved in binding the target antigen, and a constant (“C”) region that interacts with other components of the immune system.
- the light and heavy chain variable regions also referred to herein as light chain variable (VL) domain and heavy chain variable (VH) domain, respectively
- VL light chain variable
- VH heavy chain variable domain
- CDRs complementarity determining regions
- the six CDRs in an antibody variable domain fold up together in 3-dimensional space to form the actual antibody binding site which docks onto the target antigen.
- the position and length of the CDRs have been precisely defined by Rabat, E. et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1983, 1987.
- the part of a variable region not contained in the CDRs is called the framework ("FR”), which forms the environment for the CDRs.
- FR framework
- an “antibody variant” as provided herein refers to a polypeptide capable of binding to an antigen and including one or more structural domains (e.g., light chain variable domain, heavy chain variable domain) of an antibody or fragment thereof.
- Non-limiting examples of antibody variants include single-domain antibodies or nanobodies, monospecific Fab2, bispecific Fab2, trispecific Fab 3 , monovalent IgGs, scFv, bispecific antibodies, bispecific diabodies, trispecific triabodies, scFv-Fc, minibodies, IgNAR, V-NAR, hcIgG, VhH, or peptibodies.
- a “peptibody” as provided herein refers to a peptide moiety attached (through a covalent or non-covalent linker) to the Fc domain of an antibody.
- antibody variants known in the art include antibodies produced by cartilaginous fish or camelids. A general description of antibodies from camelids and the variable regions thereof and methods for their production, isolation, and use may be found in references WO97/49805 and WO 97/49805 which are incorporated by reference herein in their entirety and for all purposes. Likewise, antibodies from cartilaginous fish and the variable regions thereof and methods for their production, isolation, and use may be found in W02005/118629, which is incorporated by reference herein in its entirety and for all purposes.
- CDR LI CDR L2
- CDR L3 CDR L3
- the terms “CDR LI”, “CDR L2” and “CDR L3” as provided herein refer to the complementarity determining regions (CDR) 1, 2, and 3 of the variable light (L) chain of an antibody.
- the variable light chain provided herein includes in N-terminal to C- terminal direction a CDR LI, a CDR L2 and a CDR L3.
- CDR HI CDR H2
- CDR H3 as provided herein refer to the complementarity determining regions (CDR) 1, 2, and 3 of the variable heavy (H) chain of an antibody.
- the variable heavy chain provided herein includes in N-terminal to C-terminal direction a CDR HI, a CDR H2 and a CDR H3.
- variable light chain includes in N-terminal to C-terminal direction a FR LI, a FR L2, a FR L3 and a FR L4.
- FR HI FR H2
- FR H3 FR H4
- FR H4 the variable heavy chain provided herein includes in N-terminal to C-terminal direction a FR HI, a FR H2, a FR H3 and a FR H4.
- An exemplary immunoglobulin (antibody) structural unit comprises a tetramer.
- Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kD) and one “heavy” chain (about 50-70 kD).
- the N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the terms variable light chain (VL), variable light chain (VL) domain or light chain variable region and variable heavy chain (VH), variable heavy chain (VH) domain or heavy chain variable region refer to these light and heavy chain regions, respectively.
- the terms variable light chain (VL), variable light chain (VL) domain and light chain variable region as referred to herein may be used interchangeably.
- variable heavy chain (VH), variable heavy chain (VH) domain and heavy chain variable region as referred to herein may be used interchangeably.
- the Fc i.e. fragment crystallizable region
- the Fc region is the "base” or “tail” of an immunoglobulin and is typically composed of two heavy chains that contribute two or three constant domains depending on the class of the antibody. By binding to specific proteins, the Fc region ensures that each antibody generates an appropriate immune response for a given antigen.
- the Fc region also binds to various cell receptors, such as Fc receptors, and other immune molecules, such as complement proteins.
- antibody is used according to its commonly known meaning in the art. Antibodies exist, e.g., as intact immunoglobulins or as a number of well-characterized fragments produced by digestion with various peptidases. Thus, for example, pepsin digests an antibody below the disulfide linkages in the hinge region to produce F(ab)'2, a dimer of Fab which itself is a light chain joined to VH-CHI by a disulfide bond. The F(ab)'2 may be reduced under mild conditions to break the disulfide linkage in the hinge region, thereby converting the F(ab)' 2 dimer into an Fab' monomer.
- the Fab' monomer is essentially Fab with part of the hinge region (see Fundamental Immunology (Paul ed., 3d ed. 1993). While various antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such fragments may be synthesized de novo either chemically or by using recombinant DNA methodology. Thus, the term antibody, as used herein, also includes antibody fragments either produced by the modification of whole antibodies, or those synthesized de novo using recombinant DNA methodologies (e.g., single chain Fv) or those identified using phage display libraries (see, e.g., McCafferty et al, Nature 348:552-554 (1990)).
- an antibody as referred to herein further includes antibody variants such as single domain antibodies.
- an antibody includes a single monomeric variable antibody domain.
- the antibody includes a variable light chain (VL) domain or a variable heavy chain (VH) domain.
- the antibody is a variable light chain (VL) domain or a variable heavy chain (VH) domain.
- any technique known in the art can be used (see, e.g., Kohler & Milstein, Nature 256:495-497 (1975); Kozbor etal., Immunology Today 4:72 (1983); Cole etal., pp.
- mAb Monoclonal Antibodies and Cancer Therapy (1985)
- “Monoclonal” antibodies refer to antibodies derived from a single clone. Techniques for the production of single chain antibodies (U.S. Pat. No. 4,946,778) can be adapted to produce antibodies to polypeptides of this invention. Also, transgenic mice, or other organisms such as other mammals, may be used to express humanized antibodies. Alternatively, phage display technology can be used to identify antibodies and heteromeric Fab fragments that specifically bind to selected antigens (see, e.g., McCafferty et al, Nature 348:552-554 (1990); Marks etal, Biotechnology 10:779-783 (1992)).
- a single-chain variable fragment is typically a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a short linker peptide of 10 to about 25 amino acids.
- the linker may usually be rich in glycine for flexibility, as well as serine or threonine for solubility.
- the linker can either connect the N- terminus of the VH with the C -terminus of the VL, or vice versa.
- the epitope of a mAb is the region of its antigen to which the mAb binds.
- Two antibodies bind to the same or overlapping epitope if each competitively inhibits (blocks) binding of the other to the antigen. That is, a lx, 5x, lOx, 20x or lOOx excess of one antibody inhibits binding of the other by at least 30% but preferably 50%, 75%, 90% or even 99% as measured in a competitive binding assay (see, e.g., Junghans et al, Cancer Res. 50: 1495, 1990).
- two antibodies have the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
- Two antibodies have overlapping epitopes if some amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
- the genes encoding the heavy and light chains of an antibody of interest can be cloned from a cell, e.g., the genes encoding a monoclonal antibody can be cloned from a hybridoma and used to produce a recombinant monoclonal antibody.
- Gene libraries encoding heavy and light chains of monoclonal antibodies can also be made from hybridoma or plasma cells. Random combinations of the heavy and light chain gene products generate a large pool of antibodies with different antigenic specificity (see, e.g., Kuby, Immunology (3rd ed. 1997)).
- Techniques for the production of single chain antibodies or recombinant antibodies U.S. Patent 4,946,778, U.S. Patent No.
- transgenic mice or other organisms such as other mammals, may be used to express humanized or human antibodies (see, e.g., U.S. Patent Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, Marks et al., Bio/Technology 10:779-783 (1992); Lonberg et al., Nature 368:856-859 (1994); Morrison, Nature 368:812-13 (1994); Fishwild et al., Nature Biotechnology 14:845-51 (1996); Neuberger, Nature Biotechnology 14:826 (1996); and Lonberg & Huszar, Intern.
- phage display technology can be used to identify antibodies and heteromeric Fab fragments that specifically bind to selected antigens (see, e.g., McCafferty et al., Nature 348:552-554 (1990); Marks et al., Biotechnology 10:779-783 (1992)).
- Antibodies can also be made bispecific, i.e., able to recognize two different antigens (see, e.g., WO 93/08829, Traunecker et al., EMBO J. 10:3655-3659 (1991); and Suresh et al., Methods in Enzymology 121:210 (1986)).
- Antibodies can also be heteroconjugates, e.g., two covalently joined antibodies, or immunotoxins (see, e.g., U.S. Patent No. 4,676,980 , WO 91/00360; WO 92/200373; and EP 03089).
- a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain. Humanization can be essentially performed following the method of Winter and co-workers (see, e.g., Morrison et al., PNAS USA, 81:6851-6855 (1984), Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Morrison and Oi, Adv.
- humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
- polynucleotides comprising a first sequence coding for humanized immunoglobulin framework regions and a second sequence set coding for the desired immunoglobulin complementarity determining regions can be produced synthetically or by combining appropriate cDNA and genomic DNA segments.
- Human constant region DNA sequences can be isolated in accordance with well known procedures from a variety of human cells.
- a "chimeric antibody” is an antibody molecule in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule which confers new properties to the chimeric antibody, e.g., an enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity.
- the preferred antibodies of, and for use according to the invention include humanized and/or chimeric monoclonal antibodies.
- the specified antibodies bind to a particular protein at least two times the background and more typically more than 10 to 100 times background.
- Specific binding to an antibody under such conditions requires an antibody that is selected for its specificity for a particular protein.
- polyclonal antibodies can be selected to obtain only a subset of antibodies that are specifically immunoreactive with the selected antigen and not with other proteins.
- This selection may be achieved by subtracting out antibodies that cross-react with other molecules.
- a variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein.
- solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Using Antibodies, A Laboratory Manual (1998) for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity).
- a "ligand” refers to an agent, e.g., a polypeptide or other molecule, capable of binding to a receptor or antibody, antibody variant, antibody region or fragment thereof.
- the term “antibody-drug conjugate” or “ADC” refers to a therapeutic agent conjugated or otherwise covalently bound to to an antibody.
- ROR2 protein or “ROR2” as used herein includes any of the recombinant or naturally-occurring forms of Receptor tyrosine kinase-like orphan receptor 2, also known as Tyrosine-protein kinase transmembrane receptor ROR2, Neurotrophic tyrosine kinase receptor- related 2, or variants or homologs thereof that maintain ROR2 activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to ROR2).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring ROR2 protein.
- the ROR2 protein is substantially identical to the protein identified by SEQ ID NO: 18.
- the ROR2 protein is substantially identical to the protein identified by the UniProt reference number Q01974 or a variant or homolog having substantial identity thereto.
- the ROR2 protein is substantially identical to the protein identified by the UniProt reference number A1L4F5 or a variant or homolog having substantial identity thereto.
- the ROR2 protein is substantially identical to the protein identified by the UniProt reference number Q8C3W2 or a variant or homolog having substantial identity thereto.
- the named protein includes any of the protein’s naturally occurring forms, variants or homologs that maintain the protein transcription factor activity (e.g., within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to the native protein).
- variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring form.
- the protein is the protein as identified by its NCBI sequence reference.
- the protein is the protein as identified by its NCBI sequence reference, homolog or functional fragment thereof.
- the term "gene” means the segment of DNA involved in producing a protein; it includes regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons).
- the leader, the trailer as well as the introns include regulatory elements that are necessary during the transcription and the translation of a gene.
- a “protein gene product” is a protein expressed from a particular gene.
- plasmid refers to a nucleic acid molecule that encodes for genes and/or regulatory elements necessary for the expression of genes. Expression of a gene from a plasmid can occur in cis or in trans. If a gene is expressed in cis, the gene and the regulatory elements are encoded by the same plasmid. Expression in trans refers to the instance where the gene and the regulatory elements are encoded by separate plasmids.
- transfection can be used interchangeably and are defined as a process of introducing a nucleic acid molecule or a protein to a cell.
- Nucleic acids are introduced to a cell using non-viral or viral-based methods.
- the nucleic acid molecules may be gene sequences encoding complete proteins or functional portions thereof.
- Non-viral methods of transfection include any appropriate transfection method that does not use viral DNA or viral particles as a delivery system to introduce the nucleic acid molecule into the cell.
- Exemplary non-viral transfection methods include calcium phosphate transfection, liposomal transfection, nucleofection, sonoporation, transfection through heat shock, magnetifection and electroporation.
- the nucleic acid molecules are introduced into a cell using electroporation following standard procedures well known in the art.
- any useful viral vector may be used in the methods described herein.
- viral vectors include, but are not limited to retroviral, adenoviral, lentiviral and adeno-associated viral vectors.
- the nucleic acid molecules are introduced into a cell using a retroviral vector following standard procedures well known in the art.
- the terms "transfection” or "transduction” also refer to introducing proteins into a cell from the external environment. Typically, transduction or transfection of a protein relies on attachment of a peptide or protein capable of crossing the cell membrane to the protein of interest. See, e.g.. Ford etal. (2001) Gene Therapy 8:1-4 and Prochiantz (2007) Nat. Methods 4:119-20.
- a “label” or a “detectable moiety” is a composition detectable by spectroscopic, photochemical, biochemical, immunochemical, chemical, or other physical means.
- useful labels include 32P, fluorescent dyes, electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, digoxigenin, or haptens and proteins or other entities which can be made detectable, e.g., by incorporating a radiolabel into a peptide or antibody specifically reactive with a target peptide. Any appropriate method known in the art for conjugating an antibody to the label may be employed, e.g., using methods described in Hermanson, Bioconjugate Techniques 1996, Academic Press, Inc., San Diego.
- the agent may be reacted with another long-tailed reagent having a long tail with one or more chelating groups attached to the long tail for binding to these ions.
- the long tail may be a polymer such as a polylysine, polysaccharide, or other derivatized or derivatizable chain having pendant groups to which the metals or ions may be added for binding.
- chelating groups examples include, but are not limited to, ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTP A), DOTA, NOTA, NETA, TETA, porphyrins, polyamines, crown ethers, bis-thiosemicarbazones, polyoximes, and like groups.
- EDTA ethylenediaminetetraacetic acid
- DTP A diethylenetriaminepentaacetic acid
- DOTA diethylenetriaminepentaacetic acid
- NOTA NOTA
- NETA NETA
- TETA porphyrins
- polyamines crown ethers
- bis-thiosemicarbazones polyoximes, and like groups.
- chelates when complexed with non-radioactive metals, such as manganese, iron and gadolinium are useful for MRI, when used along with the antibodies and carriers described herein.
- Macrocyclic chelates such as NOTA, DOTA, and TETA are of use with a variety of metals and radiometals including, but not limited to, radionuclides of gallium, yttrium and copper, respectively.
- Other ring-type chelates such as macrocyclic polyethers, which are of interest for stably binding nuclides, such as 223 Ra for RAIT may be used.
- chelating moieties may be used to attach a PET imaging agent, such as an A1- 18 F complex, to a targeting molecule for use in PET analysis.
- a PET imaging agent such as an A1- 18 F complex
- a targeting molecule for use in PET analysis.
- Contacting is used in accordance with its plain ordinary meaning and refers to the process of allowing at least two distinct species (e.g. antibodies and antigens) to become sufficiently proximal to react, interact, or physically touch. It should be appreciated; however, that the resulting reaction product can be produced directly from a reaction between the added reagents or from an intermediate from one or more of the added reagents which can be produced in the reaction mixture.
- contacting may include allowing two species to react, interact, or physically touch, wherein the two species may be, for example, a pharmaceutical composition as provided herein and a cell.
- contacting includes, for example, allowing a pharmaceutical composition as described herein to interact with a cell.
- a "cell” as used herein, refers to a cell carrying out metabolic or other function sufficient to preserve or replicate its genomic DNA.
- a cell can be identified by well-known methods in the art including, for example, presence of an intact membrane, staining by a particular dye, ability to produce progeny or, in the case of a gamete, ability to combine with a second gamete to produce a viable offspring.
- Cells may include prokaryotic and eukaryotic cells.
- Prokaryotic cells include but are not limited to bacteria.
- Eukaryotic cells include, but are not limited to, yeast cells and cells derived from plants and animals, for example mammalian, insect (e.g., spodoptera) and human cells.
- recombinant when used with reference, e.g., to a cell, nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified.
- recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all.
- Transgenic cells and plants are those that express a heterologous gene or coding sequence, typically as a result of recombinant methods.
- nucleic acid or protein when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is essentially free of other cellular components with which it is associated in the natural state. It can be, for example, in a homogeneous state and may be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein that is the predominant species present in a preparation is substantially purified.
- heterologous when used with reference to portions of a nucleic acid indicates that the nucleic acid comprises two or more subsequences that are not found in the same relationship to each other in nature.
- the nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged to make a new functional nucleic acid, e.g., a promoter from one source and a coding region from another source.
- a heterologous protein indicates that the protein comprises two or more subsequences that are not found in the same relationship to each other in nature (e.g., a fusion protein).
- exogenous refers to a molecule or substance (e.g. , a compound, nucleic acid or protein) that originates from outside a given cell or organism.
- an "exogenous promoter” as referred to herein is a promoter that does not originate from the cell or organism it is expressed by.
- endogenous or endogenous promoter refers to a molecule or substance that is native to, or originates within, a given cell or organism.
- inhibition means negatively affecting (e.g., decreasing proliferation) or killing the cell.
- inhibition refers to reduction of a disease or symptoms of disease (e.g., cancer, cancer cell proliferation).
- inhibition includes, at least in part, partially or totally blocking stimulation, decreasing, preventing, or delaying activation, or inactivating, desensitizing, or down-regulating signal transduction or enzymatic activity or the amount of a protein (e.g. ROR2 protein).
- an “inhibitor” is a compound or protein that inhibits a receptor or another protein, e.g., , by binding, partially or totally blocking, decreasing, preventing, delaying, inactivating, desensitizing, or down-regulating activity (e.g., a receptor activity or a protein activity).
- the term “inhibition”, “inhibit”, “inhibiting” and the like in reference to a protein-inhibitor interaction means negatively affecting (e.g. decreasing) the activity or function of the protein (e.g. ROR2 protein) relative to the activity or function of the protein in the absence of the inhibitor.
- inhibition means negatively affecting (e.g. decreasing) the concentration or levels of ROR2 relative to the concentration or level of the protein in the absence of the inhibitor.
- inhibition refers to reduction of a disease or symptoms of disease.
- inhibition refers to a reduction in the activity of ROR2.
- inhibition includes, at least in part, partially or totally blocking stimulation, decreasing, preventing, or delaying activation, or inactivating, desensitizing, or down-regulating signal transduction or enzymatic activity or the amount of ROR2.
- inhibition refers to a reduction of activity of ROR2 resulting from a direct interaction (e.g. an inhibitor binds to ROR2).
- inhibition refers to a reduction of activity of ROR2 from an indirect interaction (e.g. an inhibitor binds to a protein that activates ROR2, thereby preventing target protein activation).
- the terms “inhibitor,” “repressor” or “antagonist” or “downregulator” interchangeably refer to a substance capable of detectably decreasing the expression or activity of a given gene or protein (e.g. ROR2 protein).
- the antagonist can decrease ROR2 expression or activity 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more in comparison to a control in the absence of the antagonist.
- ROR2 expression or activity is 1.5-fold, 2- fold, 3-fold, 4-fold, 5-fold, 10-fold or lower than the expression or activity in the absence of the antagonist.
- expression includes any step involved in the production of the polypeptide including, but not limited to, transcription, post-transcriptional modification, translation, post- translational modification, and secretion. Expression can be detected using conventional techniques for detecting protein (e.g., ELISA, Western blotting, flow cytometry, immunofluorescence, immunohistochemistry, etc. ).
- Bio sample refers to materials obtained from or derived from a subject or patient.
- a biological sample includes sections of tissues such as biopsy and autopsy samples, and frozen sections taken for histological purposes.
- Such samples include bodily fluids such as blood and blood fractions or products (e.g., serum, plasma, platelets, red blood cells, and the like), sputum, tissue, cultured cells (e.g., primary cultures, explants, and transformed cells) stool, urine, synovial fluid, joint tissue, synovial tissue, synoviocytes, fibroblast-like synoviocytes, macrophage-like synoviocytes, immune cells, hematopoietic cells, fibroblasts, macrophages, T cells, etc.
- bodily fluids such as blood and blood fractions or products (e.g., serum, plasma, platelets, red blood cells, and the like), sputum, tissue, cultured cells (e.g., primary cultures, explants, and transformed cells) stool, urine, synovial fluid, joint tissue
- a biological sample is typically obtained from a eukaryotic organism, such as a mammal such as a primate e.g., chimpanzee or human; cow; dog; cat; a rodent, e.g., guinea pig, rat, mouse; rabbit; or a bird; reptile; or fish.
- a mammal such as a primate e.g., chimpanzee or human; cow; dog; cat; a rodent, e.g., guinea pig, rat, mouse; rabbit; or a bird; reptile; or fish.
- a “control” or “standard control” refers to a sample, measurement, or value that serves as a reference, usually a known reference, for comparison to a test sample, measurement, or value.
- a test sample can be taken from a patient suspected of having a given disease (e.g. cancer) and compared to a known normal (non-diseased) individual (e.g. a standard control subject).
- a standard control can also represent an average measurement or value gathered from a population of similar individuals (e.g. standard control subjects) that do not have a given disease (i.e. standard control population), e.g., healthy individuals with a similar medical background, same age, weight, etc.
- a standard control value can also be obtained from the same individual, e.g. from an earlier-obtained sample from the patient prior to disease onset.
- a control can be devised to compare therapeutic benefit based on pharmacological data (e.g., half-life) or therapeutic measures (e.g., comparison of side effects). Controls are also valuable for determining the significance of data. For example, if values for a given parameter are widely variant in controls, variation in test samples will not be considered as significant.
- standard controls can be designed for assessment of any number of parameters (e.g. RNA levels, protein levels, specific cell types, specific bodily fluids, specific tissues, etc).
- Standard controls are also valuable for determining the significance (e.g. statistical significance) of data. For example, if values for a given parameter are widely variant in standard controls, variation in test samples will not be considered as significant.
- “Patient” or “subject in need thereof’ refers to a living organism suffering from or prone to a disease or condition that can be treated by administration of a composition or pharmaceutical composition as provided herein.
- Non-limiting examples include humans, other mammals, bovines, rats, mice, dogs, monkeys, goat, sheep, cows, deer, and other non-mammalian animals.
- a patient is human.
- the terms “disease” or “condition” refer to a state of being or health status of a patient or subject capable of being treated with the compounds or methods provided herein.
- the disease may be a cancer.
- the cancer may refer to a solid tumor malignancy.
- Solid tumor malignancies include malignant tumors that may be devoid of fluids or cysts.
- the solid tumor malignancy may include breast cancer, ovarian cancer, pancreatic cancer, cerv ical cancer, gastric cancer, renal cancer, head and neck cancer, bone cancer, skm cancer or prostate cancer.
- cancer refers to human cancers and carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, including solid and lymphoid cancers, kidney, breast, lung, bladder, colon, ovarian, prostate, pancreas, stomach, brain, head and neck, skin, uterine, testicular, glioma, esophagus, and liver cancer, including hepatocarcinoma, lymphoma, including B-acute lymphoblastic lymphoma, non-Hodgkin’s lymphomas (e.g., Burkitt’s, Small Cell, and Large Cell lymphomas), Hodgkin’s lymphoma, leukemia (including acute myeloid leukemia (AML), ALL, and CML), or multiple myeloma.
- AML acute myeloid leukemia
- ALL acute myeloid leukemia
- CML multiple myeloma
- cancer refers to all types of cancer, neoplasm or malignant tumors found in mammals (e.g., humans), including leukemia, carcinomas and sarcomas.
- exemplary cancers that may be treated with a compound or method provided herein include breast cancer, colon cancer, kidney cancer, leukemia, lung cancer, melanoma, ovarian cancer, prostate cancer, pancreatic cancer, brain cancer, liver cancer, gastric cancer or a sarcoma.
- leukemia refers broadly to progressive, malignant diseases of the blood- forming organs and is generally characterized by a distorted proliferation and development of leukocytes and their precursors in the blood and bone marrow. Leukemia is generally clinically classified on the basis of (1) the duration and character of the disease-acute or chronic; (2) the type of cell involved; myeloid (myelogenous), lymphoid (lymphogenous), or monocytic; and (3) the increase or non-increase in the number abnormal cells in the blood-leukemic or aleukemic (subleukemic).
- Exemplary leukemias that may be treated with a compound or method provided herein include, for example, acute myeloid leukemia, acute nonlymphocytic leukemia, chronic lymphocytic leukemia, acute granulocytic leukemia, chronic granulocytic leukemia, acute promyelocytic leukemia, adult T-cell leukemia, aleukemic leukemia, a leukocythemic leukemia, basophylic leukemia, blast cell leukemia, bovine leukemia, chronic myelocytic leukemia, leukemia cutis, embryonal leukemia, eosinophilic leukemia, Gross' leukemia, hairy-cell leukemia, hemoblastic leukemia, hemocytoblastic leukemia, histiocytic leukemia, stem cell leukemia, acute monocytic leukemia, leukopenic leukemia, lymphatic leukemia, lymphoblastic leukemia, lymphocytic leukemia
- sarcoma generally refers to a tumor which is made up of a substance like the embryonic connective tissue and is generally composed of closely packed cells embedded in a fibrillar or homogeneous substance.
- Sarcomas that may be treated with a compound or method provided herein include a chondrosarcoma, fibrosarcoma, lymphosarcoma, melanosarcoma, myxosarcoma, osteosarcoma, Abemethy's sarcoma, adipose sarcoma, liposarcoma, alveolar soft part sarcoma, ameloblastic sarcoma, botryoid sarcoma, chloroma sarcoma, chorio carcinoma, embryonal sarcoma, Wilms' tumor sarcoma, endometrial sarcoma, stromal sarcoma, Ewing's sarcoma, fascial sar
- melanoma is taken to mean a tumor arising from the melanocytic system of the skin and other organs.
- Melanomas that may be treated with a compound or method provided herein include, for example, acral -lentiginous melanoma, amelanotic melanoma, benign juvenile melanoma, Cloudman's melanoma, S91 melanoma, Harding-Passey melanoma, juvenile melanoma, lentigo maligna melanoma, malignant melanoma, nodular melanoma, subungal melanoma, or superficial spreading melanoma.
- carcinoma refers to a malignant new growth made up of epithelial cells tending to infiltrate the surrounding tissues and give rise to metastases.
- exemplary carcinomas that may be treated with a compound or method provided herein include, for example, medullary thyroid carcinoma, familial medullary thyroid carcinoma, acinar carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, carcinoma adenomatosum, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma, basal cell carcinoma, carcinoma basocellulare, basaloid carcinoma, basosquamous cell carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma, chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid
- the terms "metastasis,” “metastatic,” and “metastatic cancer” can be used interchangeably and refer to the spread of a proliferative disease or disorder, e.g., cancer, from one organ or another non-adjacent organ or body part. Cancer occurs at an originating site, e.g., breast, which site is referred to as a primary tumor, e.g., primary breast cancer. Some cancer cells in the primary tumor or originating site acquire the ability to penetrate and infiltrate surrounding normal tissue in the local area and/or the ability to penetrate the walls of the lymphatic system or vascular system circulating through the system to other sites and tissues in the body.
- a second clinically detectable tumor formed from cancer cells of a primary tumor is referred to as a metastatic or secondary tumor.
- the metastatic tumor and its cells are presumed to be similar to those of the original tumor.
- the secondary tumor in the breast is referred to a metastatic lung cancer.
- metastatic cancer refers to a disease in which a subject has or had a primary tumor and has one or more secondary tumors.
- non-metastatic cancer or subjects with cancer that is not metastatic refers to diseases in which subjects have a primary tumor but not one or more secondary tumors.
- metastatic lung cancer refers to a disease in a subject with or with a history of a primary lung tumor and with one or more secondary tumors at a second location or multiple locations, e.g., in the breast.
- a disease e.g. a protein associated disease, a cancer associated with ROR2 activity, ROR2 associated cancer, ROR2 associated disease (e.g., cancer, inflammatory disease, autoimmune disease, or infectious disease)
- the disease e.g. cancer, inflammatory disease, autoimmune disease, or infectious disease
- a symptom of the disease is caused by (in whole or in part) the substance or substance activity or function.
- a causative agent could be a target for treatment of the disease.
- a cancer associated with ROR2 activity or function or a ROR2 associated disease may be treated with a ROR2 modulator or ROR2 inhibitor, in the instance where increased ROR2 activity or function (e.g. signaling pathway activity) causes the disease (e.g., cancer, inflammatory disease, autoimmune disease, or infectious disease).
- a ROR2 modulator or ROR2 inhibitor in the instance where increased ROR2 activity or function (e.g. signaling pathway activity) causes the disease (e.g., cancer, inflammatory disease, autoimmune disease, or infectious disease).
- an inflammatory disease associated with ROR2 activity or function or an ROR2 associated inflammatory disease may be treated with an ROR2 modulator or ROR2 inhibitor, in the instance where increased ROR2 activity or function (e.g. signaling pathway activity) causes the disease.
- signaling pathway refers to a series of interactions between cellular and optionally extra-cellular components (e.g. proteins, nucleic acids, small molecules, ions, lipids) that conveys a change in one component to one or more other components, which in turn may convey a change to additional components, which is optionally propagated to other signaling pathway components.
- extra-cellular components e.g. proteins, nucleic acids, small molecules, ions, lipids
- aberrant refers to different from normal. When used to describe enzymatic activity, aberrant refers to activity that is greater or less than a normal control or the average of normal non-diseased control samples. Aberrant activity may refer to an amount of activity that results in a disease, wherein returning the aberrant activity to a normal or non disease-associated amount (e.g. by using a method as described herein), results in reduction of the disease or one or more disease symptoms.
- a "therapeutic agent” as referred to herein, is a composition useful in treating or preventing a disease such as cancer (e.g., leukemia).
- the therpaeutic agent is an anti-cancer agent.
- Anti-cancer agent is used in accordance with its plain ordinary meaning and refers to a composition (e.g. compound, drug, antagonist, inhibitor, modulator) having antineoplastic properties or the ability to inhibit the growth or proliferation of cells.
- an anti-cancer agent is a chemotherapeutic.
- an anti-cancer agent is an agent identified herein having utility in methods of treating cancer.
- an anti-cancer agent is an agent approved by the FDA or similar regulatory agency of a country other than the USA, for treating cancer.
- an “anticancer agent” as used herein refers to a molecule (e.g. compound, peptide, protein, nucleic acid, 0103) used to treat cancer through destruction or inhibition of cancer cells or tissues. Anticancer agents may be selective for certain cancers or certain tissues. In embodiments, anticancer agents herein may include epigenetic inhibitors and multi-kinase inhibit “Anti-cancer agent” and “anticancer agent” are used in accordance with their plain ordinary meaning and refers to a composition (e.g. compound, drug, antagonist, inhibitor, modulator) having antineoplastic properties or the ability to inhibit the growth or proliferation of cells. In some embodiments, an anti-cancer agent is a chemotherapeutic.
- an anti cancer agent is an agent identified herein having utility in methods of treating cancer.
- an anti-cancer agent is an agent approved by the FDA or similar regulatory agency of a country other than the USA, for treating cancer.
- anti-cancer agents include, but are not limited to, MEK (e.g. MEK1, MEK2, or MEK1 and MEK2) inhibitors (e.g.
- alkylating agents e.g., cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan, mechlorethamine, uramustine, thiotepa, nitrosoureas, nitrogen mustards (e.g., mechloroethamine, cyclophosphamide, chlorambucil, meiphalan), ethylenimine and methylmelamines (e.g., hexamethlymelamine, thiotepa), alkyl sulfon
- alkylating agents e.g., cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan, mechlorethamine, uramustine, thiotepa, nitrosoureas, nitrogen mustards (e.g., mechloroethamine, cyclophosphamide, chlorambucil
- Taxol.TM i.e. paclitaxel
- Taxotere.TM compounds comprising the taxane skeleton, Erbulozole (i.e. R-55104), Dolastatin 10 (i.e. DLS-10 and NSC-376128), Mivobulin isethionate (i.e. as CI-980), Vincristine, NSC-639829, Discodermolide (i.e. as NVP-XX-A-296), ABT-751 (Abbott, i.e. E-7010), Altorhyrtins (e.g. Altorhyrtin A and Altorhyrtin C),
- Altorhyrtins e.g. Altorhyrtin A and Altorhyrtin C
- Spongistatins e.g. Spongistatin 1, Spongistatin 2, Spongistatin 3, Spongistatin 4, Spongistatin 5, Spongistatin 6, Spongistatin 7, Spongistatin 8, and Spongistatin 9
- Cemadotin hydrochloride i.e. LU-103793 andNSC-D-669356
- Epothilones e.g. Epothilone A, Epothilone B, Epothilone C (i.e. desoxyepothilone A or dEpoA), Epothilone D (i.e.
- Epothilone E Epothilone F
- Epothilone B N-oxide Epothilone A N-oxide
- 16-aza-epothilone B Epothilone B
- 21-aminoepothilone B i.e. BMS-310705
- 21 -hydroxy epothilone D i.e. Desoxyepothilone F and dEpoF
- 26-fluoroepothilone Auristatin PE (i.e. NSC-654663), Soblidotin (i.e. TZT-1027), LS-4559-P (Pharmacia, i.e.
- LS-4577 LS-4578 (Pharmacia, i.e. LS- 477-P), LS-4477 (Pharmacia), LS-4559 (Pharmacia), RPR-112378 (Aventis), Vincristine sulfate, DZ-3358 (Daiichi), FR-182877 (Fujisawa, i.e. WS-9885B), GS-164 (Takeda), GS-198 (Takeda), KAR-2 (Hungarian Academy of Sciences), BSF-223651 (BASF, i.e.
- ILX-651 and LU-223651 SAH-49960 (Lilly/Novartis), SDZ-268970 (Lilly/Novartis), AM-97 (Armad/Kyowa Hakko), AM-132 (Armad), AM-138 (Armad/Kyowa Hakko), IDN-5005 (Indena), Cryptophycin 52 (i.e. LY-355703), AC-7739 (Ajinomoto, i.e. AVE-8063A and CS-39.HC1), AC-7700 (Ajinomoto, i.e.
- T-900607 RPR-115781 (Aventis), Eleutherobins (such as Desmethyleleutherobin, Desaetyleleutherobin, lsoeleutherobin A, and Z-Eleutherobin), Caribaeoside, Caribaeolin, Halichondrin B, D-64131 (Asia Medica), D- 68144 (Asia Medica), Diazonamide A, A-293620 (Abbott), NPI-2350 (Nereus), Taccalonolide A, TUB-245 (Aventis), A-259754 (Abbott), Diozostatin, (-)-Phenylahistin (i.e.
- NSCL-96F03-7 D-68838 (Asia Medica), D-68836 (Asia Medica), Myoseverin B, D-43411 (Zentaris, i.e. D- 81862), A-289099 (Abbott), A-318315 (Abbott), HTI-286 (i.e.
- SPA- 110 trifluoroacetate salt
- D-82317 Zentaris
- D-82318 Zentaris
- SC-12983 NCI
- steroids e.g dexamethasone
- finasteride aromatase inhibitors
- gonadotropin-releasing hormone agonists GnRH
- goserelin or leuprolide adrenocorticosteroids
- progestins e.g., hydroxy progesterone caproate, megestrol acetate, medroxyprogesterone acetate
- estrogens e.g., diethlystilbestrol, ethinyl estradiol
- antiestrogen e.g., tamoxifen
- androgens e.g.
- gefitinib Iressa TM
- erlotinib Tarceva TM
- cetuximab ErbituxTM
- lapatinib TykerbTM
- panitumumab VectibixTM
- vandetanib CaprelsaTM
- afatinib/BIBW2992 CI-1033/canertinib, neratinib/HKI-272, CP-724714, TAK-285, AST-1306, ARRY334543, ARRY-380, AG-1478, dacomitinib/PF299804, OSI-420/desmethyl erlotinib, AZD8931, AEE788, pelitinib/EKB-569, CUDC-101, WZ8040, WZ4002, WZ3146, AG-490, XL647, PD153035, BMS-599626), sorafenib, imatinib, sunitinib,
- treating or “treatment of’ a condition, disease or disorder or symptoms associated with a condition, disease or disorder refers to an approach for obtaining beneficial or desired results, including clinical results.
- beneficial or desired clinical results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions, diminishment of extent of condition, disorder or disease, stabilization of the state of condition, disorder or disease, prevention of development of condition, disorder or disease, prevention of spread of condition, disorder or disease, delay or slowing of condition, disorder or disease progression, delay or slowing of condition, disorder or disease onset, amelioration or palliation of the condition, disorder or disease state, and remission, whether partial or total.
- Treating can also mean prolonging survival of a subject beyond that expected in the absence of treatment. “Treating” can also mean inhibiting the progression of the condition, disorder or disease, slowing the progression of the condition, disorder or disease temporarily, although in some instances, it involves halting the progression of the condition, disorder or disease permanently.
- treatment, treat, or treating refers to a method of reducing the effects of one or more symptoms of a disease or condition characterized by expression of the protease or symptom of the disease or condition characterized by expression of the protease.
- treatment can refer to a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% reduction in the severity of an established disease, condition, or symptom of the disease or condition.
- a method for treating a disease is considered to be a treatment if there is a 10% reduction in one or more symptoms of the disease in a subject as compared to a control.
- the reduction can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%,
- references to decreasing, reducing, or inhibiting include a change of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater as compared to a control level and such terms can include but do not necessarily include complete elimination.
- dose refers to the amount of active ingredient given to an individual at each administration.
- the dose will vary depending on a number of factors, including the range of normal doses for a given therapy, frequency of administration; size and tolerance of the individual; severity of the condition; risk of side effects; and the route of administration.
- dose form refers to the particular format of the pharmaceutical or pharmaceutical composition, and depends on the route of administration.
- a dosage form can be in a liquid form for nebulization, e.g., for inhalants, in a tablet or liquid, e.g., for oral delivery, or a saline solution, e.g., for injection.
- terapéuticaally effective dose or amount as used herein is meant a dose that produces effects for which it is administered (e.g. treating or preventing a disease).
- dose and formulation will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Remington: The Science and Practice of Pharmacy, 20th Edition,
- a therapeutically effective amount will show an increase or decrease of at least 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%.
- Therapeutic efficacy can also be expressed as “-fold” increase or decrease.
- a therapeutically effective amount can have at least a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a standard control.
- a therapeutically effective dose or amount may ameliorate one or more symptoms of a disease.
- a therapeutically effective dose or amount may prevent or delay the onset of a disease or one or more symptoms of a disease when the effect for which it is being administered is to treat a person who is at risk of developing the disease.
- administering means oral administration, administration as a suppository, topical contact, intravenous, intraperitoneal, intramuscular, intralesional, intrathecal, intranasal or subcutaneous administration, or the implantation of a slow-release device, e.g., a mini-osmotic pump, to a subject.
- Administration is by any route, including parenteral and transmucosal (e.g., buccal, sublingual, palatal, gingival, nasal, vaginal, rectal, or transdermal).
- Parenteral administration includes, e.g., intravenous, intramuscular, intra-arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial.
- Other modes of delivery include, but are not limited to, the use of liposomal formulations, intravenous infusion, transdermal patches, etc.
- co-administer it is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of one or more additional therapies, for example cancer therapies such as chemotherapy, hormonal therapy, radiotherapy, or immunotherapy.
- the compounds of the invention can be administered alone or can be coadministered to the patient. Coadministration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound).
- compositions of the present invention can be delivered by transdermally, by a topical route, formulated as applicator sticks, solutions, suspensions, emulsions, gels, creams, ointments, pastes, jellies, paints, powders, and aerosols.
- compositions of the present invention may additionally include components to provide sustained release and/or comfort.
- Such components include high molecular weight, anionic mucomimetic polymers, gelling polysaccharides and finely-divided drug carrier substrates. These components are discussed in greater detail in U.S. Pat. Nos. 4,911,920; 5,403,841; 5,212,162; and 4,861,760. The entire contents of these patents are incorporated herein by reference in their entirety for all purposes.
- the compositions of the present invention can also be delivered as microspheres for slow release in the body.
- microspheres can be administered via intradermal injection of drug-containing microspheres, which slowly release subcutaneously (see Rao, J. Biomater Sci. Polym. Ed.
- the formulations of the compositions of the present invention can be delivered by the use of liposomes which fuse with the cellular membrane or are endocytosed, i.e., by employing receptor ligands attached to the liposome, that bind to surface membrane protein receptors of the cell resulting in endocytosis.
- liposomes particularly where the liposome surface carries receptor ligands specific for target cells, or are otherwise preferentially directed to a specific organ, one can focus the delivery of the compositions of the present invention into the target cells in vivo.
- the compositions of the present invention can also be delivered as nanoparticles.
- composition will generally comprise agents for buffering and preservation in storage, and can include buffers and carriers for appropriate delivery, depending on the route of administration.
- “Pharmaceutically acceptable excipient” and “pharmaceutically acceptable carrier” refer to a substance that aids the administration of an active agent to and absorption by a subject and can be included in the compositions of the present invention without causing a significant adverse toxicological effect on the patient.
- Non-limiting examples of pharmaceutically acceptable excipients include water, NaCl, normal saline solutions, lactated Ringer’s, normal sucrose, normal glucose, binders, fillers, disintegrants, lubricants, coatings, sweeteners, flavors, salt solutions (such as Ringer's solution), alcohols, oils, gelatins, carbohydrates such as lactose, amylose or starch, fatty acid esters, hydroxymethy cellulose, polyvinyl pyrrolidine, and colors, and the like.
- Such preparations can be sterilized and, if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
- auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
- auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
- auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents
- pharmaceutically acceptable salt refers to salts derived from a variety of organic and inorganic counter ions well known in the art and include, by way of example only, sodium, potassium, calcium, magnesium, ammonium, tetraalkylammonium, and the like; and when the molecule contains a basic functionality, salts of organic or inorganic acids, such as hydrochloride, hydrobromide, tartrate, mesylate, acetate, maleate, oxalate and the like.
- preparation is intended to include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it.
- cachets and lozenges are included. Tablets, powders, capsules, pills, cachets, and lozenges can be used as solid dosage forms suitable for oral administration.
- the pharmaceutical preparation is optionally in unit dosage form.
- the preparation is subdivided into unit doses containing appropriate quantities of the active component.
- the unit dosage form can be a packaged preparation, the package containing discrete quantities of preparation, such as packeted tablets, capsules, and powders in vials or ampoules.
- the unit dosage form can be a capsule, tablet, cachet, or lozenge itself, or it can be the appropriate number of any of these in packaged form.
- the unit dosage form can be of a frozen dispersion.
- antibodies e.g., humanized antibodies, monoclonal antibodies
- antibody fragments e.g., scFvs
- antibody compositions e.g., chimeric antigen receptors, bispecific antibodies
- ROR2 human tyrosine kinase-like orphan receptor 2
- the antibodies and antibody compositions provided herein include novel light and heavy chain domain CDRs and framework regions and have been identified to bind extracellular domains of human ROR2.
- the antibodies provided herein including embodiments thereof may bind the Kringle or the Ig-like domain of ROR2 with high affinity and specificity.
- Applicants have characterized the amino acid residues in the ROR2 extracellular domains, which are important for binding of antibodies as described herein including embodiments thereof.
- Antibodies specifically binding the epitope described herein including embodiments thereof are useful for binding human ROR2 with high effectivity and affinity and inhibiting ROR2 signaling in cells expressing ROR2.
- the antibodies provided herein including embodiments thereof may be used for diagnostic and therapeutic purposes in cancer and other ROR2 -related diseases.
- the variable light chain and the variable heavy chain domains provided herein may, inter alia, form part of an anti-ROR2 chimeric antigen receptor or an anti-ROR2 bispecific antibody.
- anti-ROR2 antibodies provided herein may be attached to therapeutic moieties and used as antibody-drug conjugates (ADC), or they may be attached to a detectable moiety and used for diagnostic purposes.
- ADC antibody-drug conjugates
- the antibodies provided herein including embodiments thereof, have an ability to inhibit migration of ROR2 expressing metastatic cells and therefore are capable of mitigating the risk of metastasis in patients with ROR2-expressing cancer cells
- anti-ROR2 antibodies provided herein are referred to by clone names (e.g., 6E6, 4G9, 5C11 and 5G3).
- the anti-ROR2 antibody is antibody 6E6.
- the antibody 6E6 has a heavy chain variable domain of SEQ ID NO:2 and a light variable domain of SEQ ID NO:4.
- the antibody 6E6 has a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26 and a CDR H3 as set forth in SEQ ID NO:27; and wherein the light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:28, a CDR L2 as set forth in SEQ ID NO:29, and a CDR L3 as set forth in SEQ ID NO:30.
- the anti-ROR2 antibody is antibody 4G9.
- the antibody 4G9 has a heavy chain variable domain of SEQ ID NO:6 and a light variable domain of SEQ ID NO: 8.
- the antibody 4G9 has a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32 and a CDR H3 as set forth in SEQ ID NO:33; and wherein said light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35, and a CDR L3 as set forth in SEQ ID NO:36.
- the anti-ROR2 antibody is antibody 5C11.
- the antibody 5C11 and has a heavy chain variable domain of SEQ ID NO: 10 and a light variable domain of SEQ ID NO: 12.
- the antibody 5C11 has a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:37, a CDR H2 as set forth in SEQ ID NO:38 and a CDR H3 as set forth in SEQ ID NO:39; and wherein said light chain variable domain includes:a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO:41, and a CDR L3 as set forth in SEQ ID NO: 42.
- the anti-ROR2 antibody is antibody 5G3.
- the antibody 5G3 has a heavy chain variable domain of SEQ ID NO: 14 and a light variable domain of SEQ ID NO: 16.
- the antibody 5G3 has a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44 and a CDR H3 as set forth in SEQ ID NO:45; and wherein said light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47, and a CDR L3 as set forth in SEQ ID NO:48.
- an anti-tyrosine kinase-like orphan receptor 2 (ROR2) antibody including a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26 and a CDR H3 as set forth in SEQ ID NO:27; and wherein the light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:28, a CDR L2 as set forth in SEQ ID NO:29, and a CDR L3 as set forth in SEQ ID NO:30.
- ROR2 anti-tyrosine kinase-like orphan receptor 2
- a "light chain variable (VL) domain” as provided herein refers to the variable region of the light chain of an antibody, an antibody variant or fragment thereof.
- the “heavy chain variable (VH) domain” as provided herein refers to the variable region of the heavy chain of an antibody, an antibody variant or fragment thereof.
- the light chain variable domain and the heavy chain variable domain together form the paratope, which binds an antigen (epitope).
- the paratope or antigen-binding site is formed at the N-terminus of an antibody, an antibody variant or fragment thereof.
- the light chain variable (VL) domain includes CDR LI, CDR L2, CDR L3 and FR LI, FR L2, FR L3 and FR L4 (framework regions) of an antibody light chain.
- the heavy chain variable (VH) domain includes CDR HI, CDR H2, CDR H3 and FR HI, FR H2, FR H3 and FR H4 (framework regions) of an antibody heavy chain.
- the light chain variable (VL) domain and a light chain constant (CL) domain form part of an antibody light chain.
- the heavy chain variable (VH) domain and a heavy chain constant (CHI) domain form part of an antibody heavy chain.
- the heavy chain variable (VH) domain and one or more heavy chain constant (CHI, CH2, or CH3) domains form part of an antibody heavy chain.
- the light chain variable (VL) domain forms part of an antibody.
- the heavy chain variable (VH) domain forms part of an antibody.
- the light chain variable (VL) domain forms part of a therapeutic antibody.
- the heavy chain variable (VH) domain forms part of a therapeutic antibody.
- the light chain variable (VL) domain forms part of a human antibody.
- the heavy chain variable (VH) domain forms part of a human antibody.
- the light chain variable (VL) domain forms part of a humanized antibody.
- the heavy chain variable (VH) domain forms part of a humanized antibody. In embodiments, the light chain variable (VL) domain forms part of a chimeric antibody. In embodiments, the heavy chain variable (VH) domain forms part of a chimeric antibody. In embodiments, the light chain variable (VL) domain forms part of an antibody fragment. In embodiments, the heavy chain variable (VH) domain forms part of an antibody fragment. In embodiments, the light chain variable (VL) domain forms part of an antibody variant. In embodiments, the heavy chain variable (VH) domain forms part of an antibody variant. In embodiments, the light chain variable (VL) domain forms part of a Fab. In embodiments, the heavy chain variable (VH) domain forms part of a Fab. In embodiments, the light chain variable (VH) domain forms part of a scFv. In embodiments, the heavy chain variable (VH) domain forms part of a scFv. In embodiments, the heavy chain variable (VH) domain forms part of a s
- the heavy chain variable domain includes the sequence of SEQ ID NO:2. In embodiments, the heavy chain variable domain is the sequence of SEQ ID NO:2. In embodiments, the light chain variable domain includes the sequence of SEQ ID NO:4. In embodiments, the light chain variable domain is the sequence of SEQ ID NO:4.
- the heavy chain variable domain includes a FR HI as set forth in SEQ ID NO:49, a FR H2 as set forth in SEQ ID NO:50, a FR H3 as set forth in SEQ ID NO:51 and a FR H4 as set forth in SEQ ID NO:52.
- the light chain variable domain includes a FR LI as set forth in SEQ ID NO:53, a FR L2 as set forth in SEQ ID NO:54, a FR L3 as set forth in SEQ ID NO:55 and a FR L4 as set forth in SEQ ID NO:56.
- the antibody is capable of binding a ROR2 protein.
- the ROR2 protein is a human ROR2 protein.
- the antibody binds a ROR2 protein.
- the ROR2 protein includes the amino acid sequence of SEQ ID NO: 18.
- the antibody is capable of binding an extracellular domain of the ROR2 protein.
- the antibody binds an extracellular domain of the ROR2 protein.
- the extracellular domain includes the amino acid sequence of SEQ ID NO:22.
- the extracellular domain is a Kringle domain.
- the Kringle domain includes the amino acid sequence of SEQ ID NO: 113.
- the ROR2 protein includes a histidine at a position corresponding to position 349 or an aspartic acid at a position corresponding to position 354 of SEQ ID NO:22. In embodiments, the ROR2 protein includes a histidine at a position corresponding to position 349 and an aspartic acid at a position corresponding to position 354 of SEQ ID NO:22. In embodiments, the ROR2 protein includes a histidine at a position corresponding to position 349 or an aspartic acid at a position corresponding to position 354 of SEQ ID NO: 18. In embodiments, the ROR2 protein includes a histidine at a position corresponding to position 349 and an aspartic acid at a position corresponding to position 354 of SEQ ID NO: 18.
- the antibody does not bind an arginine at a position corresponding to position 349 of SEQ ID NO:20. In embodiments, the antibody does not bind a glutamic acid at a position corresponding to position 354 of SEQ ID NO:20. In embodiments, the antibody does not bind an arginine at a position corresponding to position 349 of SEQ ID NO: 24. In embodiments, the antibody does not bind a glutamic acid at a position corresponding to position 354 of SEQ ID NO: 24.
- the ability of an antibody to bind a specific epitope can be described by the equilibrium dissociation constant (KD).
- KD equilibrium dissociation constant
- the antibody binds the ROR2 protein with an equilibrium dissociation constant (KD) from 0.01 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.2 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.3 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.4 nM to 10 nM.
- KD equilibrium dissociation constant
- the antibody binds the ROR2 protein with a KD from 0.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.6 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.8 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.9 nM to 1 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1 nM to 10 nM.
- the antibody binds the ROR2 protein with an equilibrium dissociation constant (KD) from 1.1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1.2 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1.3 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1.4 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1.6 nM to 10 nM.
- KD equilibrium dissociation constant
- the antibody binds the ROR2 protein with a KD from 1.7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1.8 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1.9 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 2 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with an equilibrium dissociation constant (KD) from 2.1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 2.2 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from KD from 1.7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1.8 nM to 10 nM. In embodiment
- the antibody binds the ROR2 protein with a KD from 2.4 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 2.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 2.6 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 2.7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 2.8 nM to 10 nM.
- the antibody binds the ROR2 protein with a KD from 2.9 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 3 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with an equilibrium dissociation constant (KD) from 4.1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 4.2 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from
- the antibody binds the ROR2 protein with a K D from 4.4 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 4.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 4.6 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 4.7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 4.8 nM to 10 nM.
- the antibody binds the ROR2 protein with a K D from 4.9 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with an equilibrium dissociation constant (K D ) from 5.1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 5.2 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from
- the antibody binds the ROR2 protein with a KD from 5.4 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 5.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 5.6 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 5.7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 5.8 nM to 10 nM.
- the antibody binds the ROR2 protein with a KD from 5.9 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 6 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with an equilibrium dissociation constant (KD) from 6.1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 6.2 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from
- the antibody binds the ROR2 protein with a KD from 6.4 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 6.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 6.6 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 6.7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 6.8 nM to 10 nM.
- the antibody binds the ROR2 protein with a KD from 6.9 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with an equilibrium dissociation constant (KD) from 7.1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 7.2 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from
- the antibody binds the ROR2 protein with a KD from 7.4 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 7.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 7.6 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 7.7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 7.8 nM to 10 nM.
- the antibody binds the ROR2 protein with a KD from 7.9 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 8 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with an equilibrium dissociation constant (KD) from 8.1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 8.2 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from
- the antibody binds the ROR2 protein with a KD from 8.4 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 8.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 8.6 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 8.7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 8.8 nM to 10 nM.
- the antibody binds the ROR2 protein with a K D from 8.9 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 9 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with an equilibrium dissociation constant (K D ) from 9.1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 9.2 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 8.9 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 9 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with an equilibrium dissociation constant (K D ) from 9.1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 9.2 nM to 10 n
- the antibody binds the ROR2 protein with a KD from 9.4 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 9.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 9.6 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 9.7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 9.8 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 9.9 nM to 10 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 9.9 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 9.8 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 9.7 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 9.6 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 9.5 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 9.4 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 9.3 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 9.2 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 9.1 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 9 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 8.9 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 8.8 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 8.7 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 8.6 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 8.5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 8.4 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 8.3 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 8.2 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 8.1 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 8 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 7.9 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 7.8 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 7.7 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 7.6 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 7.5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 7.4 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 7.3 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 7.2 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 7.1 nM.
- the antibody binds the ROR2 protein with a K D from 0.01 nM to 7 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 6.9 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 6.8 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 6.7 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 6.6 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 6.5 nM.
- the antibody binds the ROR2 protein with a K D from 0.01 nM to 6.4 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 6.3 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 6.2 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 6.1 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 6 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 5.9 nM.
- the antibody binds the ROR2 protein with a K D from 0.01 nM to 5.8 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 5.7 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 5.6 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 5.5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 5.4 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 5.3 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 5.2 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 5.1 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 4.9 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 4.8 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 4.7 nM.
- the antibody binds the ROR2 protein with a K D from 0.01 nM to 4.6 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 4.5 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 4.4 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 4.3 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 4.2 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 4.1 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 4 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 3.9 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 3.8 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 3.7 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 3.6 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 3.5 nM.
- the antibody binds the ROR2 protein with a K D from 0.01 nM to 3.4 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 3.3 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 3.2 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 3.1 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 3 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 2.9 nM.
- the antibody binds the ROR2 protein with a K D from 0.01 nM to 2.8 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 2.7 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 2.6 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 2.5 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 2.4 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 2.3 nM.
- the antibody binds the ROR2 protein with a K D from 0.01 nM to 2.2 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 2.1 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 2 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 1.9 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 1.8 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 1.7 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 1.6 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 1.5 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 1.4 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 1.3 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 1.2 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 1.1 nM.
- the antibody binds the ROR2 protein with a K D from 0.01 nM to 0.9 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 0.8 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 0.7 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 0.6 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 0.5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 0.4 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 0.3 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 0.2 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 0.1 nM.
- the antibody binds the ROR2 protein with a a KD of 0.01, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4,
- the antibody binds the ROR2 protein with a KD of about 0.06 nM. In embodiments, the antibody is antibody 6E6 and binds a ROR2 protein with a KD of 0.01 nM to 10 nM. In embodiments, the antibody 6E6 binds a ROR2 protein with a KD of 0.01, 0.05, 0.1,
- the antibody is antibody 6E6 and binds a ROR2 protein with a KD of 0.06 nM.
- the antibody is attached to a therapeutic agent. In embodiments, the antibody is attached to a diagnostic agent. In embodiments, the diagnostic agent is a detectable moiety.
- the antibody has a heavy chain variable domain of SEQ ID NO:2 and a light chain variable domain of SEQ ID NO:4.
- the antibody includes (i) a heavy chain variable domain including a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26; a CDR H3 as set forth in SEQ ID NO:27; a FR HI as set forth in SEQ ID NO:49, a FR H2 as set forth in SEQ ID NO:50, a FR H3 as set forth in SEQ ID NO:51 and a FR H4 as set forth in SEQ ID NO:52; and (ii) a light chain variable domain including a CDR LI as set forth in SEQ ID NO:28, a CDR L2 as set forth in SEQ ID NO:29, a CDR L3 as set forth in SEQ ID NO:30; a FR LI as set forth in SEQ ID NO:53, a
- an anti-tyrosine kmase-hke orphan receptor 2 (ROR2) antibody including a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32 and a CDR H3 as set forth in SEQ ID NO:33; and wherein the light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35, and a CDR L3 as set forth in SEQ ID NO:36.
- ROR2 anti-tyrosine kmase-hke orphan receptor 2
- the heavy chain variable domain includes the sequence of SEQ ID NO:6. In embodiments, the heavy chain variable domain is the sequence of SEQ ID NO:6. In embodiments, the light chain variable domain includes the sequence of SEQ ID NO: 8. In embodiments, the light chain variable domain is the sequence of SEQ ID NO: 8.
- the heavy chain variable domain includes a FR HI as set forth in SEQ ID NO:57, a FR H2 as set forth in SEQ ID NO:58, a FR H3 as set forth in SEQ ID NO:59 and a FR H4 as set forth in SEQ ID NO:60.
- the light chain variable domain includes a FR LI as set forth in SEQ ID NO:61, a FR L2 as set forth in SEQ ID NO:62, a FR L3 as set forth in SEQ ID NO:63 and a FR L4 as set forth in SEQ ID NO:64.
- the antibody is capable of binding a ROR2 protein.
- the ROR2 protein is a human ROR2 protein.
- the antibody binds a ROR2 protein.
- the ROR2 protein includes the amino acid sequence of SEQ ID NO: 18.
- the antibody is capable of binding an extracellular domain of the ROR2 protein.
- the antibody binds an extracellular domain of the ROR2 protein.
- the extracellular domain includes the amino acid sequence of SEQ ID NO:22.
- the extracellular domain is an Ig-like domain.
- the Ig- like domain includes the amino acid sequence of SEQ ID NO: 114.
- the ROR2 protein includes a methionine at a position corresponding to position 386 of SEQ ID NO:22. In embodiments, the ROR2 protein includes a methionine at a position corresponding to position 386 of SEQ ID NO: 18.
- the antibody does not bind a valine at a position corresponding to position 349 of SEQ ID NO:20. In embodiments, the antibody does not bind a valine at a position corresponding to position 349 of SEQ ID NO:24.
- the antibody binds the ROR2 protein with a KD from 0.2 nM to 5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.6 nM to 5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1 nM to 5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1.4 nM to 5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1.8 nM to 5 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 2.2 nM to 5 nM.
- the antibody binds the ROR2 protein with a K D from 2.6 nM to 5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 3 nM to 5 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 3.4 nM to 5 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 3.8 nM to nM. In embodiments, the antibody binds the ROR2 protein with a KD from 4.2 nM to 5 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 4.6 nM to 5 nM.
- the antibody binds the ROR2 protein with a KD from 0.2 nM to 4.6 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.2 nM to 4.2 nM.
- the antibody binds the ROR2 protein with a KD from 0.2 nM to 3.8 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.2 nM to 3.4 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.2 nM to 3 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.2 nM to 2.6 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.2 nM to 2.2 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.2 nM to 1.8 nM.
- the antibody binds the ROR2 protein with a KD from 0.2 nM to 1.4 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.2 nM to 1 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.2 nM to 0.6 nM.
- the antibody binds the ROR2 protein with a KD from 0.1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 2 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 2.5 nM to 10 nM.
- the antibody binds the ROR2 protein with a KD from 3 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 3.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 4 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 4.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 5.5 nM to 10 nM.
- the antibody binds the ROR2 protein with a KD from 6 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 6.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 7 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 7.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 8 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 8.5 nM to 10 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 9 nM to 10 nM.
- the antibody binds the ROR2 protein with a KD from 0.1 nM to 9.5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 9 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 8.5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 8 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 7.5 nM.
- the antibody binds the ROR2 protein with a KD from 0.1 nM to 7 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 6.5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 6 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 5.5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 4.5 nM.
- the antibody binds the ROR2 protein with a KD from 0.1 nM to 4 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 3.5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 3 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 2.5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 2 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 1.5 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.1 nM to 1 nM.
- the antibody binds the ROR2 protein with a a KD of 0.1, 0.4, 0.8, 1.2, 1.6, 2, 2.4, 2.8, 3.2, 3.6, 4, 4.4, 4.8, 5.2, 5.6, 6, 6.4, 6.8, 7.2, 7.6, 8, 8.4, 8.8, 9.2, 9.6, or 10 nM.
- the antibody binds the ROR2 protein with a KD of about 1.9 nM.
- the antibody is antibody 4G9 and binds a ROR2 protein with a KD of 0.1 nM to 10 nM.
- the antibody 4G9 binds a ROR2 protein with a KD of 0.1, 0.4, 0.8, 1.2,
- the antibody is antibody 4G9 and binds a ROR2 protein with a KD of 1.9 nM.
- the antibody is attached to a therapeutic agent. In embodiments, the antibody is attached to a diagnostic agent. In embodiments, the diagnostic agent is a detectable moiety. [0159] In one embodiment, the antibody has a heavy chain variable domain of SEQ ID NO:6 and a light chain variable domain of SEQ ID NO: 8.
- the antibody includes (i) a heavy chain variable domain including a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32; a CDR H3 as set forth in SEQ ID NO:33; a FR HI as set forth in SEQ ID NO:57, a FR H2 as set forth in SEQ ID NO:58, a FR H3 as set forth in SEQ ID NO:59 and a FR H4 as set forth in SEQ ID NO:60; and (ii) a light chain variable domain including a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35, a CDR L3 as set forth in SEQ ID NO:36; a FR LI as set forth in SEQ ID NO:61, a FR L2 as set forth in SEQ ID NO:62, a FR L3 as set forth in SEQ ID NO:63 and a FR L4 as
- an anti-tyrosine kinase-like orphan receptor 2 (ROR2) antibody including a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:37, a CDR H2 as set forth in SEQ ID NO:38 and a CDR H3 as set forth in SEQ ID NO:39; and wherein the light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO:41, and a CDR L3 as set forth in SEQ ID NO:42.
- ROR2 anti-tyrosine kinase-like orphan receptor 2
- the heavy chain variable domain includes the sequence of SEQ ID NO: 10. In embodiments, the heavy chain variable domain is the sequence of SEQ ID NO: 10. In embodiments, the light chain variable domain includes the sequence of SEQ ID NO: 12. In embodiments, the light chain variable domain is the sequence of SEQ ID NO: 12.
- the heavy chain variable domain includes a FR HI as set forth in SEQ ID NO:65, a FR H2 as set forth in SEQ ID NO:66, a FR H3 as set forth in SEQ ID NO:67 and a FR H4 as set forth in SEQ ID NO:68.
- the light chain variable domain includes a FR LI as set forth in SEQ ID NO:69, a FR L2 as set forth in SEQ ID NO:70, a FR L3 as set forth in SEQ ID NO:71 and a FR L4 as set forth in SEQ ID NO:72.
- the antibody is capable of binding a ROR2 protein.
- the ROR2 protein is a human ROR2 protein.
- the antibody binds a ROR2 protein.
- the ROR2 protein includes the amino acid sequence of SEQ ID NO: 18.
- the antibody is capable of binding an extracellular domain of the ROR2 protein.
- the antibody binds an extracellular domain of the ROR2 protein.
- the extracellular domain includes the amino acid sequence of SEQ ID NO:22.
- the extracellular domain is a Kringle domain.
- the Kringle domain includes the amino acid sequence of SEQ ID NO: 113.
- the ROR2 protein includes a histidine at a position corresponding to position 349, an aspartic acid at a position corresponding to position 354, or a methionine at a position corresponding to position 386 of SEQ ID NO:22.
- the ROR2 protein includes a histidine at a position corresponding to position 349, an aspartic acid at a position corresponding to position 354, and a methionine at a position corresponding to position 386 of SEQ ID NO:22.
- the ROR2 protein includes a histidine at a position corresponding to position 349, an aspartic acid at a position corresponding to position 354, or a methionine at a position corresponding to position 386 of SEQ ID NO: 18.
- the ROR2 protein includes a histidine at a position corresponding to position 349, an aspartic acid at a position corresponding to position 354, and a methionine at a position corresponding to position 386 of SEQ ID NO: 18.
- the antibody does not bind an arginine at a position corresponding to position 349 of SEQ ID NO:20. In embodiments, the antibody does not bind a glutamic acid at a position corresponding to position 354 of SEQ ID NO:20. In embodiments, the antibody does not bind a valine at a position corresponding to position 386 of SEQ ID NO:20. In embodiments, the antibody does not bind an arginine at a position corresponding to position 349 of SEQ ID NO:24. In embodiments, the antibody does not bind a glutamic acid at a position corresponding to position 354 of SEQ ID NO:24. In embodiments, the antibody does not bind a valine at a position corresponding to position 386 of SEQ ID NO:24.
- the antibody binds the ROR2 protein with a KD from 10 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 20 nM to 150 nM.
- the antibody binds the ROR2 protein with a KD from 30 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 40 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 50 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 60 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 70 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 80 nM to 150 nM.
- the antibody binds the ROR2 protein with a KD from 90 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 100 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 110 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 120 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 130 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 140 nM to 150 nM.
- the antibody binds the ROR2 protein with a KD from 10 nM to 140 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 130 nM.
- the antibody binds the ROR2 protein with a KD from 10 nM to 120 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 110 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 100 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 90 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 80 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 70 nM.
- the antibody binds the ROR2 protein with a KD from 10 nM to 60 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 50 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 40 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 30 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 20 nM. In embodiments, the antibody binds the ROR2 protein with a a KD of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140 or l50 nM.
- the antibody is 5C11 and binds a ROR2 protein with a KD of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140 or 150 nM.
- the antibody is attached to a therapeutic agent. In embodiments, the antibody is attached to a diagnostic agent. In embodiments, the diagnostic agent is a detectable moiety.
- the antibody has a heavy chain variable domain of SEQ ID NO: 10 and a light chain variable domain of SEQ ID NO: 12.
- the antibody includes (i) a heavy chain variable domain including a CDR HI as set forth in SEQ ID NO: 37, a CDR H2 as set forth in SEQ ID NO:38; a CDR H3 as set forth in SEQ ID NO:39; a FR HI as set forth in SEQ ID NO:65, a FR H2 as set forth in SEQ ID NO:66, a FR H3 as set forth in SEQ ID NO:67 and a FR H4 as set forth in SEQ ID NO:68; and (ii) a light chain variable domain including a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO:41, a CDR L3 as set forth in SEQ ID NO:42; a FR LI as set forth in SEQ ID NO:69, a
- the antibody is antibody 5C11.
- an anti-tyrosine kinase-like orphan receptor 2 (ROR2) antibody including a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44 and a CDR H3 as set forth in SEQ ID NO:45; and wherein the light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47, and a CDR L3 as set forth in SEQ ID NO:48.
- ROR2 anti-tyrosine kinase-like orphan receptor 2
- the heavy chain variable domain includes the sequence of SEQ ID NO: 14. In embodiments, the heavy chain variable domain is the sequence of SEQ ID NO: 14. In embodiments, the light chain variable domain includes the sequence of SEQ ID NO: 16. In embodiments, the light chain variable domain is the sequence of SEQ ID NO: 16.
- the heavy chain variable domain includes a FR HI as set forth in SEQ ID NO:73, a FR H2 as set forth in SEQ ID NO:74, a FR H3 as set forth in SEQ ID NO:75 and a FR H4 as set forth in SEQ ID NO:76.
- the light chain variable domain includes a FR LI as set forth in SEQ ID NO:77, a FR L2 as set forth in SEQ ID NO:78, a FR L3 as set forth in SEQ ID NO:79 and a FR L4 as set forth in SEQ ID NO: 80.
- the antibody is capable of binding a ROR2 protein.
- the ROR2 protein is a human ROR2 protein.
- the antibody binds a ROR2 protein.
- the ROR2 protein includes the amino acid sequence of SEQ ID NO: 18.
- the antibody is capable of binding an extracellular domain of the ROR2 protein.
- the antibody binds an extracellular domain of the ROR2 protein.
- the extracellular domain includes the amino acid sequence of SEQ ID NO:22.
- the extracellular domain is an Ig-like domain.
- the Ig- like domain includes includes the amino acid sequence of SEQ ID NO: 114.
- the antibody binds the ROR2 protein with a KD from 10 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 20 nM to 150 nM.
- the antibody binds the ROR2 protein with a KD from 30 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 40 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 50 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 60 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 70 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 80 nM to 150 nM.
- the antibody binds the ROR2 protein with a KD from 90 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 100 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 110 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 120 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 130 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 140 nM to 150 nM.
- the antibody binds the ROR2 protein with a KD from 10 nM to 140 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 130 nM.
- the antibody binds the ROR2 protein with a KD from 10 nM to 120 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 110 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 100 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 90 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 80 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 70 nM.
- the antibody binds the ROR2 protein with a KD from 10 nM to 60 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 50 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 40 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 30 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 20 nM. In embodiments, the antibody binds the ROR2 protein with a a KD of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140 or l50 nM.
- the antibody is 5G3 and binds a ROR2 protein with a KD of 10, 20,
- the antibody is attached to a therapeutic agent. In embodiments, the antibody is attached to a diagnostic agent. In embodiments, the diagnostic agent is a detectable moiety.
- the antibody has a heavy chain variable domain of SEQ ID NO: 14 and a light chain variable domain of SEQ ID NO: 16.
- the antibody includes (i) a heavy chain variable domain including a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44; a CDR H3 as set forth in SEQ ID NO:45; a FR HI as set forth in SEQ ID NO:73, a FR H2 as set forth in SEQ ID NO:74, a FR H3 as set forth in SEQ ID NO:75 and a FR H4 as set forth in SEQ ID NO:76; and (ii) a light chain variable domain including a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47, a CDR L3 as set forth in SEQ ID NO:48; a FR LI as set forth in SEQ ID NO:77, a
- the antibody is antibody 5G3.
- the antibodies provided herein including embodiments thereof may be humanized antibodies.
- the antibody is a humanized antibody.
- the antibody is a chimeric antibody.
- antibody is a Fab' fragment.
- the antibody is an IgG.
- the antibody is an IgG.
- the anti-ROR2 antibody provided herein may be an IgGl, IgG2, IgG3 or IgG4.
- the antibody is an IgGl.
- the antibody is an IgG2.
- the antibody is an IgG2a.
- the antibody is an IgG3.
- the antibody is an IgG4.
- the antibody does not bind a mouse ROR2 protein. In embodiments, the antibody does not bind a mouse ROR2 protein identified by the UniProt reference number Q9Z138. In embodiments, the antibody provided herein does not bind a protein comprising the amino acid sequence of SEQ ID NO: 20. In embodiments, the antibody provided herein does not bind a protein comprising the amino acid sequence of SEQ ID NO: 24. In embodiments, the antibody provided herein does not bind the protein of SEQ ID NO:20 or SEQ ID NO:24. In embodiments, the antibody provided herein does not bind the protein of SEQ ID NO:20. In embodiments, the antibody provided herein does not bind the protein of SEQ ID NO:24.
- the ROR2 protein bound by the antibodies provided herein including embodiments thereof may be expressed by a cell (e.g., cancer cell).
- a cell e.g., cancer cell
- the ROR2 protein is expressed on a cell.
- the cell is a cancer cell.
- the cancer cell is cancer is a breast cancer cell, ovarian cancer cell, pancreatic cancer cell, cervical cancer cell, gastric cancer cell, renal cancer cell, head and neck cancer cell, bone cancer cell, skin cancer cell or prostate cancer cell.
- the cancer cell is a breast cancer cell.
- the cancer cell is an ovarian cancer cell.
- the cancer cell is a pancreatic cancer cell. In embodiments, the cancer cell is cancer is a cervical cancer cell. In embodiments, the cancer cell is cancer is a gastric cancer cell. In embodiments, the cancer cell is cancer is a renal cancer cell. In embodiments, the cancer cell is cancer is a head and neck cancer cell. In embodiments, the cancer cell is a cancer is bone cancer cell. In embodiments, the cancer cell is cancer is a skin cancer cell. In embodiments, the cancer cell is cancer is a prostate cancer cell.
- the antibody provided herein does not bind a ROR2-negative cell.
- a “ROR2 -negative cell” as provided herein is a cell that does not express a detectable amount of a ROR2 protein relative to a standard control.
- the expression level of a ROR2 -negative cell is undetectable using methods conventionally known in the art to a detect protein expression in a cell (e.g., immunofluorescent detection, protein biochemistry, RNA expression level).
- the expression level of a ROR2-negative cell is 1000, 500, 100, 50, 25, 20, 10, 5, or 1.5 times lower than the expression level of a standard control (e.g., a cell expressin gdetectable levels of ROR2 using conventional methods).
- a standard control e.g., a cell expressin gdetectable levels of ROR2 using conventional methods.
- ROR2-negative cells include a peripheral blood mononuclear cell (PBMC) from a healthy subject.
- PBMC peripheral blood mononuclear cell
- variable light chain domain or the variable heavy chain of the antibodies provided herein may form part of an scFv.
- the antibody is a single chain antibody (scFv).
- the light chain variable domain and the heavy chain variable domain form part of a scFv.
- a linker forms part of the scFv.
- the linker includes the sequence of SEQ ID NO: 82.
- a leader peptide forms part of the scFv.
- the leader peptide includes the sequence of SEQ ID NO:81.
- the scFv further includes a heavy chain constant region (CH2-CH3).
- the heavy chain constant region includes the sequence of SEQ ID NO: 84.
- the scFv includes the sequence of SEQ ID NO: 85. In embodiments, the scFv is the sequence of SEQ ID NO: 85.
- the scFv binds the ROR2 protein with an equilibrium dissociation constant (KD) from 0.01 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.1 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.2 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.3 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.4 nM to 10 nM.
- KD equilibrium dissociation constant
- the scFv binds the ROR2 protein with a KD from 0.5 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.6 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.7 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.8 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.9 nM to 1 nM.
- the scFv binds the ROR2 protein with a K D from 1 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 1.1 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 1.2 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 1.3 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 1.4 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 1.5 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 1.6 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 1.7 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 1.8 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 1.9 nM to 10 nM.
- the scFv binds the ROR2 protein with a K D from 2 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 2.1 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 2.2 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 2.3 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 2.4 nM to 10 nM.
- the scFv binds the ROR2 protein with a K D from 2.5 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 2.6 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 2.7 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 2.8 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 2.9 nM to 10 nM.
- the scFv binds the ROR2 protein with a K D from 3 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 3.1 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 3.2 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 3.3 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 3.4 nM to 10 nM.
- the scFv binds the ROR2 protein with a K D from 3.5 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 3.6 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 3.7 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 3.8 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 3.9 nM to 10 nM.
- the scFv binds the ROR2 protein with a K D from 4 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 4.1 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 4.2 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 4.3 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 4.4 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 4.5 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 4.6 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 4.7 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 4.8 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 4.9 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 5 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 5.1 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 5.2 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 5.3 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 5.4 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 5.5 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 5.6 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 5.7 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 5.8 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 5.9 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 6 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 6.1 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 6.2 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 6.3 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 6.4 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 6.5 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 6.6 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 6.7 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 6.8 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 6.9 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 7 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 7.1 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 7.2 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 7.3 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 7.4 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 7.5 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 7.6 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 7.7 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 7.8 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 7.9 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 8 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 8.1 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 8.2 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 8.3 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 8.4 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 8.5 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 8.6 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 8.7 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 8.8 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 8.9 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 9 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 9.1 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 9.2 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 9.3 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 9.4 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 9.5 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 9.6 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 9.7 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 9.8 nM to 10 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 9.9 nM to 10 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 9.9 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 9.8 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 9.7 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 9.6 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 9.5 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 9.4 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 9.3 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 9.2 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 9.1 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 9 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 8.9 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 8.8 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 8.7 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 8.6 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 8.5 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 8.4 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 8.3 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 8.2 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 8.1 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 8 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 7.9 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 7.8 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 7.7 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 7.6 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 7.5 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 7.4 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 7.3 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 7.2 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 7.1 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 7 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 6.9 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 6.8 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 6.7 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 6.6 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 6.5 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 6.4 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 6.3 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 6.2 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 6.1 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 6 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 5.9 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 5.8 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 5.7 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 5.6 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 5.5 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 5.4 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 5.3 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 5.2 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 5.1 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 5 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 4.9 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 4.8 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 4.7 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 4.6 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 4.5 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 4.4 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 4.3 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 4.2 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 4.1 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 4 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 3.9 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 3.8 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 3.7 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 3.6 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 3.5 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 3.4 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 3.3 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 3.2 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 3.1 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 3 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 2.9 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 2.8 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 2.7 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 2.6 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 2.5 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 2.4 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 2.3 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 2.2 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 2.1 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 2 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 1.9 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 1.8 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 1.7 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 1.6 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 1.5 nM.
- the scFv binds the ROR2 protein with a K D from 0.01 nM to 1.4 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 1.3 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 1.2 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 1.1 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 0.9 nM.
- the scFv binds the ROR2 protein with a K D from 0.01 nM to 0.8 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 0.7 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 0.6 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 0.5 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 0.4 nM.
- the scFv binds the ROR2 protein with a KD from 0.01 nM to 0.3 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 0.01 nM to 0.2 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 0.01 nM to 0.1 nM.
- the scFv binds the R0R2 protein with a a K D of 0.01, 0.1, 0.2, 0.3, 0.4 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7,
- the scFv binds the ROR2 protein with a K D of about 0.07 nM.
- the scFv is 6E6 scFv and binds a ROR2 protein with a K D of 0.01 nM to 10 nM.
- the 6E6 scFv binds a ROR2 protein with a K D of 0.01, 0.05, 0.1, 0.2, 0.3, 0.4,
- the scFv is 6E6 scFv and binds a ROR2 protein with a K D of 0.07 nM.
- the scFv includes from the N-terminus to the C-terminus: a leader peptide of SEQ ID NO:81, a light chain variable domain of SEQ ID NO:4, a linker domain of SEQ ID NO: 82, a heavy chain variable domain of SEQ ID NO:2, a spacer of SEQ ID NO: 83, and a constant heavy chain domain (CH2-CH3) of SEQ ID NO: 84.
- the scFv is the 6E6 scFv.
- the scFv includes the sequence of SEQ ID NO: 86. In embodiments, the scFv is the sequence of SEQ ID NO: 86.
- the scFv binds the ROR2 protein with a K D from 0.01 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 1 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 10 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 20 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 30 nM to 150 nM.
- the scFv binds the ROR2 protein with a K D from 40 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 50 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 60 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 70 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 80 nM to 150 nM.
- the scFv binds the ROR2 protein with a K D from 90 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 100 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 110 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 120 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 130 nM to 150 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 140 nM to 150 nM.
- the scFv binds the ROR2 protein with a K D from 0.01 nM to 140 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 1 nM to 140 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 10 nM to 140 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 10 nM to 130 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 10 nM to 120 nM.
- the scFv binds the ROR2 protein with a K D from 10 nM to 110 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 10 nM to 100 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 10 nM to 90 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 10 nM to 80 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 10 nM to 70 nM.
- the scFv binds the ROR2 protein with a K D from 10 nM to 60 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 10 nM to 50 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 10 nM to 40 nM. In embodiments, the scFv binds the ROR2 protein with a K D from 10 nM to 30 nM. In embodiments, the scFv binds the ROR2 protein with a KD from 10 nM to 20 nM. In embodiments, the scFv binds the ROR2 protein with a a K D of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140 or 150 nM.
- the scFv is 4G9 scFv and binds a ROR2 protein with a K D of 0.01, 1, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140 or 150 nM.
- the scFv includes from the N-terminus to the C-terminus: a leader peptide of SEQ ID NO:81; a light chain variable domain of SEQ ID NO:8, a linker domain of SEQ ID NO:82, a heavy chain variable domain of SEQ ID NO:6, a spacer of SEQ ID NO:83, and and a constant heavy chain domain (CH2-CH3) of SEQ ID NO: 84.
- the scFv is 4G9 scFv.
- the scFv is capable of binding a ROR2 protein.
- the ROR2 protein is a human ROR2 protein.
- the scFv binds a ROR2 protein.
- the ROR2 protein includes the amino acid sequence of SEQ ID NO: 18.
- the scFv is capable of binding an extracellular domain of the ROR2 protein.
- the scFv binds an extracellular domain of the ROR2 protein.
- the extracellular domain includes the amino acid sequence of SEQ ID NO: 22.
- the extracellular domain is a Kringle domain.
- the Kringle domain includes the amino acid sequence of SEQ ID NO: 113.
- the extracellular domain is an Ig-like domain.
- the Ig-like domain includes the amino acid sequence of SEQ ID NO: 114.
- the scFv does not bind a mouse ROR2 protein. In embodiments, the scFv does not bind a mouse ROR2 protein identified by the UniProt reference number Q9Z138. In embodiments, the scFv provided herein does not bind a protein comprising the amino acid sequence of SEQ ID NO:20. In embodiments, the scFv provided herein does not bind a protein comprising the amino acid sequence of SEQ ID NO:24. In embodiments, the scFv provided herein does not bind the protein of SEQ ID NO:20 or SEQ ID NO:24. In embodiments, the scFv provided herein does not bind the protein of SEQ ID NO:20. In embodiments, the scFv provided herein does not bind the protein of SEQ ID NO: 24
- an anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain including: a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26 and a CDR H3 as set forth in SEQ ID NO:27; and a light chain variable domain including: a CDR LI as set forth in SEQ ID NO:28, a CDR L2 as set forth in SEQ ID NO:29, and a CDR L3 as set forth in SEQ ID NO:30.
- the heavy chain variable domain includes the sequence of SEQ ID NO:2.
- the light chain variable domain includes the sequence of SEQ ID NO: 4.
- an anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain of SEQ ID:2; and a light chain variable domain of SEQ ID NO:4.
- an anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID: 1; and a light chain variable domain encoded by the nucleic acid sequence of SEQ ID:3.
- an anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain including: a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32 and a CDR H3 as set forth in SEQ ID NO:33; and a light chain variable domain including: a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35, and a CDR L3 as set forth in SEQ ID NO:36.
- the heavy chain variable domain includes the sequence of SEQ ID:6.
- the light chain variable domain includes the sequence of SEQ ID NO:8.
- an anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain of SEQ ID:6; and a light chain variable domain of SEQ ID NO: 8.
- an anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID: 5; and a light chain variable domain encoded by the nucleic acid sequence of SEQ ID:7.
- an anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain of SEQ ID: 10; and a light chain variable domain of SEQ ID NO: 12.
- an anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID: 9; and a light chain variable domain encoded by the nucleic acid sequence of SEQ IDT 1.
- an anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain including: a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44 and a CDR H3 as set forth in SEQ ID NO:45; and a light chain variable domain including: a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47, and a CDR L3 as set forth in SEQ ID NO:48.
- the heavy chain variable domain includes the sequence of SEQ ID: 14.
- the light chain variable domain includes the sequence of SEQ ID NO: 16.
- an anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain of SEQ ID: 14; and a light chain variable domain of SEQ ID NO: 16.
- an anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody including a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID: 13; and a light chain variable domain encoded by the nucleic acid sequence of SEQ ID: 15.
- the antibody is capable of binding a ROR2 protein.
- the ROR2 protein is a human ROR2 protein.
- the antibody binds a ROR2 protein.
- the ROR2 protein includes the amino acid sequence of SEQ ID NO: 18.
- the antibody is capable of binding an extracellular domain of the ROR2 protein.
- the antibody binds an extracellular domain of the ROR2 protein.
- the extracellular domain includes the amino acid sequence of SEQ ID NO:22.
- the extracellular domain is a Kringle domain.
- the Kringle domain includes the amino acid sequence of SEQ ID NO: 113.
- the extracellular domain is an Ig-like domain.
- the Ig-like domain includes includes the amino acid sequence of SEQ ID NO: 114.
- the ROR2 protein includes a histidine at a position corresponding to position 349, an aspartic acid at a position corresponding to position 354, or a methionine at a position corresponding to position 386 of SEQ ID NO:22.
- the ROR2 protein includes a histidine at a position corresponding to position 349, an aspartic acid at a position corresponding to position 354, and a methionine at a position corresponding to position 386 of SEQ ID NO:22.
- the ROR2 protein includes a histidine at a position corresponding to position 349, an aspartic acid at a position corresponding to position 354, or a methionine at a position corresponding to position 386 of SEQ ID NO: 18.
- the ROR2 protein includes a histidine at a position corresponding to position 349, an aspartic acid at a position corresponding to position 354, and a methionine at a position corresponding to position 386 of SEQ ID NO: 18.
- the ROR2 protein includes a methionine at a position corresponding to position 386 of SEQ ID NO:22. In embodiments, the ROR2 protein includes a histidine at a position corresponding to position 349 of SEQ ID NO:22. In embodiments, the ROR2 protein includes an aspartic acid at a position corresponding to position 354 of SEQ ID NO: 22. In embodiments, the ROR2 protein includes a methionine at a position corresponding to position 386 of SEQ ID NO: 18. In embodiments, the ROR2 protein includes a histidine at a position corresponding to position 349 of SEQ ID NO: 18. In embodiments, the ROR2 protein includes an aspartic acid at a position corresponding to position 354 of SEQ ID NO: 18.
- the antibody is capable of binding a ROR2 protein.
- the ROR2 protein is a human ROR2 protein.
- the antibody binds a ROR2 protein.
- the ROR2 protein includes the amino acid sequence of SEQ ID NO: 18.
- the antibody is capable of binding an extracellular domain of the ROR2 protein.
- the antibody binds an extracellular domain of the ROR2 protein.
- the extracellular domain includes the amino acid sequence of SEQ ID NO:22.
- the extracellular domain is an Ig-like domain.
- the Ig- like domain includes residues corresponding to positions 79 to 147 of SEQ ID NO:22.
- the antibody is attached to a therapeutic agent.
- the antibody is attached to a diagnostic agent.
- the diagnostic agent is a detectable moiety.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 1 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 20 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 30 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 40 nM to 150 nM.
- the antibody binds the ROR2 protein with a KD from 50 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 60 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 70 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 80 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 90 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 100 nM to 150 nM.
- the antibody binds the ROR2 protein with a KD from 110 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 120 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 130 nM to 150 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 140 nM to 150 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 140 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 140 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 130 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 120 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 110 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 100 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 90 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 80 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 70 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 60 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 50 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 40 nM.
- the antibody binds the ROR2 protein with a KD from 0.01 nM to 30 nM. In embodiments, the antibody binds the ROR2 protein with a K D from 0.01 nM to 20 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 10 nM to 20 nM. In embodiments, the antibody binds the ROR2 protein with a KD from 0.01 nM to 20 nM.In embodiments, the antibody binds the ROR2 protein with a a KD of 0.01, 1, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140 or 150 nM.
- the antibodies binding the epitopes provided herein may be humanized antibodies.
- the antibody is a humanized antibody.
- antibody is a chimeric antibody.
- antibody is a Fab' fragment.
- the antibody is an IgG.
- the antibody is an IgG.
- the anti-ROR2 antibody provided herein may be an IgGl, IgG2, IgG3 or IgG4.
- the antibody is an IgGl .
- the antibody is an IgG2.
- the antibody is an IgG2a.
- the antibody is an IgG3.
- the antibody is an IgG4.
- the antibody does not bind a mouse ROR2 protein. In embodiments, the antibody does not bind a mouse ROR2 protein identified by the UniProt reference number Q9Z138. In embodiments, the antibody provided herein does not bind a protein comprising the amino acid sequence of SEQ ID NO: 20. In embodiments, the antibody provided herein does not bind a protein comprising the amino acid sequence of SEQ ID NO: 24. In embodiments, the antibody provided herein does not bind the protein of SEQ ID NO:20 or SEQ ID NO:24. In embodiments, the antibody provided herein does not bind the protein of SEQ ID NO:20. In embodiments, the antibody provided herein does not bind the protein of SEQ ID NO:24.
- the antibody does not bind an arginine at a position corresponding to position 349 of SEQ ID NO:20. In embodiments, the antibody does not bind a glutamic acid at a position corresponding to position 354 of SEQ ID NO:20. In embodiments, the antibody does not bind a valine at a position corresponding to position 386 of SEQ ID NO:20. In embodiments, the antibody does not bind an arginine at a position corresponding to position 349 of SEQ ID NO: 24. In embodiments, the antibody does not bind a glutamic acid at a position corresponding to position 354 of SEQ ID NO:24. In embodiments, the antibody does not bind a valine at a position corresponding to position 386 of SEQ ID NO:24.
- the antibody provided herein does not bind a ROR2-negative cell.
- a “ROR2 -negative cell” as provided herein is a cell that does not express a detectable amount of a ROR2 protein relative to a standard control.
- the expression level of a ROR2- negative cell is undetectable using methods conventionally known in the art to a detect protein expression in a cell (e.g., immunofluorescent detection, protein biochemistry, RNA expression level).
- the expression level of a ROR2-negative cell is 1000, 500, 100, 50, 25, 20, 10, 5, or 1.5 times lower than the expression level of a standard control (e.g., a cell expressin gdetectable levels of ROR2 using conventional methods).
- No limiting examples of ROR2- negative cells include a peripheral blood mononuclear cell (PBMC) from a healthy subject.
- PBMC peripheral blood mononuclear cell
- the heavy chain variable (VH) domain and the light chain variable (VL) domain provided herein including embodiments thereof may each independently form part of an antibody, a fragment of an antibody, or a a chimeric antigen receptor or bispecific antibody.
- chimeric antigen receptors and bispecific antibodies which include the light chain variable (VL) domain and/or the heavy chain variable (VH) domain as provided herein and are therefore capable of binding human ROR2 effectively and efficiently.
- the antibody region of the chimeric antigen receptor may include any of the light chain and heavy chain variable domains provided herein including embodiments thereof.
- a chimeric antigen receptor including: (i) an antibody region including: (a) a light chain variable domain including a CDR LI as set forth in SEQ ID NO: 28, a CDR L2 as set forth in SEQ ID NO:29 and a CDR L3 as set forth in SEQ ID NO:30; and (b) a heavy chain variable region domain including a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26, and a CDR H3 as set forth in SEQ ID NO:27; and (ii) a transmembrane domain.
- the chimeric antigen receptor includes the light chain variable domain of antibody 6E6 and a heavy chain variable domain of antibody 6E6.
- a chimeric antigen receptor including: (i) an antibody region including: (a) a light chain variable domain including a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35 and a CDR L3 as set forth in SEQ ID NO:36; and (b) a heavy chain variable region domain including a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32, and a CDR H3 as set forth in SEQ ID NO:33; and (ii) a transmembrane domain.
- the chimeric antigen receptor includes the light chain variable domain of antibody 4G9 and a heavy chain variable domain of antibody 4G9.
- a chimeric antigen receptor including: (i) an antibody region including: (a) a light chain variable domain including a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO:41 and a CDR L3 as set forth in SEQ ID NO:42; and (b) a heavy chain variable region domain including a CDR HI as set forth in SEQ ID NO:37, a CDR H2 as set forth in SEQ ID NO:38, and a CDR H3 as set forth in SEQ ID NO:39; and (ii) a transmembrane domain.
- the chimeric antigen receptor includes the light chain variable domain of antibody 5C11 and a heavy chain variable domain of antibody 5C11.
- a chimeric antigen receptor including: (i) an antibody region including: (a) a light chain variable domain including a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47 and a CDR L3 as set forth in SEQ ID NO:48; and (b) a heavy chain variable region domain including a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44, and a CDR H3 as set forth in SEQ ID NO:45; and (ii) a transmembrane domain.
- the chimeric antigen receptor includes the light chain variable domain of antibody 5G3 and a heavy chain variable domain of antibody 5G3.
- an "antibody region” as provided herein refers to a monovalent or multivalent protein moiety that forms part of the recombinant protein (e.g., CAR, bispecific antibody) provided herein including embodiments thereof.
- the antibody region is a protein moiety capable of binding an antigen (epitope).
- the antibody region provided herein may include a domain of an antibody (e.g., a light chain variable (VL) domain, a heavy chain variable (VH) domain) or a fragment of an antibody (e.g., Fab).
- the antibody region is a protein conjugate.
- a “protein conjugate” as provided herein refers to a construct consisting of more than one polypeptide, wherein the polypeptides are bound together covalently or non-covalently.
- the polypeptides of a protein conjugate are encoded by one nucleic acid molecule.
- the polypeptides of a protein conjugate are encoded by different nucleic acid molecules.
- the polypeptides are connected through a linker.
- the polypeptides are connected through a chemical linker.
- the antibody region is an scFv.
- the antibody region may include a light chain variable (VL) domain and/or a heavy chain variable (VH) domain.
- the antibody region includes a light chain variable (VL) domain.
- the antibody region includes a heavy chain variable (VH) domain.
- a “transmembrane domain” as provided herein refers to a polypeptide forming part of a biological membrane.
- the transmembrane domain provided herein is capable of spanning a biological membrane (e.g., a cellular membrane) from one side of the membrane through to the other side of the membrane.
- the transmembrane domain spans from the intracellular side to the extracellular side of a cellular membrane.
- Transmembrane domains may include non-polar, hydrophobic residues, which anchor the proteins provided herein including embodiments thereof in a biological membrane (e.g., cellular membrane of a T cell). Any transmembrane domain capable of anchoring the proteins provided herein including embodiments thereof are contemplated.
- Non-limiting examples of transmembrane domains include the transmembrane domains of CD28, CD8, CD4 or CD3-zeta.
- the transmembrane domain is a CD4 transmembrane domain.
- the transmembrane domain is a CD28 transmembrane domain.
- CD28 transmembrane domain includes any of the recombinant or naturally-occurring forms of the transmembrane domain of CD28, or variants or homologs thereof that maintain CD28 transmembrane domain activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to the CD28 transmembrane domain).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g.
- CD28 is the protein as identified by the NCBI sequence reference GI: 340545506, homolog or functional fragment thereof.
- the transmembrane domain is a CD8 transmembrane domain.
- CD8 transmembrane domain includes any of the recombinant or naturally-occurring forms of the transmembrane domain of CD8, or variants or homologs thereof that maintain CD8 transmembrane domain activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to the CD8 transmembrane domain).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100,
- CD8 is the protein as identified by the NCBI sequence reference GI:225007534, homolog or functional fragment thereof.
- the transmembrane domain is a CD4 transmembrane domain.
- CD4 transmembrane domain includes any of the recombinant or naturally-occurring forms of the transmembrane domain of CD4, or variants or homologs thereof that maintain CD4 transmembrane domain activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to the CD4 transmembrane domain).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100,
- CD4 is the protein as identified by the NCBI sequence reference GI: 303522473, homolog or functional fragment thereof.
- the transmembrane domain is a CD3-zeta (also known as CD247) transmembrane domain.
- CD3-zeta transmembrane domain includes any of the recombinant or naturally-occurring forms of the transmembrane domain of CD3-zeta, or variants or homologs thereof that maintain CD3-zeta transmembrane domain activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to the CD3-zeta transmembrane domain).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring CD3-zeta transmembrane domain polypeptide.
- CD3-zeta is the protein as identified by the NCBI sequence reference GI: 166362721, homolog or functional fragment thereof.
- the chimeric antigen receptor further includes an intracellular T-cell signaling domain.
- An "intracellular T-cell signaling domain" as provided herein includes amino acid sequences capable of providing primary signaling in response to binding of an antigen to the antibody region provided herein including embodiments thereof.
- the signaling of the intracellular T-cell signaling domain results in activation of the T cell expressing the same.
- the signaling of the intracellular T-cell signaling domain results in proliferation (cell division) of the T cell expressing the same.
- the signaling of the intracellular T-cell signaling domain results expression by said T cell of proteins known in the art to characteristic of activated T cell (e.g., CTLA-4, PD-1, CD28, CD69).
- the intracellular T-cell signaling domain is a CD3 z intracellular T-cell signaling domain.
- the chimeric antigen receptor further includes an intracellular co stimulatory T-cell signaling domain.
- An "intracellular co-stimulatory signaling domain" as provided herein includes amino acid sequences capable of providing co-stimulatory signaling in response to binding of an antigen to the antibody region provided herein including embodiments thereof.
- the signaling of the co-stimulatory signaling domain results in production of cytokines and proliferation of the T cell expressing the same.
- the intracellular co-stimulatory signaling domain is a CD28 intracellular co-stimulatory signaling domain, a 4-1BB intracellular co-stimulatory signaling domain, an ICOS intracellular co stimulatory signaling domain, or an OX-40 intracellular co-stimulatory signaling domain.
- the intracellular co-stimulatory signaling domain is a CD28 intracellular co stimulatory signaling domain.
- the intracellular co-stimulatory signaling domain is a 4-1BB intracellular co-stimulatory signaling domain.
- the intracellular co-stimulatory signaling domain is an ICOS intracellular co-stimulatory signaling domain.
- the intracellular co-stimulatory signaling domain is an OX-40 intracellular co-stimulatory signaling domain.
- the antibody region includes an Fc domain.
- the antibody region includes a spacer region.
- the spacer region is between the transmembrane domain and the antibody region.
- a "spacer region" as provided herein is a polypeptide connecting the antibody region with the transmembrane domain.
- the spacer region connects the heavy chain constant region with the transmembrane domain.
- the spacer region includes an Fc region.
- the spacer region is an Fc region.
- spacer regions contemplated for the compositions provided herein include without limitation, immunoglobulin molecules or fragments thereof (e.g., IgGl, IgG2, IgG3, IgG4) and immunoglobulin molecules or fragments thereof (e.g., IgGl, IgG2, IgG3, IgG4) including mutations affecting Fc receptor binding.
- the spacer region is a hinge region.
- CTLA-4" as referred to herein includes any of the recombinant or naturally- occurring forms of the cytotoxic T-lymphocyte-associated protein 4 protein, also known as CD152 (cluster of differentiation 152), or variants or homologs thereof that maintain CTLA-4 activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to CTLA-4).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring CTLA-4 protein.
- the CTLA-4 protein is substantially identical to the protein identified by the UniProt reference number P16410 or a variant or homolog having substantial identity thereto.
- CD28 as referred to herein includes any of the recombinant or naturally- occurring forms of the Cluster of Differentiation 28 protein, or variants or homologs thereof that maintain CD28 activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to CD28).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g . a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring CD28 protein.
- the CD28 protein is substantially identical to the protein identified by the UniProt reference number PI 0747 or a variant or homolog having substantial identity thereto.
- CD69 includes any of the recombinant or naturally- occurring forms of the Cluster of Differentiation 69 protein, or variants or homologs thereof that maintain CD69 activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to CD69).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring CD69 protein.
- the CD69 protein is substantially identical to the protein identified by the UniProt reference number Q07108 or a variant or homolog having substantial identity thereto.
- 4-1BB as referred to herein includes any of the recombinant or naturally- occurring forms of the 4-1BB protein, also known as tumor necrosis factor receptor superfamily member 9 (TNFRSF9), Cluster of Differentiation 137 (CD137) and induced by lymphocyte activation (ILA), or variants or homologs thereof that maintain 4-1BB activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to 4-1BB).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g.
- the 4- IBB protein is substantially identical to the protein identified by the UniProt reference number Q07011 or a variant or homolog having substantial identity thereto.
- the chimeric antigen receptors provided herein may include any of the anti-ROR2 antibodies or fragments thereof described herein.
- the chimeric antigen receptors may include any of the CDRs, FRs, heavy chain variable domains, or light chain variable domains provided herein.
- the heavy chain variable domain may include the sequence of SEQ ID NO:2, SEQ ID NO:6, SEQ ID NO: 10 or SEQ ID NO: 14.
- the heavy chain variable domain is the sequence of SEQ ID NO:2, SEQ ID NO:6, SEQ ID NO: 10 or SEQ ID NO: 14.
- the light chain variable domain may include the sequence of SEQ ID NO:4, SEQ ID NO:8, SEQ ID NO: 12, or SEQ ID NO: 16.
- light chain variable domain is the sequence of SEQ ID NO:4, SEQ ID NO: 8, SEQ ID NO: 12, or SEQ ID NO: 16.
- the chimeric antigen receptor further includes a heavy chain constant domain. In embodiments, the chimeric antigen receptor further includes a spacer region. In embodiments, the spacer region is between the transmembrane domain and the antibody region. In embodiments, the spacer region further includes a hinge region. In embodiments, the spacer region includes the sequence of SEQ ID NO:94. In embodiments, the spacer region includes the sequence of SEQ ID NO:95. In embodiments, the spacer region includes the sequence of SEQ ID NO:96.
- the chimeric antigen receptor further includes a linker domain.
- the linker domain is between the heavy chain variable domain and the light chain variable domain.
- the linker domain includes the sequence of SEQ ID NO: 82.
- the chimeric antigen receptor further includes a leader peptide.
- the leader peptide includes the sequence of SEQ ID NO:93.
- the chimeric antigen receptor includes the sequence of SEQ ID NO: 100. In embodiments, the chimeric antigen receptor is the sequence of SEQ ID NO: 100. In embodiments, the chimeric antigen receptor includes the sequence of SEQ ID NO: 101. In embodiments, the chimeric antigen receptor is the sequence of SEQ ID NO: 101.
- the chimeric antigen receptor includes from the N-terminus to the C-terminus: a leader peptide of SEQ ID NO:93, a light chain variable domain of SEQ ID NO:4, a linker domain of SEQ ID NO: 82, a heavy chain variable domain of SEQ ID NO:2, a spacer domain of SEQ ID NO:96, a transmembrane domain of SEQ ID NO:97, an intracellular co stimulatory signaling domain of SEQ ID NO:98, and an intracellular T-cell signaling domain of SEQ ID NO:99.
- the protein includes from the N-terminus to the C-terminus: a leader peptide of SEQ ID NO:93; a light chain variable domain of SEQ ID NO:8, a linker domain of SEQ ID NO:82, a heavy chain variable domain of SEQ ID NO:6, a spacer domain of SEQ ID NO:96, a transmembrane domain of SEQ ID NO:97, an intracellular co-stimulatory signaling domain of SEQ ID NO:98, and an intracellular T-cell signaling domain of SEQ ID NO:99.
- the light chain variable (VL) domain and the heavy chain variable (VH) domain as provided herein may form part of a bispecific antibody.
- the second antibody region may include any of the light chain and/or heavy chain variable domains provided herein including embodiments thereof.
- a bispecific antibody including: (i) a first antibody region capable of binding an effector cell ligand; and (ii) a second antibody region, including: (a) a heavy chain variable domain including a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26 and a CDR H3 as set forth in SEQ ID NO:27; and (b) a CDR LI as set forth in SEQ ID NO:28, a CDR L2 as set forth in SEQ ID NO:29, and a CDR L3 as set forth in SEQ ID NO: 30.
- a bispecific antibody including: (i) a first antibody region capable of binding an effector cell ligand; and (ii) a second antibody region, including: (a) a heavy chain variable domain including a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32 and a CDR H3 as set forth in SEQ ID NO:33; and (b) a a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35, and a CDR L3 as set forth in SEQ ID NO: 36.
- a bispecific antibody including: (i) a first antibody region capable of binding an effector cell ligand; and (ii) a second antibody region, including: (a) a heavy chain variable domain including a CDR HI as set forth in SEQ ID NO:37, a CDR H2 as set forth in SEQ ID NO:38 and a CDR H3 as set forth in SEQ ID NO:39; and (b) a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO:41, and a CDR L3 as set forth in SEQ ID NO: 42.
- a bispecific antibody including: (i) a first antibody region capable of binding an effector cell ligand; and (ii) a second antibody region, including: (a) a heavy chain variable domain including a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44 and a CDR H3 as set forth in SEQ ID NO:45; and (b) a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47, and a CDR L3 as set forth in SEQ ID NO: 48.
- effector cell ligand refers to a cell surface molecule expressed on an effector cell of the immune system (e.g., a cytotoxic T cell, a helper T cell, a B cell, a natural killer cell).
- an effector cell of the immune system e.g., a cytotoxic T cell, a helper T cell, a B cell, a natural killer cell.
- the effector cell Upon binding of the first antibody region to the effector cell ligand expressed on the effector cell, the effector cell is activated and able to exert its function (e.g., selective killing or eradication of malignant, infected or otherwise unhealthy cells).
- the effector cell ligand is a CD3 protein.
- the effector cell ligand is a CD 16 protein.
- the effector cell ligand is a CD32 protein.
- the effector cell ligand is a NKp46 protein.
- the first antibody region as provided herein may be an antibody, an antibody variant, a fragment
- a "CD3 protein” as referred to herein includes any of the recombinant or naturally- occurring forms of the Cluster of Differentiation 3 (CD3) proteins or variants or homologs thereof that comprise the CD3 complex that mediates signal transduction and maintains CD3 complex activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to the CD3 complex).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring CD3 proteins in the CD3 complex.
- CD 16 protein as referred to herein includes any of the recombinant or naturally- occurring forms of the Cluster of Differentiation 16 (CD 16) protein, also known as low affinity immunoglobulin gamma Fc region receptor III -A, or variants or homologs thereof that maintain CD16 activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to CD 16).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g.
- the CD 16 protein is substantially identical to the protein identified by the UniProt reference number P08637 or a variant or homolog having substantial identity thereto.
- a "CD32 protein” as referred to herein includes any of the recombinant or naturally- occurring forms of the Cluster of Differentiation 32 (CD32) protein, also known as low affinity immunoglobulin gamma Fc region receptor II- A, or variants or homologs thereof that maintain CD32 activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to CD32).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g . a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring CD32 protein.
- the CD32 protein is substantially identical to the protein identified by the UniProt reference number P12318 or a variant or homolog having substantial identity thereto.
- a "NKp46 protein" as referred to herein includes any of the recombinant or naturally- occurring forms of the NKp46 protein, also known as natural cytotoxicity triggering receptor 1, or variants or homologs thereof that maintain NKp46 activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to NKp46).
- the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring NKp46 protein.
- the NKp46 protein is substantially identical to the protein identified by the UniProt reference number 076036 or a variant or homolog having substantial identity thereto.
- the bispecific antibody provided herein may include any of the ROR2 antibodies or fragments thereof described herein.
- the second antibody region may include any of the CDRs, FRs, heavy chain variable domains, or light chain variable domains provided herein.
- the second antibody region includes a heavy chain variable domain including the sequence of SEQ ID NO:2.
- the second antibody region includes a light chain variable domain includes the sequence of SEQ ID NO:4.
- the second antibody region includes a heavy chain variable domain with the sequence of SEQ ID NO: 2.
- the second antibody region includes a light chain variable domain with the sequence of SEQ ID NO:4.
- the heavy chain variable domain of the second antibody region may include, for example, a FR HI as set forth in SEQ ID NO:49, a FR H2 as set forth in SEQ ID NO:50, a FR H3 as set forth in SEQ ID NO:51, and a FR H4 as set forth in SEQ ID NO:52.
- the light chain variable domain of the second antibody region a may include any of the CDRs or FRs provided herein.
- the light chain variable domain may include, for example, a FR LI as set forth in SEQ ID NO:53, a FR L2 as set forth in SEQ ID NO:54, a FR L3 as set forth in SEQ ID NO:55, and a FR L4 as set forth in SEQ ID NO:56.
- the second antibody region includes a heavy chain variable domain including the sequence of SEQ ID NO: 6. In embodiments, the second antibody region includes a light chain variable domain includes the sequence of SEQ ID NO: 8. In embodiments, the second antibody region includes a heavy chain variable domain with the sequence of SEQ ID NO:6. In embodiments, the second antibody region includes a light chain variable domain with the sequence of SEQ ID NO: 8.
- the heavy chain variable domain of the second antibody region may include, for example, a FR HI as set forth in SEQ ID NO:57, a FR H2 as set forth in SEQ ID NO:58, a FR H3 as set forth in SEQ ID NO:59, and a FR H4 as set forth in SEQ ID NO:60.
- the light chain variable domain of the bispecific antibody provided herein may include, for example, a FR LI as set forth in SEQ ID NO:61, a FR L2 as set forth in SEQ ID NO:62, a FR L3 as set forth in SEQ ID NO:63, and a FR L4 as set forth in SEQ ID NO:64.
- the second antibody region includes a heavy chain variable domain including the sequence of SEQ ID NO: 10. In embodiments, the second antibody region includes a light chain variable domain includes the sequence of SEQ ID NO: 12. In embodiments, the second antibody region includes a heavy chain variable domain with the sequence of SEQ ID NO: 10. In embodiments, the second antibody region includes a light chain variable domain with the sequence of SEQ ID NO: 12.
- the heavy chain variable domain of the second antibody region may include, for example, a FR HI as set forth in SEQ ID NO:65, a FR H2 as set forth in SEQ ID NO:66, a FR H3 as set forth in SEQ ID NO:67, and a FR H4 as set forth in SEQ ID NO:68.
- the light chain variable domain of the bispecific antibody provided herein may include, for example, a FR LI as set forth in SEQ ID NO:69, a FR L2 as set forth in SEQ ID NO:70, a FR L3 as set forth in SEQ ID NO: 71, and a FR L4 as set forth in SEQ ID NO: 72.
- the second antibody region includes a heavy chain variable domain including the sequence of SEQ ID NO: 14. In embodiments, the second antibody region includes a light chain variable domain includes the sequence of SEQ ID NO: 16. In embodiments, the second antibody region includes a heavy chain variable domain with the sequence of SEQ ID NO: 14. In embodiments, the second antibody region includes a light chain variable domain with the sequence of SEQ ID NO: 16.
- the heavy chain variable domain of the second antibody region may include, for example, a FR HI as set forth in SEQ ID NO:73, a FR H2 as set forth in SEQ ID NO:74, a FR
- the light chain variable domain of the bispecific antibody provided herein may include, for example, a FR LI as set forth in SEQ ID NO:77, a FR L2 as set forth in SEQ ID NO:78, a FR L3 as set forth in SEQ ID NO: 79, and a FR L4 as set forth in SEQ ID NO: 80.
- the first antibody region is a first Fab' fragment or the second antibody region is a second Fab' fragment.
- the first antibody region is a single chain variable fragment (scFv) or the second antibody region is a second single chain variable fragment (scFv).
- the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.1 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 1 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 10 nM to 150 nM.
- the scFv of the second antibody region binds the ROR2 protein with a KD from 20 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 30 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 40 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 50 nM to 150 nM.
- the scFv of the second antibody region binds the ROR2 protein with a KD from 60 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 70 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 80 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 90 nM to 150 nM.
- the scFv of the second antibody region binds the ROR2 protein with a KD from 100 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 110 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 120 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 130 nM to 150 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 140 nM to 150 nM.
- the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 140 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 130 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 120 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 110 nM.
- the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 100 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 90 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 80 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 70 nM.
- the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 60 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 50 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 40 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 30 nM.
- the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 20 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 10 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD from 0.01 nM to 1 nM.
- the scFv of the second antibody region binds the ROR2 protein with a KD of about 0.07 nM. In embodiments, the scFv of the second antibody region binds the ROR2 protein with a KD of 0.07 nM. In embodiments, the scFv of the second antibody region is the 6E6 scFv and binds the ROR2 protein with a KD of 0.07 nM.
- the second antibody region may include a light chain variable (VL) domain or a heavy chain variable (VH) domain. In embodiments, the second antibody region includes a light chain variable (VL) domain. In embodiments, the second antibody region includes a heavy chain variable (VH) domain.
- the second antibody region is bound to a ROR2 protein.
- the ROR2 protein is expressed on a cell.
- the cell is a cancer cell.
- the cancer cell is cancer is a breast cancer cell, ovarian cancer cell, pancreatic cancer cell, cervical cancer cell, gastric cancer cell, renal cancer cell, head and neck cancer cell, bone cancer cell, skin cancer cell or prostate cancer cell.
- the cancer cell is a breast cancer cell.
- the cancer cell is an ovarian cancer cell.
- the cancer cell is a pancreatic cancer cell.
- the cancer cell is cancer is a cervical cancer cell.
- the cancer cell is cancer is a gastric cancer cell.
- the cancer cell is cancer is a renal cancer cell. In embodiments, the cancer cell is cancer is a head and neck cancer cell. In embodiments, the cancer cell is a cancer is bone cancer cell. In embodiments, the cancer cell is cancer is a skin cancer cell. In embodiments, the cancer cell is cancer is a prostate cancer cell.
- compositions provided herein include nucleic acid molecules encoding the anti- ROR2 antibodies, CARs and bispecific antibodies or portions thereof provided herein including embodiments thereof.
- the antibodies, CARs and bispecific antibodies encoded by the isolated nucleic acid are described in detail throughout this application (including the description above and in the examples section).
- an isolated nucleic acid encoding an antibody as provided herein including embodiments thereof is provided.
- the isolated nucleic acid encodes a variable heavy chain domain or a variable light chain domain provided herein. In embodiments, the isolated nucleic acid encodes a variable heavy chain domain. In embodiments, the isolated nucleic acid encodes a variable light chain domain. In embodiments, the isolated nucleic acid includes the sequence of SEQ ID NO:l. In embodiments, the isolated nucleic acid includes the sequence of SEQ ID NO:3. In embodiments, the isolated nucleic acid includes the sequence of SEQ ID NO: 5. In embodiments, the isolated nucleic acid includes the sequence of SEQ ID NO:7. In embodiments, the isolated nucleic acid includes the sequence of SEQ ID NO:9. In embodiments, the isolated nucleic acid includes the sequence of SEQ ID NO: 11. In embodiments, the isolated nucleic acid includes the sequence of SEQ ID NO: 13. In embodiments, the isolated nucleic acid includes the sequence of SEQ ID NO: 15.
- an isolated nucleic acid encoding an antibody as provided herein including embodiments thereof is provided.
- the isolated nucleic acid includes the sequence of SEQ ID NO:91.
- the isolated nucleic acid includes the sequence of SEQ ID NO: 92.
- an isolated nucleic acid encoding a chimeric antigen receptor as provided herein including embodiments thereof is provided.
- the isolated nucleic acid includes the sequence of SEQ ID NO: 111.
- the isolated nucleic acid includes the sequence of SEQ ID NO: 112.
- compositions provided herein include pharmaceutical compositions including the anti anti-ROR2 antibodies, CARs and bispecific antibodies provided herein including embodiments thereof.
- a pharmaceutical composition including a therapeutically effective amount of an antibody as provided herein including embodiments thereof and a pharmaceutically acceptable excipient.
- compositions including a therapeutically effective amount of a CAR as provided herein including embodiments thereof and a pharmaceutically acceptable excipient.
- compositions including a therapeutically effective amount of a bispecific antibody as provided herein including embodiments thereof and a pharmaceutically acceptable excipient.
- compositions e.g., the anti-ROR2 antibodies CARs and bispecific antibodies provided herein, including embodiments thereof, are contemplated as providing effective treatments for diseases such as cancer (e.g., breast cancer).
- cancer e.g., breast cancer
- a method of treating cancer in a subject in need thereof including administering to a subject a therapeutically effective amount of an antibody as provided herein including embodiments thereof.
- a method of inhibiting metastasis of a ROR2 expressing cancer in a subject in need thereof including administering to a subject a therapeutically effective amount of an antibody provided herein including embodiments thereof.
- a method of treating cancer in a subject in need thereof including administering a therapeutically effective amount of a chimeric antigen receptor provided herein including embodiments thereof to a subject.
- the cancer is a solid tumor malignancy.
- the cancer is breast cancer, ovarian cancer, pancreatic cancer, cervical cancer, gastric cancer, renal cancer, head and neck cancer, hone cancer, skin cancer or prostate cancer.
- the cancer is breast cancer.
- the cancer is ovarian cancer.
- the cancer is pancreatic cancer.
- the cancer is cervical cancer.
- the cancer is gastric cancer.
- the cancer is renal cancer.
- the cancer is head and neck cancer.
- the cancer is bone cancer.
- the cancer is skin cancer.
- the cancer is prostate cancer.
- a method of detecting a ROR2 expressing cell including (i) contacting a ROR2-expressing cell with an antibody provided herein including embodiments thereof; (ii) and detecting binding of the antibody to a ROR2 protein expressed by the cell.
- the antibody is attached to a detectable moiety.
- a method of delivering a therapeutic agent to a ROR2 expressing cell including contacting a ROR2 expressing cell with an antibody provided herein including embodiments thereof, wherein the antibody is attached to a therapeutic agent.
- the therapeutic agent is an anti-cancer agent.
- anti-cancer agent include without limitation any anti-cancer agent conventionally used and known in the art, for example, calicheamicin, duocarmycin, pyrrolobenzodiazepine, (PBD), SN-38, DXd and anti-tubulin.
- PBD pyrrolobenzodiazepine
- SN-38 SN-38
- DXd anti-tubulin
- the contacting occurs in vitro.
- the ROR2-expressing cell is in a subject.
- the subject is a healthy subject.
- the subject is a subject having cancer.
- the cancer is a solid tumor malignancy.
- the cancer is breast cancer, ovarian cancer, pancreatic cancer, cervical cancer, gastric cancer, renal cancer, head and neck cancer, hone cancer, skin cancer or prostate cancer.
- the cancer is breast cancer.
- the cancer is ovarian cancer.
- the cancer is pancreatic cancer.
- the cancer is cervical cancer.
- the cancer is gastric cancer.
- the cancer is renal cancer.
- the cancer is head and neck cancer.
- the cancer is bone cancer.
- the cancer is skm cancer.
- the cancer is prostate cancer.
- the ROR2 expressing cell is a cancer cell.
- the cancer cell is cancer is a breast cancer cell, ovarian cancer cell, pancreatic cancer cell, cervical cancer cell, gastric cancer cell, renal cancer cell, head and neck cancer cell, bone cancer cell, skin cancer cell or prostate cancer cell.
- the cancer cell is a brest cancer cell.
- the cancer cell is an ovarian cancer cell.
- the cancer cell is a pancreatic cancer cell.
- the cancer cell is cancer is a cervical cancer cell.
- the cancer cell is cancer is a gastric cancer cell.
- the cancer cell is cancer is a renal cancer cell.
- the cancer cell is cancer is a head and neck cancer cell. In embodiments, the cancer cell is a cancer is bone cancer cell. In embodiments, the cancer cell is cancer is a skin cancer cell. In embodiments, the cancer cell is cancer is a prostate cancer cell.
- the antibody is administered at an amount from about 0.01 nM to about 10 nM. In embodiments, the antibody is administered at an amount from about 0.05 nM to about 10 nM. In embodiments, the antibody is administered at an amount from about 0.1 nM to about 10 nM. In embodiments, the antibody is administered at an amount from about 0.5 nM to about 10 nM. In embodiments, the antibody is administered at an amount from about 1 nM to about 10 nM. In embodiments, the antibody is administered at an amount from about 2 nM to about 10 nM. In embodiments, the antibody is administered at an amount from about 4 nM to about 10 nM.
- the antibody is administered at an amount from about 6 nM to about 10 nM. In embodiments, the antibody is administered at an amount from about 4 nM to about 10 nM. In embodiments, the antibody is administered at an amount from about 8nM to about lOnM. In embodiments, the antibody is administered at an amount of about 0.01 nM, 0.05 nM, 0.1 nM, 0.5 nM, 1 nM, 2 nM, 2 nM, 4 nM, 5 nM, 6 nM, 7 nM, 8 nM, 9 nM or 10 nM.
- the antibody is administered at an amount from 0.01 nM to 10 nM. In embodiments, the antibody is administered at an amount from 0.05 nM to 10 nM. In embodiments, the antibody is administered at an amount from 0.1 nM to 10 nM. In embodiments, the antibody is administered at an amount from 0.5 nM to 10 nM. In embodiments, the antibody is administered at an amount from 1 nM to 10 nM. In embodiments, the antibody is administered at an amount from 2 nM to 10 nM. In embodiments, the antibody is administered at an amount from 4 nM to 10 nM. In embodiments, the antibody is administered at an amount from 6 nM to 1 OnM.
- the antibody is administered at an amount from 4 nM to 10 nM. In embodiments, the antibody is administered at an amount from 8 nM to 10 nM. In embodiments, the antibody is administered at an amount of 0.01 nM, 0.05 nM, 0.1 nM, 0.5 nM, 1 nM, 2 nM, 2 nM, 4 nM, 5 nM, 6 nM, 7 nM, 8 nM, 9 nM or 10 nM. [0284] In embodiments, the antibody is administered at an amount from about 0.01 nM to about 8 nM. In embodiments, the antibody is administered at an amount from about 0.05 nM to about 8 nM.
- the antibody is administered at an amount from about 0.1 nM to about 8 nM. In embodiments, the antibody is administered at an amount from about 0.5 nM to about 8 nM. In embodiments, the antibody is administered at an amount from about 1 nM to about 8 nM. In embodiments, the antibody is administered at an amount from about 2 nM to about 8 nM. In embodiments, the antibody is administered at an amount from about 4 nM to about 8 nM. In embodiments, the antibody is administered at an amount from about 6 nM to about 8nM. In embodiments, the antibody is administered at an amount from about 4 nM to about 8 nM.
- the antibody is administered at an amount from 0.01 nM to 8 nM. In embodiments, the antibody is administered at an amount from 0.05 nM to 8 nM. In embodiments, the antibody is administered at an amount from 0.1 nM to 8 nM. In embodiments, the antibody is administered at an amount from 0.5 nM to 8n M. In embodiments, the antibody is administered at an amount from 1 nM to 8 nM. In embodiments, the antibody is administered at an amount from 2 nM to 8 nM. In embodiments, the antibody is administered at an amount from 4 nM to 8 nM. In embodiments, the antibody is administered at an amount from 6 nM to 8 nM.
- the antibody is administered at an amount from 4 nM to 8 nM.
- the antibody is administered at an amount from about 0.01 nM to about 6 nM. In embodiments, the antibody is administered at an amount from about 0.05 nM to about 6 nM. In embodiments, the antibody is administered at an amount from about 0.1 nM to about 6 nM. In embodiments, the antibody is administered at an amount from about 0.5 nM to about 8 nM. In embodiments, the antibody is administered at an amount from about 1 nM to about 6 nM. In embodiments, the antibody is administered at an amount from about 2 nM to about 6 nM. In embodiments, the antibody is administered at an amount from about 4 nM to about 6 nM.
- the antibody is administered at an amount from 0.01 nM to 6 nM. In embodiments, the antibody is administered at an amount from 0.05 nM to 6 nM. In embodiments, the antibody is administered at an amount from 0.1 nM to 6 nM. In embodiments, the antibody is administered at an amount from 0.5 nM to 6 nM. In embodiments, the antibody is administered at an amount from 1 nM to 6nM. In embodiments, the antibody is administered at an amount from 2 nM to 6 nM. In embodiments, the antibody is administered at an amount from 4 nM to 6 nM.
- the antibody is administered at an amount from about 0.01 nM to about 4 nM. In embodiments, the antibody is administered at an amount from about 0.05 nM to about 4 nM. In embodiments, the antibody is administered at an amount from about 0.1 nM to about 4 nM. In embodiments, the antibody is administered at an amount from about 0.5 nM to about 4nM. In embodiments, the antibody is administered at an amount from about 1 nM to about 4 nM. In embodiments, the antibody is administered at an amount from about 2 nM to about 4 nM.
- the antibody is administered at an amount from 0.01 nM to 4 nM. In embodiments, the antibody is administered at an amount from 0.05 nM to 4 nM. In embodiments, the antibody is administered at an amount from 0.1 nM to 4 nM. In embodiments, the antibody is administered at an amount from 0.5 nM to 4 nM. In embodiments, the antibody is administered at an amount from 1 nM to 4 nM. In embodiments, the antibody is administered at an amount from 2 nM to 4 nM.
- the antibody is administered at an amount from about 0.01 nM to about 2 nM. In embodiments, the antibody is administered at an amount from about 0.05 nM to about 2 nM. In embodiments, the antibody is administered at an amount from about 0.1 nM to about 2 nM. In embodiments, the antibody is administered at an amount from about 0.5 nM to about 2 nM. In embodiments, the antibody is administered at an amount from about 1 nM to about 2 nM.
- the antibody is administered at an amount from 0.01 nM to 2 nM. In embodiments, the antibody is administered at an amount from 0.05 nM to 2 nM. In embodiments, the antibody is administered at an amount from 0.1 nM to 2 nM. In embodiments, the antibody is administered at an amount from 0.5 nM to 2 nM. In embodiments, the antibody is administered at an amount from 1 nM to 2 nM.
- the antibody is administered at an amount from about O.OlnM to about InM. In embodiments, the antibody is administered at an amount from about 0.05nM to about InM. In embodiments, the antibody is administered at an amount from about 0. InM to about InM. In embodiments, the antibody is administered at an amount from about 0.5nM to about InM. [0293] In embodiments, the antibody is administered at an amount from O.OlnM to InM. In embodiments, the antibody is administered at an amount from 0.05nM to InM. In embodiments, the antibody is administered at an amount from 0. InM to InM. In embodiments, the antibody is administered at an amount from 0.5nM to InM.
- the antibody is administered at an amount of about 3.15nM. In embodiments, the antibody is administered at an amount of 3.15nM. In embodiments, the antibody is administered at an amount of about 1.05nM. In embodiments, the antibody is administered at an amount of 1.05nM.
- the bispecific antibody or the chimeric antigen receptor provided herein including embodiments thereof may be administered at any of the concentrations described herein for the administration of the antibody (e.g., O.OlnM-lOnM).
- the antibody is administered at an amount from about 10 pg to about 500 pg. In embodiments, the antibody is administered at an amount from about 20 pg to about 500 pg. In embodiments, the antibody is administered at an amount from about 30 pg to about 500 pg. In embodiments, the antibody is administered at an amount from about 40 pg to about 500 pg. In embodiments, the antibody is administered at an amount from about 50 pg to about 500 pg. In embodiments, the antibody is administered at an amount from about 60 pg to about 500 pg. In embodiments, the antibody is administered at an amount from about 70 pg to about 500 pg.
- the antibody is administered at an amount from about 80 pg to about 500 pg. In embodiments, the antibody is administered at an amount from about 90 pg to about 500 pg. In embodiments, the antibody is administered at an amount from about 100 pg to about 500 pg.
- the antibody is administered at an amount from about 110 pg to about
- the antibody is administered at an amount from about 120 pg to about
- the antibody is administered at an amount from about 130 pg to about
- the antibody is administered at an amount from about 140 pg to about
- the antibody is administered at an amount from about 150 pg to about
- the antibody is administered at an amount from about 160 pg to about
- the antibody is administered at an amount from about 170 pg to about
- the antibody is administered at an amount from about 180 pg to about
- the antibody is administered at an amount from about 190 pg to about 500 mg. In embodiments, the antibody is administered at an amount from about 200 mg to about 500 mg.
- the antibody is administered at an amount from about 210 mg to about 500 mg. In embodiments, the antibody is administered at an amount from about 220 mg to about
- the antibody is administered at an amount from about 230 mg to about
- the antibody is administered at an amount from about 240 mg to about
- the antibody is administered at an amount from about 250 mg to about
- the antibody is administered at an amount from about 260 mg to about
- the antibody is administered at an amount from about 270 mg to about
- the antibody is administered at an amount from about 280 mg to about
- the antibody is administered at an amount from about 290 mg to about
- the antibody is administered at an amount from about 300 mg to about
- the antibody is administered at an amount from about 310 mg to about 500 mg. In embodiments, the antibody is administered at an amount from about 320 mg to about
- the antibody is administered at an amount from about 330 mg to about
- the antibody is administered at an amount from about 340 mg to about
- the antibody is administered at an amount from about 350 mg to about
- the antibody is administered at an amount from about 360 mg to about
- the antibody is administered at an amount from about 370 mg to about
- the antibody is administered at an amount from about 380 mg to about
- the antibody is administered at an amount from about 390 mg to about
- the antibody is administered at an amount from about 400 mg to about
- the antibody is administered at an amount from about 410 mg to about 500 mg. In embodiments, the antibody is administered at an amount from about 420 mg to about
- the antibody is administered at an amount from about 430 mg to about
- the antibody is administered at an amount from about 440 mg to about
- the antibody is administered at an amount from about 450 mg to about
- the antibody is administered at an amount from about 460 mg to about 500 mg. In embodiments, the antibody is administered at an amount from about 470 mg to about
- the antibody is administered at an amount from about 480 mg to about
- the antibody is administered at an amount from about 490 mg to about
- the antibody is administered at an amount from about 10 mg to about 400 mg. In embodiments, the antibody is administered at an amount from about 20 mg to about
- the antibody is administered at an amount from about 30 mg to about
- the antibody is administered at an amount from about 40 mg to about
- the antibody is administered at an amount from about 50 mg to about
- the antibody is administered at an amount from about 60 mg to about
- the antibody is administered at an amount from about 70 mg to about
- the antibody is administered at an amount from about 80 mg to about
- the antibody is administered at an amount from about 90 mg to about
- the antibody is administered at an amount from about 100 mg to about 400 mg.
- the antibody is administered at an amount from about 10 mg to about 300 mg. In embodiments, the antibody is administered at an amount from about 20 mg to about
- the antibody is administered at an amount from about 30 mg to about
- the antibody is administered at an amount from about 40 mg to about
- the antibody is administered at an amount from about 50 mg to about
- the antibody is administered at an amount from about 60 mg to about
- the antibody is administered at an amount from about 70 mg to about
- the antibody is administered at an amount from about 80 mg to about
- the antibody is administered at an amount from about 90 mg to about
- the antibody is administered at an amount from about 100 mg to about 300 mg.
- the antibody is administered at an amount from about 10 mg to about 200 mg. In embodiments, the antibody is administered at an amount from about 20 mg to about
- the antibody is administered at an amount from about 30 mg to about
- the antibody is administered at an amount from about 40 mg to about 200 mg. In embodiments, the antibody is administered at an amount from about 50 mg to about
- the antibody is administered at an amount from about 60 mg to about
- the antibody is administered at an amount from about 70 mg to about
- the antibody is administered at an amount from about 80 mg to about
- the antibody is administered at an amount from about 90 mg to about
- the antibody is administered at an amount from about 100 mg to about 200 mg.
- the antibody is administered at an amount from about 10 mg to about 100 mg. In embodiments, the antibody is administered at an amount from about 20 mg to about
- the antibody is administered at an amount from about 30 mg to about
- the antibody is administered at an amount from about 40 mg to about
- the antibody is administered at an amount from about 50 mg to about
- the antibody is administered at an amount from about 60 mg to about
- the antibody is administered at an amount from about 70 mg to about
- the antibody is administered at an amount from about 80 mg to about
- the antibody is administered at an amount from about 90 mg to about
- the antibody is administered at an amount of about 10 mg, 20 mg, 30 mx, 40 mg, 50 mg, 60 mg, 70 mg, 80 mg , 90 mg , 100 mg , 110 mg, 120 mg, 130 mg, 140 mg, 150 mg, 160 mg, 170 mg, 180 mg 190 mg 200 mg 210 mg, 220 mg, 230 mg, 240 mg, 250 mg, 260 mg, 270 mg, 280 mg 290 mg 300 mg 310 mg, 320 mg, 330 mg, 340 mg, 350 mg, 360 mg, 370 mg, 380 mg
- the antibody is administered at an amount of 10 mg, 20 mg, 30 mg, 40 mg, 50 mg. 60 mg, 70 mg. 80 mg , 90 mg , 100 mg , 110 mg, 120 mg, 130 mg, 140 mg, 150 mg, 160 mg, 170 mg, 180 mg 190 mg 200 mg 210 mg, 220 mg, 230 mg, 240 mg, 250 mg, 260 mg, 270 mg, 280
- bispecific antibody or the chimeric antigen receptor provided herein including embodiments thereof may be administered at any of the concentrations described herein for the administration of the antibody (e.g., 10 pg -500 pg).
- compositions provided herein, including embodiments thereof, are further contemplated for inhibiting cell migration.
- a method of inhibiting migration of a ROR2-expressing cell including contacting a ROR2 expressing cell with an antibody provided herein including embodiments thereof.
- the antibody includes a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain includes: a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26 and a CDR H3 as set forth in SEQ ID NO:27; and wherein the light chain variable domain includes: a CDR LI as set forth in SEQ ID NO:28, a CDR L2 as set forth in SEQ ID NO:29, and a CDR L3 as set forth in SEQ ID NO:30.
- the ROR2 expressing cell is a cancer cell.
- the cancer cell is cancer is a breast cancer cell, ovarian cancer cell, pancreatic cancer cell, cervical cancer cell, gastric cancer cell, renal cancer cell, head and neck cancer cell, bone cancer cell, skin cancer cell or prostate cancer cell.
- the cancer is cancer is breast cancer.
- the cancer cell is an ovarian cancer cell.
- the cancer cell is a pancreatic cancer cell.
- the cancer cell is cancer is a cervical cancer cell.
- the cancer cell is cancer is a gastric cancer cell.
- the cancer cell is cancer is a renal cancer cell.
- the cancer cell is cancer is a head and neck cancer cell. In embodiments, the cancer cell is a cancer is bone cancer cell. In embodiments, the cancer cell is cancer is a skin cancer cell. In embodiments, the cancer cell is cancer is a prostate cancer cell.
- ROR2 Due to its expression in cancer cells, ROR2 has the potential to serve as a diagnostic and therapeutic target. There have been monoclonal antibodies generated that reportedly bind ROR2 and that are available from commercial sources. However, Applicants found that several reacted with cells expressing ROR2 by immunoblot and/or flow cytometry. Further, Applicants discovered that several of these antibodies also unexpectedly reacted with cells that were deleted of ROR2 using CRISPR-Cas9 technology. This unexpected binding revealed that many commercially available antibodies are not specific for ROR2.
- mice were immunized with recombinant protein of the extracellular portion (AA 1-403) of the ROR2 protein that include the Ig-like, cysteine rich domain (CRD) and Kringle domains (FIG. 1). Because of the high degree of homology between the murine and human molecules, Applicants co-injected immune stimulatory agents, such as Freund’s Complete Adjuvant, to maximize the generation of anti-human ROR2 antibodies.
- immune stimulatory agents such as Freund’s Complete Adjuvant
- Hybridomas generated following fusion of splenocytes with a myeloma fusion partner were screened for expression of anti-ROR2 mAb using ELISA and flow cytometry to identify clones that produce antibody that specifically bind to human ROR2.
- mAbs N-LN or in the more familiar form 6-E6, are listed in Table 1, and the sequences of the heavy and light chain variable regions are depicted in FIG. 2.
- Equilibrium dissociation constants (Kd) were measured in a kinetic exclusion assay (KinExA) that measures the equilibrium binding affinity and kinetics between unmodified molecules in solution.
- the 6E6 mAh binds to the target ROR2 extracellular sequence with a Kd of about 0.1 nM.
- 4G9 binds to the extracellular domain of human ROR2 with a Kd of about 2 nM (FIG.s 4A and 4B).
- Analysis of the 5C11 and 5G3 mAh determined that each has a Kd greater than about 40 nM, consistent with the results from the ELISA analysis above.
- the 6E6 and 5C11 mAh bind to the Kringle domain of human, but not mouse, ROR2.
- the 4G9 and 5G3 mAh bind within the first 111 aa of human ROR2, which includes the Ig-like domain. None of the four mAh bind mouse ROR2.
- Applicants also refined this procedure to identify specific amino acids that are critical for the binding of the two anti-ROR2 mAbs that bind within the Kringle domain (FIG. 6).
- Applicants produced several recombinant human ROR2 proteins in which one of the amino acids that differs between human and mouse ROR2 within the Kringle domain was replaced with the corresponding amino acid of mouse ROR2.
- 6E6 and 5C11 mAbs require a histidine residue at position 349 and an aspartic acid at position 354 for binding to the Kringle domain of human ROR2, as replacement of these amino acids with the murine molecule’s arginine and glutamic acid residues, respectively, the 6E6 and 5C11 mAbs no longer bind the ROR2 protein. Additionally, 5C11 requires a methionine residue at position 386, as binding is lost upon replacement of methionine with the valine of mouse ROR2.
- Binding of each of the mAh to human ROR2 was validated by flow cytometric staining and analysis of several cell lines known to express ROR2 using each mAh conjugated with Alexa647 (FIG. 7 A). Specificity was validated by the absence of binding to HCT116 colorectal cancer cells and HEK293 cells in which ROR2 expression was eliminated using CRISPR-cas9 (FIG. 7B). Validation of the specificity of these mAh sets them apart from many commercially available anti-human ROR2 polyclonal and monoclonal antibodies, as in the last few years several that have been widely used in published studies, have subsequently been recalled and are no longer available, as they were determined to not be specific for ROR2.
- 6E6 and 4G9 mAh have been tested on primary human cells.
- 6E6 and 4G9 each stain ROR2 on BR1936, but not BR1367 (ROR2 negative), human breast cancer PDX cells (FIG. 8), compared to staining with equal amounts of isotype matched Alex647-conjugated control antibody.
- Neither 6E6 nor 4G9 demonstrate binding to peripheral blood mononuclear cells isolated from several healthy donors (FIG. 9).
- Both the 6E6 and 4G9 mAh had increased relative fluorescence in K562 cells at 37°C, relative to unstained cells or cells incubated at 4°C, and showed no difference at either temperature for JEKO cells that lacked ROR2 expression.
- 6E6 internalized with greater efficiency than 4G9. Because antibodies that internalize into primary endosomes/lysosomes have been demonstrated to be effective vehicles for delivering drugs or other molecules conjugated to them to the cell that expresses the target antigen, in this case ROR2, Applicants conclude from these data that 6E6 would be very effective as the antibody in antibody-drug conjugates (or ADCs) that then could target cells that express ROR2.
- antibodies targeting the epitope recognized by 6E6 can be used to deliver drugs or other compounds efficiently to cells that express ROR2 in a fashion that allows for the drug/compound to be internalized into the cell and active within the ROR2 cell. This allows for selective targeting of ROR2 positive cells in vivo. Further, these antibodies may be used for targeting ROR2-expressing cells with agents that can identify the ROR2-expressing cell for diagnostic imaging or fluorescence identification during surgical extraction of ROR2-positive cancer cells.
- Tumor-cell expression of ROR2 may have functional significance.
- MCF7-ROR2 cells had enhanced motility and tissue invasiveness in response to Wnt5a than parental MCF7 ceils, which do not express ROR2.
- the increased motility and invasiveness are associated with an enhanced capacity to form metastatic tumors in immune-deficient mice, such has been observed using MCF7 cells transfected to express RORl.
- MCF7-ROR2 cells treated with Wnt5a had 2-fold greater migration/invasiveness than Wnt5a- treated MCF7 cells; the increased migration MCF7-ROR2 cells was not inhibited when control, non-specific mouse IgG was added to the cultures (FIG. 11 A, gray bars).
- 25 ug/ml of 6E6 (white bars), but not 4G9 (black bars) provided for complete inhibition of Wnt5a-induced migration of MCF7-ROR2 cells, such that it no longer had an advantage over MCF7 cells in the migration/invasiveness assay.
- scFv single chain Fv
- 6E6 or 4G9 bind to the ROR2 antigen by ELISA and can bind specifically to cells that express the ROR2 surface antigen (FIG. 12). Therefore, the 6E6 or 4G9 scFv retain their specificity and binding activity for the target antigen.
- Such scFv’s also may be used to generate bispecific antibodies that conjoin the scFv of 6E6 or 4G9 with another scFv, such as the scFv that recognizes a surface antigen expressed by T cells (e.g. CD3).
- T cells e.g. CD3
- chimeric bispecific molecules may be used for cellular immune activation for the purpose of killing ROR2-expressing cells in patients treated with such bispecific antibodies.
- CARs chimeric antigen receptors
- T cells or NK cells for generation of cytotoxic effector cells capable of specifically killing cells that express the ROR2 surface antigen.
- Applicants have generated CAR constructs using the variable region sequences of either the 6E6 or 4G9 scFv. Applicants find that transfection of cells with these constructs can generate cells that express surface CAR that bind to the extracellular domain of ROR2.
- ROR2-Ig a recombinant protein called ROR2-Ig, which is comprised of the ROR2 extracellular domain and the CH2-CH3 constant region domains of human IgGl.
- RORl-Ig a recombinant protein comprised of the extracellular domain of ROR1 and the CH2-CH3 constant region domains of human IgGl. This allows for isolation of soluble proteins with the extracellular domain of either ROR2 or ROR1.
- Embodiment 1 An anti -tyrosine kinase-like orphan receptor 2 (ROR2) antibody comprising a heavy chain variable domain and a light chain variable domain, wherein said heavy chain variable domain comprises: a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26 and a CDR H3 as set forth in SEQ ID NO:27; and wherein said light chain variable domain comprises: a CDR LI as set forth in SEQ ID NO:28, a CDR L2 as set forth in SEQ ID NO:29, and a CDR L3 as set forth in SEQ ID NO:30.
- ROR2 anti -tyrosine kinase-like orphan receptor 2
- Embodiment 2 The antibody of embodiment 1, wherein said heavy chain variable domain comprises the sequence of SEQ ID NO: 2.
- Embodiment 3 The antibody of embodiment 1 or 2, wherein said light chain variable domain comprises the sequence of SEQ ID NO: 4.
- Embodiment 4 The antibody of any one of embodiments 1 to 3, wherein said antibody is a humanized antibody.
- Embodiment 5 The antibody of any one of embodiments 1 to 4, wherein said antibody is a Fab' fragment.
- Embodiment 6 The antibody of any one of embodiments 1 to 4, wherein said antibody is a single chain antibody (scFv).
- Embodiment 7 The antibody of any one of embodiments 1 to 3, wherein said antibody is a chimeric antibody.
- Embodiment 8 The antibody of any one of embodiments 1 to 4, wherein said antibody is an IgG.
- Embodiment 9 The antibody of any one of embodiments 1 to 4 or 8, wherein said antibody is an IgGl or an IgG2.
- Embodiment 10 The antibody of any one of embodiments 1 to 9, wherein said antibody is capable of binding a ROR2 protein.
- Embodiment 11 The antibody of embodiment 10, wherein said ROR2 protein comprises the amino acid sequence of SEQ ID NO: 18.
- Embodiment 12 The antibody of embodiment 10 or 11, wherein said antibody is capable of binding the extracellular domain of said ROR2 protein.
- Embodiment 13 The antibody of embodiment 12, wherein said extracellular domain comprises the amino acid sequence of SEQ ID NO:22.
- Embodiment 14 The antibody of embodiment 12, wherein said extracellular domain is a Kringle domain.
- Embodiment 15 The antibody of any one of embodiments 10 to 14, wherein said ROR2 protein comprises a histidine at a position corresponding to position 349 or an aspartic acid at a position corresponding to position 354 of SEQ ID NO:22.
- Embodiment 16 The antibody of any one of embodiments 10 to 15, wherein said
- ROR2 protein is expressed on a cell.
- Embodiment 17 The antibody of embodiment 16, wherein said cell is a cancer cell.
- Embodiment 18 The antibody of embodiment 17, wherein said cancer cell is a breast cancer cell, ovarian cancer cell, pancreatic cancer cell, cervical cancer cell, gastric cancer cell, renal cancer cell, head and neck cancer cell, bone cancer cell, skin cancer cell or prostate cancer cell.
- said cancer cell is a breast cancer cell, ovarian cancer cell, pancreatic cancer cell, cervical cancer cell, gastric cancer cell, renal cancer cell, head and neck cancer cell, bone cancer cell, skin cancer cell or prostate cancer cell.
- Embodiment 19 The antibody of any one of embodiments 10 to 18, wherein said antibody is capable of binding said ROR2 protein with an equilibrium dissociation constant (KD) from about 0.01 nM to about 1 nM.
- Embodiment 20 The antibody of any one of embodiments 10 to 19, wherein said antibody is capable of binding said ROR2 protein with an equilibrium dissociation constant (KD) of about 0.06 nM.
- Embodiment 21 The antibody of any one of embodiments 1 to 20, wherein said antibody is attached to a therapeutic agent.
- Embodiment 22 The antibody of any one of embodiments 1 to 20, wherein said antibody is attached to a diagnostic agent.
- Embodiment 23 An anti -tyrosine kinase-like orphan receptor 2 (ROR2) antibody comprising a heavy chain variable domain and a light chain variable domain, wherein said heavy chain variable domain comprises: a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32 and a CDR H3 as set forth in SEQ ID NO:33; and wherein said light chain variable domain comprises: a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35, and a CDR L3 as set forth in SEQ ID NO:36.
- ROR2 anti -tyrosine kinase-like orphan receptor 2
- Embodiment 24 The antibody of embodiment 23, wherein said heavy chain variable domain comprises the sequence of SEQ ID NO: 6.
- Embodiment 25 The antibody of embodiment 23 or 24, wherein said light chain variable domain comprises the sequence of SEQ ID NO: 8.
- Embodiment 26 The antibody of any one of embodiments 23 to 25, wherein said antibody is a humanized antibody.
- Embodiment 27 The antibody of any one of embodiments 23 to 26, wherein said antibody is a Fab' fragment.
- Embodiment 28 The antibody of any one of embodiments 23 to 26, wherein said antibody is a single chain antibody (scFv).
- Embodiment 29 The antibody of any one of embodiments 23 to 25, wherein said antibody is a chimeric antibody.
- Embodiment 30 The antibody of any one of embodiments 23 to 26, wherein said antibody is an IgG.
- Embodiment 31 The antibody of any one of embodiments 23 to 26 or 30, wherein said antibody is an IgGl or an IgG2.
- Embodiment 32 The antibody of any one of embodiments 23 to 31, wherein said antibody is capable of binding a ROR2 protein comprising the amino acid sequence of SEQ ID NO:18.
- Embodiment 33 The antibody of embodiment 32, wherein said antibody is capable of binding an extracellular domain of said ROR2 protein.
- Embodiment 34 The antibody of embodiment 33, wherein said extracellular domain comprises the amino acid sequence of SEQ ID NO:22.
- Embodiment 35 The antibody of embodiment 33, wherein said extracellular domain is an Ig-like domain.
- Embodiment 36 The antibody of any one of embodiments 32 to 35, wherein said
- ROR2 protein comprises a methionine at a position corresponding to position 386 of SEQ ID NO:22.
- Embodiment 37 The antibody of any one of embodiments 32 to 36, wherein said ROR2 protein is expressed on a cell.
- Embodiment 38 The antibody of embodiment 37, wherein said cell is a cancer cell.
- Embodiment 39 The antibody of embodiment 38, wherein said cancer cell is a breast cancer cell, ovarian cancer cell, pancreatic cancer cell, cervical cancer cell, gastric cancer cell, renal cancer cell, head and neck cancer cell, bone cancer cell, skin cancer cell or prostate cancer cell.
- Embodiment 40 The antibody of any one of embodiments 32 to 39, wherein said antibody is capable of binding said ROR2 protein with an equilibrium dissociation constant (K D ) from about 0.2 nM to about 5 nM.
- K D equilibrium dissociation constant
- Embodiment 41 The antibody of any one of embodiments 32 to 40, wherein said antibody is capable of binding a ROR2 protein with an equilibrium dissociation constant (KD) of about 1.9 nM.
- KD equilibrium dissociation constant
- Embodiment 42 The antibody of any one of embodiments 23 to 41, wherein said antibody is conjugated to a therapeutic agent.
- Embodiment 43 The antibody of any one of embodiments 23 to 41, wherein said antibody is conjugated to a diagnostic agent.
- Embodiment 44 An anti-tyrosine kinase-like orphan receptor 2 (ROR2) antibody comprising a heavy chain variable domain and a light chain variable domain, wherein said heavy chain variable domain comprises: a CDR HI as set forth in SEQ ID NO:37, a CDR H2 as set forth in SEQ ID NO:38 and a CDR H3 as set forth in SEQ ID NO:39; and wherein said light chain variable domain comprises: a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO: 41, and a CDR L3 as set forth in SEQ ID NO: 42.
- ROR2 anti-tyrosine kinase-like orphan receptor 2
- Embodiment 45 The antibody of embodiment 44, wherein said heavy chain variable domain comprises the sequence of SEQ ID NO: 10.
- Embodiment 46 The antibody of embodiment 44 or 45, wherein said light chain variable domain comprises the sequence of SEQ ID NO: 12.
- Embodiment 47 The antibody of any one of embodiments 44 to 46, wherein said antibody is a humanized antibody.
- Embodiment 48 The antibody of any one of embodiments 44 to 47, wherein said antibody is a Fab' fragment.
- Embodiment 49 The antibody of any one of embodiments 44 to 47, wherein said antibody is a single chain antibody (scFv).
- Embodiment 50 The antibody of any one of embodiments 44 to 46, wherein said antibody is a chimeric antibody.
- Embodiment 51 The antibody of any one of embodiments 44 to 47, wherein said antibody is an IgG.
- Embodiment 52 The antibody of any one of embodiments 44 to 47 or 51, wherein said antibody is an IgGl .
- Embodiment 53 The antibody of any one of embodiments 44 to 52, wherein said antibody is capable of binding a ROR2 protein comprising the amino acid sequence of SEQ ID NO: 18.
- Embodiment 54 The antibody of embodiment 53, wherein said antibody is capable of binding an extracellular domain of a ROR2 protein.
- Embodiment 55 The antibody of embodiment 54, wherein said extracellular domain comprises the amino acid sequence of SEQ ID NO:22.
- Embodiment 56 The antibody of embodiment 54, wherein said wherein said extracellular domain is a Kringle domain.
- Embodiment 57 The antibody of any one of embodiments 53 to 56, wherein said ROR2 protein comprises a histidine at a position corresponding to position 349, an aspartic acid at a position corresponding to position 354, or a methionine at a position corresponding to position 386 of SEQ ID NO:22.
- Embodiment 58 The antibody of any one of embodiments 43 to 57, wherein said ROR2 protein is expressed on a cell.
- Embodiment 59 The antibody of embodiment 58, wherein said cell is a cancer cell.
- Embodiment 60 The antibody of embodiment 59, wherein said cancer cell is a breast cancer cell, ovarian cancer cell, pancreatic cancer cell, cervical cancer cell, gastric cancer cell, renal cancer cell, head and neck cancer cell, bone cancer cell, skin cancer cell or prostate cancer cell.
- Embodiment 61 The antibody of any one of embodiments 44 to 50, wherein said antibody is capable of binding said ROR2 protein with an equilibrium dissociation constant (KD) from about 10 nM to about 150 nM.
- KD equilibrium dissociation constant
- Embodiment 62 The antibody of any one of embodiments 44 to 61, wherein said antibody is conjugated to a therapeutic agent.
- Embodiment 63 The antibody of any one of embodiments 44 to 61, wherein said antibody is conjugated to a diagnostic agent.
- Embodiment 64 An anti-tyrosine kinase-like orphan receptor 2 (ROR2) antibody comprising a heavy chain variable domain and a light chain variable domain, wherein said heavy chain variable domain comprises: a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44 and a CDR H3 as set forth in SEQ ID NO:45; and wherein said light chain variable domain comprises: a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47, and a CDR L3 as set forth in SEQ ID NO:48.
- ROR2 anti-tyrosine kinase-like orphan receptor 2
- Embodiment 65 The antibody of embodiment 64, wherein said heavy chain variable domain comprises the sequence of SEQ ID NO: 14.
- Embodiment 66 The antibody of embodiment 64 or 65, wherein said light chain variable domain comprises the sequence of SEQ ID NO: 16.
- Embodiment 67 The antibody of any one of embodiments 64 to 66, wherein said antibody is a humanized antibody.
- Embodiment 68 The antibody of any one of embodiments 64 to 67, wherein said antibody is a Fab' fragment.
- Embodiment 69 The antibody of any one of embodiments 64 to 67, wherein said antibody is a single chain antibody (scFv).
- Embodiment 70 The antibody of any one of embodiments 64 to 66, wherein said antibody is a chimeric antibody.
- Embodiment 71 The antibody of any one of embodiments 64 to 67, wherein said antibody is an IgG.
- Embodiment 72 The antibody of any one of embodiments 64 to 66 or 71, wherein said antibody is an IgGl .
- Embodiment 73 The antibody of any one of embodiments 64 to 67, wherein said antibody is capable of binding a ROR2 protein comprising the amino acid sequence of SEQ ID NO:18.
- Embodiment 74 The antibody of embodiment 73, wherein said antibody is capable of binding an extracellular domain of said ROR2 protein.
- Embodiment 75 The antibody of embodiments 74, wherein said extracellular domain comprises the amino acid sequence of SEQ ID NO:22.
- Embodiment 76 The antibody of embodiment 72, wherein said extracellular domain is an Ig-like domain.
- Embodiment 77 The antibody of any one of embodiments 74 to 76, wherein said ROR2 protein is expressed on a cell.
- Embodiment 78 The antibody of embodiment 77, wherein said cell is a cancer cell.
- Embodiment 79 The antibody of embodiment 78, wherein said cancer cell is a breast cancer cell, ovarian cancer cell, pancreatic cancer cell, cervical cancer cell, gastric cancer cell, renal cancer cell, head and neck cancer cell, bone cancer cell, skin cancer cell or prostate cancer cell.
- Embodiment 80 The antibody of any one of embodiments 64 to 79, wherein said antibody is capable of binding said ROR2 protein with an equilibrium dissociation constant (KD) from about 10 nM to about 150 nM.
- KD equilibrium dissociation constant
- Embodiment 81 The antibody of any one of embodiments 64 to 80, wherein said antibody is conjugated to a therapeutic agent.
- Embodiment 82 The antibody of any one of embodiments 64 to 80, wherein said antibody is conjugated to a diagnostic agent.
- Embodiment 83 A method of treating cancer in a subject in need thereof, said method comprising administering to a subject a therapeutically effective amount of an antibody of any one of embodiments 1 to 82.
- Embodiment 84 A method of inhibiting metastasis of a ROR2 expressing cancer in a subject in need thereof, said method comprising administering to a subject a therapeutically effective amount of an antibody of any one of embodiments 1 to 82.
- Embodiment 85 The method of embodiments 83 or 84, wherein said cancer is breast cancer, ovarian cancer, pancreatic cancer, cervical cancer, gastric cancer, renal cancer, head and neck cancer, bone cancer, skin cancer or prostate cancer.
- Embodiment 86 A method of detecting a ROR2 expressing cell, said method comprising (i)contacting a ROR2-expressing cell with an antibody of any one of embodiments 1 to 82; and (ii) detecting binding of said antibody to a ROR2 protein expressed by said cell.
- Embodiment 87 The method of embodiment 86, wherein said antibody is attached to a detectable moiety.
- Embodiment 88 The method of embodiment 86 or 87, wherein said ROR2-expressing cell is in a subject.
- Embodiment 89 The method of embodiment 88, wherein said subject is a subject having cancer.
- Embodiment 90 The method of embodiment 89, wherein said cancer is cancer is breast cancer, ovarian cancer, pancreatic cancer, cervical cancer, gastric cancer, renal cancer, head and neck cancer, bone cancer, skin cancer or prostate cancer.
- Embodiment 91 The method of embodiment 86 or 87, wherein said contacting occurs in vitro.
- Embodiment 92 A method of delivering a therapeutic agent to a ROR2 expressing cell, said method comprising contacting a ROR2 expressing cell with an antibody of any one of embodiments 1-82, wherein said antibody is attached to a therapeutic agent.
- Embodiment 93 The method of embodiment 92, wherein said therapeutic agent is an anti-cancer agent.
- Embodiment 94 The method of embodiment 92 or 93, wherein said ROR2-expressing cell is in a subject.
- Embodiment 95 The method of embodiment 94, wherein said subject is a subject having cancer.
- Embodiment 96 The method of embodiment 95, wherein said cancer is cancer is breast cancer, ovarian cancer, pancreatic cancer, cervical cancer, gastric cancer, renal cancer, head and neck cancer, bone cancer, skin cancer or prostate cancer.
- Embodiment 97 The method of embodiment 93 or 94, wherein said contacting occurs in vitro.
- Embodiment 98 A method of inhibiting migration of a ROR2-expressing cell, said method comprising contacting a ROR2 expressing cell with an antibody of any one of embodiments 1-80.
- Embodiment 99 The method of embodiment 98, wherein said ROR2 expressing cell is in a subject having cancer.
- Embodiment 100 The method of embodiment 99, wherein said cancer is cancer is breast cancer, ovarian cancer, pancreatic cancer, cervical cancer, gastric cancer, renal cancer, head and neck cancer, bone cancer, skin cancer or prostate cancer.
- Embodiment 101 The method of embodiment 98, wherein said contacting occurs in vitro.
- Embodiment 102 The method of any one of embodiments 86 to 101, wherein said ROR2 expressing cell is a cancer cell.
- Embodiment 103 The method of embodiment 102, wherein said cancer cell is a breast cancer cell, ovarian cancer cell, pancreatic cancer cell, cervical cancer cell, gastric cancer cell, renal cancer cell, head and neck cancer cell, bone cancer cell, skin cancer cell or prostate cancer cell.
- Embodiment 104 An anti-ROR2 antibody, wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain comprising: a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26 and a CDR H3 as set forth in SEQ ID NO:27; and a light chain variable domain comprising: a CDR LI as set forth in SEQ ID NO:28, a CDR L2 as set forth in SEQ ID NO:29, and a CDR L3 as set forth in SEQ ID NO:30
- Embodiment 105 An anti-ROR2 antibody, wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain of SEQ ID:2; and a light chain variable domain of SEQ ID NO:4.
- Embodiment 106 An anti-ROR2 antibody, wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID:1; and a light chain variable domain encoded by the nucleic acid sequence of SEQ ID:3.
- Embodiment 107 An anti-ROR2 antibody, wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain comprising: a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32 and a CDR H3 as set forth in SEQ ID NO:33; and a light chain variable domain comprising: a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35, and a CDR L3 as set forth in SEQ ID NO: 36.
- a heavy chain variable domain comprising: a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32 and a CDR H3 as set forth in SEQ ID NO:33
- a light chain variable domain comprising: a CDR LI as set forth in SEQ ID NO:34, a CDR
- Embodiment 108 An anti-ROR2 antibody, wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain of SEQ ID:6; and a light chain variable domain of SEQ ID NO: 8.
- Embodiment 109 An anti-ROR2 antibody, wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID:5; and a light chain variable domain encoded by the nucleic acid sequence of SEQ ID:7.
- Embodiment 110 Embodiment 110.
- an anti-ROR2 antibody wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain comprising: a CDR HI as set forth in SEQ ID NO: 37, a CDR H2 as set forth in SEQ ID NO: 38 and a CDR H3 as set forth in SEQ ID NO:39; and a light chain variable domain comprising: a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO:41, and a CDR L3 as set forth in SEQ ID NO: 42
- Embodiment 111 An anti-ROR2 antibody, wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain of SEQ ID: 10; and a light chain variable domain of SEQ ID NO: 12.
- Embodiment 112. An anti-ROR2 antibody, wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID:9; and a light chain variable domain encoded by the nucleic acid sequence of SEQ ID:11.
- Embodiment 113 An anti-ROR2 antibody, wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain comprising: a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44 and a CDR H3 as set forth in SEQ ID NO:45; and a light chain variable domain comprising: a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47, and a CDR L3 as set forth in SEQ ID NO:48.
- a heavy chain variable domain comprising: a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44 and a CDR H3 as set forth in SEQ ID NO:45
- a light chain variable domain comprising: a CDR LI as set forth in SEQ ID NO:46, a CDR
- Embodiment 114 An anti-ROR2 antibody, wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain of SEQ ID: 14; and a light chain variable domain of SEQ ID NO: 16.
- Embodiment 115 An anti-ROR2 antibody, wherein said anti-ROR2 antibody binds the same epitope as an anti-ROR2 antibody comprising a heavy chain variable domain encoded by the nucleic acid sequence of SEQ ID: 13; and a light chain variable domain encoded by the nucleic acid sequence of SEQ ID: 15.
- Embodiment 116 A chimeric antigen receptor comprising: (i) an antibody region comprising: (a) a light chain variable domain comprising a CDR LI as set forth in SEQ ID NO: 28, a CDR L2 as set forth in SEQ ID NO:29 and a CDR L3 as set forth in SEQ ID NO: 30; and (b) a heavy chain variable region domain comprising a CDR HI as set forth in SEQ ID NO:25, a CDR H2 as set forth in SEQ ID NO:26, and a CDR H3 as set forth in SEQ ID NO:27; and (ii) a transmembrane domain.
- an antibody region comprising: (a) a light chain variable domain comprising a CDR LI as set forth in SEQ ID NO: 28, a CDR L2 as set forth in SEQ ID NO:29 and a CDR L3 as set forth in SEQ ID NO: 30; and (b) a heavy chain variable region domain comprising a CDR HI as set forth
- a chimeric antigen receptor comprising: (i) an antibody region comprising: (a) a light chain variable domain comprising a CDR LI as set forth in SEQ ID NO:34, a CDR L2 as set forth in SEQ ID NO:35 and a CDR L3 as set forth in SEQ ID NO:36; and (b) a heavy chain variable region domain comprising a CDR HI as set forth in SEQ ID NO:31, a CDR H2 as set forth in SEQ ID NO:32, and a CDR H3 as set forth in SEQ ID NO:33; and (ii) a transmembrane domain.
- a chimeric antigen receptor comprising: (i) an antibody region comprising: (a) a light chain variable domain comprising a CDR LI as set forth in SEQ ID NO:40, a CDR L2 as set forth in SEQ ID NO:41 and a CDR L3 as set forth in SEQ ID NO:42; and (b) a heavy chain variable region domain comprising a CDR HI as set forth in SEQ ID NO:37, a CDR H2 as set forth in SEQ ID NO:38, and a CDR H3 as set forth in SEQ ID NO:39; and (ii) a transmembrane domain
- a chimeric antigen receptor comprising: (i) an antibody region comprising: (a) a light chain variable domain comprising a CDR LI as set forth in SEQ ID NO:46, a CDR L2 as set forth in SEQ ID NO:47 and a CDR L3 as set forth in SEQ ID NO:48; and (b) a heavy chain variable region domain comprising a CDR HI as set forth in SEQ ID NO:43, a CDR H2 as set forth in SEQ ID NO:44, and a CDR H3 as set forth in SEQ ID NO:45; and (ii) a transmembrane domain.
- Embodiment 120 The chimeric antigen receptor of any one of embodiments 116 to 119, further comprising an intracellular T-cell signaling domain.
- Embodiment 121 The chimeric antigen receptor of embodiments 116 to 120, wherein the intracellular T-cell signaling domain is a CD3 z intracellular T-cell signaling domain.
- Embodiment 122 The chimeric antigen receptor of any one of embodiments 116 to 121, further comprising an intracellular co-stimulatory T-cell signaling domain.
- Embodiment 123 The chimeric antigen receptor of embodiment 122, wherein said intracellular co-stimulatory signaling domain is a CD28 intracellular co-stimulatory signaling domain, a 4-1BB intracellular co-stimulatory signaling domain, a ICOS intracellular co stimulatory signaling domain, or an OX-40 intracellular co-stimulatory signaling domain.
- Embodiment 124 The chimeric antigen receptor of any one of embodiments 116 to 123, further comprising a spacer region.
- Embodiment 125 The chimeric antigen receptor of embodiment 124, wherein the spacer region further comprises a hinge region.
- Embodiment 126 The chimeric antigen receptor of any one of embodiments 116 to
- Embodiment 127 The chimeric antigen receptor of any one of embodiments 116 to
- Embodiment 128 A method of treating cancer in a subject in need thereof said method comprising, administering a therapeutically effective amount of a chimeric antigen receptor of any one of embodiments 116 to 127 to a subject.
- Embodiment 129 The method of embodiment 126, wherein said cancer is cancer is breast cancer, ovarian cancer, pancreatic cancer, cervical cancer, gastric cancer, renal cancer, head and neck cancer, bone cancer, skin cancer or prostate cancer.
- CDVPSCSPRDSS KMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTPQRRQLM
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Organic Chemistry (AREA)
- Epidemiology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Pathology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2020388577A AU2020388577A1 (en) | 2019-11-18 | 2020-11-18 | Anti-ROR-2 antibodies and methods of use |
| US17/777,591 US20230192846A1 (en) | 2019-11-18 | 2020-11-18 | Anti-ror-2 antibodies and methods of use |
| MX2022005949A MX2022005949A (es) | 2019-11-18 | 2020-11-18 | Anticuerpos anti-ror-2 y metodos de uso. |
| IL293026A IL293026A (en) | 2019-11-18 | 2020-11-18 | Anti-ror-2 antibodies and methods of using them |
| EP20889747.0A EP4061848A4 (en) | 2019-11-18 | 2020-11-18 | ANTI-ROR-2 ANTIBODIES AND METHODS OF USE |
| BR112022009611A BR112022009611A2 (pt) | 2019-11-18 | 2020-11-18 | Anticorpos anti-ror-2 e métodos de uso |
| CA3161617A CA3161617A1 (en) | 2019-11-18 | 2020-11-18 | Anti-ror-2 antibodies and methods of use |
| KR1020227019898A KR20220113951A (ko) | 2019-11-18 | 2020-11-18 | 항-ror-2 항체 및 사용 방법 |
| CN202080093841.5A CN116018353A (zh) | 2019-11-18 | 2020-11-18 | 抗ror-2抗体和使用方法 |
| JP2022528625A JP7734661B2 (ja) | 2019-11-18 | 2020-11-18 | 抗ror-2抗体および使用方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962936900P | 2019-11-18 | 2019-11-18 | |
| US62/936,900 | 2019-11-18 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021102055A1 true WO2021102055A1 (en) | 2021-05-27 |
Family
ID=75981012
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/061130 Ceased WO2021102055A1 (en) | 2019-11-18 | 2020-11-18 | Anti-ror-2 antibodies and methods of use |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20230192846A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4061848A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP7734661B2 (cg-RX-API-DMAC7.html) |
| KR (1) | KR20220113951A (cg-RX-API-DMAC7.html) |
| CN (1) | CN116018353A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2020388577A1 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112022009611A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3161617A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL293026A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2022005949A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2021102055A1 (cg-RX-API-DMAC7.html) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3953372A4 (en) * | 2019-03-26 | 2022-11-02 | The Regents of The University of California | Chimeric antigen receptor modified t-cells (car-t) for the treatment of hematological and solid tumor cancers |
| WO2023164618A1 (en) * | 2022-02-25 | 2023-08-31 | Bioatla, Inc. | Cancer treatment with a conditionally active anti-ror2 antibody-drug conjugate |
| WO2024145650A3 (en) * | 2022-12-30 | 2024-09-12 | The Regents Of The University Of California | Anti-ror-2 antibodies and methods of use |
| WO2025014830A1 (en) | 2023-07-07 | 2025-01-16 | Solve Therapeutics, Inc. | Conjugates of drug units and targeting units and precursor compounds thereof |
| WO2026011121A1 (en) | 2024-07-03 | 2026-01-08 | Solve Therapeutics, Inc. | Anti-ror2 antibody-drug conjugates |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN121181696A (zh) * | 2024-06-21 | 2025-12-23 | 深圳大学 | 一种治疗肿瘤的抗体及其应用 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008031009A2 (en) * | 2006-09-08 | 2008-03-13 | Genentech, Inc. | Wnt antagonists and their use in the diagnosis and treatment of wnt-mediated disorders |
| WO2016166297A1 (en) * | 2015-04-15 | 2016-10-20 | Van Berkel Patricius Hendrikus Cornelis | Site-specific antibody-drug conjugates |
| WO2017197234A1 (en) * | 2016-05-13 | 2017-11-16 | Bioatla, Llc | Anti-ror2 antibodies, antibody fragments, their immunoconjugates and uses thereof |
| WO2017218707A2 (en) * | 2016-06-14 | 2017-12-21 | Xencor, Inc. | Bispecific checkpoint inhibitor antibodies |
| US20190031754A1 (en) * | 2016-01-20 | 2019-01-31 | The Scripps Research Institute | Ror2 antibody compositions and related methods |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP7280827B2 (ja) * | 2017-01-18 | 2023-05-24 | エクスマ バイオテック コーポレイション | Axlまたはror2に対するキメラ抗原受容体およびその使用方法 |
| US11447546B2 (en) | 2017-07-20 | 2022-09-20 | Nbe-Therapeutics Ag | Human antibodies binding to ROR2 |
-
2020
- 2020-11-18 WO PCT/US2020/061130 patent/WO2021102055A1/en not_active Ceased
- 2020-11-18 EP EP20889747.0A patent/EP4061848A4/en active Pending
- 2020-11-18 KR KR1020227019898A patent/KR20220113951A/ko active Pending
- 2020-11-18 JP JP2022528625A patent/JP7734661B2/ja active Active
- 2020-11-18 CN CN202080093841.5A patent/CN116018353A/zh active Pending
- 2020-11-18 AU AU2020388577A patent/AU2020388577A1/en active Pending
- 2020-11-18 MX MX2022005949A patent/MX2022005949A/es unknown
- 2020-11-18 US US17/777,591 patent/US20230192846A1/en active Pending
- 2020-11-18 CA CA3161617A patent/CA3161617A1/en active Pending
- 2020-11-18 BR BR112022009611A patent/BR112022009611A2/pt unknown
- 2020-11-18 IL IL293026A patent/IL293026A/en unknown
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008031009A2 (en) * | 2006-09-08 | 2008-03-13 | Genentech, Inc. | Wnt antagonists and their use in the diagnosis and treatment of wnt-mediated disorders |
| WO2016166297A1 (en) * | 2015-04-15 | 2016-10-20 | Van Berkel Patricius Hendrikus Cornelis | Site-specific antibody-drug conjugates |
| US20190031754A1 (en) * | 2016-01-20 | 2019-01-31 | The Scripps Research Institute | Ror2 antibody compositions and related methods |
| WO2017197234A1 (en) * | 2016-05-13 | 2017-11-16 | Bioatla, Llc | Anti-ror2 antibodies, antibody fragments, their immunoconjugates and uses thereof |
| WO2017218707A2 (en) * | 2016-06-14 | 2017-12-21 | Xencor, Inc. | Bispecific checkpoint inhibitor antibodies |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4061848A4 * |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3953372A4 (en) * | 2019-03-26 | 2022-11-02 | The Regents of The University of California | Chimeric antigen receptor modified t-cells (car-t) for the treatment of hematological and solid tumor cancers |
| WO2023164618A1 (en) * | 2022-02-25 | 2023-08-31 | Bioatla, Inc. | Cancer treatment with a conditionally active anti-ror2 antibody-drug conjugate |
| WO2024145650A3 (en) * | 2022-12-30 | 2024-09-12 | The Regents Of The University Of California | Anti-ror-2 antibodies and methods of use |
| WO2025014830A1 (en) | 2023-07-07 | 2025-01-16 | Solve Therapeutics, Inc. | Conjugates of drug units and targeting units and precursor compounds thereof |
| WO2026011121A1 (en) | 2024-07-03 | 2026-01-08 | Solve Therapeutics, Inc. | Anti-ror2 antibody-drug conjugates |
Also Published As
| Publication number | Publication date |
|---|---|
| CN116018353A (zh) | 2023-04-25 |
| MX2022005949A (es) | 2022-08-02 |
| JP2023502108A (ja) | 2023-01-20 |
| BR112022009611A2 (pt) | 2022-08-09 |
| CA3161617A1 (en) | 2021-05-27 |
| KR20220113951A (ko) | 2022-08-17 |
| EP4061848A1 (en) | 2022-09-28 |
| JP7734661B2 (ja) | 2025-09-05 |
| AU2020388577A1 (en) | 2022-06-02 |
| EP4061848A4 (en) | 2024-03-20 |
| US20230192846A1 (en) | 2023-06-22 |
| IL293026A (en) | 2022-07-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230081443A1 (en) | Anti-il1rap antibodies | |
| AU2021200091B2 (en) | Chimeric antigen receptor compositions | |
| JP7734661B2 (ja) | 抗ror-2抗体および使用方法 | |
| US20240117047A1 (en) | Monoclonal antibodies specific for human ror1 | |
| US20240400686A1 (en) | Anti-cd3 antibodies and uses thereof | |
| WO2016004383A1 (en) | Tumor-selective ctla-4 antagonists | |
| US20250353924A1 (en) | Anti-cd84 antibodies and uses thereof | |
| EP4236997A1 (en) | Bispecific anti-cd38-cd3 binders | |
| US12617845B2 (en) | SMC1A antibodies and uses thereof | |
| US20250027945A1 (en) | Anti-related-to-receptor tyrosine kinase (ryk) antibodies and uses thereof | |
| US20240317873A1 (en) | Anti-hvem antibodies | |
| EP4642808A2 (en) | Anti-ror-2 antibodies and methods of use | |
| US20230340089A1 (en) | Smc1a antibodies and uses thereof | |
| US20250361315A1 (en) | Humanized anti-cd84 recombinant protein compositions | |
| WO2025235952A1 (en) | Humanized anti-cd84 antibodies | |
| HK40115498A (zh) | 抗-cd84抗体以及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20889747 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3161617 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022528625 Country of ref document: JP Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022009611 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2020388577 Country of ref document: AU Date of ref document: 20201118 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020889747 Country of ref document: EP Effective date: 20220620 |
|
| ENP | Entry into the national phase |
Ref document number: 112022009611 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220517 |