WO2021084063A1 - Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells - Google Patents
Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells Download PDFInfo
- Publication number
- WO2021084063A1 WO2021084063A1 PCT/EP2020/080494 EP2020080494W WO2021084063A1 WO 2021084063 A1 WO2021084063 A1 WO 2021084063A1 EP 2020080494 W EP2020080494 W EP 2020080494W WO 2021084063 A1 WO2021084063 A1 WO 2021084063A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- antibody
- antibody fragment
- administered
- combination
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/32—T-cell receptors [TCR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
Definitions
- Anti-Tumor combination therapy comprising anti-CD19 antibody and gamma delta T-cells
- the present disclosure is directed to a combination therapy comprising an anti-CD19 antibody or antibody fragment thereof and gamma delta T-cells (gd T-cells) for use in the treatment of leukemia or lymphoma.
- gd T-cells gamma delta T-cells
- CD19 is a 95-kDa transmembrane glycoprotein of the immunoglobulin superfamily containing two extracellular immunoglobulin-like domains and an extensive cytoplasmic tail.
- the protein is a pan-B lymphocyte surface receptor and is ubiquitously expressed from the earliest stages of pre-B cell development onwards until it is down-regulated during terminal differentiation into plasma cells. It is B-lymphocyte lineage specific and not expressed on hematopoietic stem cells and other immune cells, except some follicular dendritic cells.
- CD19 functions as a positive regulator of B cell receptor (BCR) signalling and is important for B cell activation and proliferation and in the development of humoral immune responses.
- BCR B cell receptor
- CD19 acts as a co-stimulatory molecule in conjunction with CD21 and CD81 and is critical for B cell responses to T-cell-dependent antigens.
- the cytoplasmic tail of CD19 is physically associated with a family of tyrosine kinases that trigger downstream signalling pathways via the src-family of protein tyrosine kinases.
- CD19 is an attractive target for cancers of lymphoid origin since it is highly expressed in nearly all-chronic lymphocytic leukemia (CLL) and non-Hodgkin’s lymphomas (NHL), as well as many other different types of leukemias, including acute lymphocytic leukemia (ALL) and hairy cell leukemia (HCL).
- Tafasitamab (former names: MOR00208 and XmAb ® 5574) is a humanized monoclonal antibody that targets the antigen CD19, a transmembrane protein involved in B-cell receptor signalling. Tafasitamab has been engineered in the IgG Fc-region to enhance antibody- dependent cell-mediated cytotoxicity (ADCC), thus improving a key mechanism for tumor cell killing and offering potential for enhanced efficacy compared to conventional antibodies, i.e. non-enhanced antibodies. Tafasitamab has or is currently being studied in several clinical trials, such as in CLL, ALL and NHL. In some of those trials, Tafasitamab is used in combination with Idelalisib, Lenalidomide or Venetoclax.
- ADCC antibody- dependent cell-mediated cytotoxicity
- the present disclosure provides a novel combination for use in the treatment of cancer, comprising an antibody or antibody fragment specific for CD19 and gd T-cells.
- gd T-cells are important players in infections and also malignancies such as cancer.
- Activated gd T-cells have powerful cytotoxic and broad tumor recognition abilities independent of major histocompatibility complex (MHC) molecules being present on their target cells.
- MHC major histocompatibility complex
- gd T-cells were shown to be potent mediators of antibody dependent cell-mediated cytotoxicity (ADCC).
- ADCC antibody dependent cell-mediated cytotoxicity
- the anti-tumor effect of gd T-cells can be reinforced substantially by anti-CD20 antibodies (Tokuyama et al. 2008; Hoeres et al. 2018).
- the Fc-enhanced anti-CD20 antibody Obinutuzumab shows increased tumor cell killing compared to non-Fc-enhanced antibodies like Rituximab when combined with gd T-cells.
- the object of the present disclosure is to provide an alternative combined therapy that comprises an antibody and gd T-cells.
- the present disclosure provides a combination for use in the treatment of cancer, comprising an antibody or antibody fragment specific for CD19 and gd T-cells.
- the inventors have combined gd T-cells with the CD19- targeting antibodies Tafasitamab (Fc-enhanced) and Xmab5603 (non-Fc-enhanced) and evaluated their anti-tumor activity in patient derived CLL, MCL and B-ALL samples as well as various lymphoma and leukemia cell lines in ADCC assays.
- gd T-cells are a potential effector cell population in antibody based tumor therapy as demonstrated for the Fc-enhanced CD 19-targeting antibody Tafasitamab in this study.
- Tafasitamab showed strong anti-tumor activity mediated by gd T- cells towards several lymphoma and leukemia cell lines as well as primary patient-derived CLL, MCL and BALL cells and may hold a promising approach for lymphoma and leukemia therapy.
- the gd T-cells can be derived from any suitable autologous or allogeneic gd T-cell or population thereof.
- suitable gd T-cells for use as a source for the presently described gd T-cells include V61 cells, V62 cells, V53 cells, V65 cells, and V68 cells.
- V61 cells, V62 cells, V53 cells, V65 cells, and V68 cells include V61 cells, V62 cells, V53 cells, V65 cells, and V68 cells.
- nd1 cells can be isolated from human skin biopsies as described in US2018/0312808, which is hereby incorporated by reference in its entirety and specifically for methods of isolating ⁇ /d1 cells from tissue.
- suitable gd T-cells can be derived from blood (e.g., peripheral blood).
- blood e.g., peripheral blood.
- Methods of isolating and expanding ⁇ /d1 cells from blood include those described, for example, in U S. Patent No. 9,499,788 and International Patent Publication No. WO2016/198480, each of which is incorporated herein by reference in its entirety.
- Vy9V52 T-cells can be isolated from peripheral blood and further cultivated ex vivo. Cultivation of Vy9V62 T-cells can be optimized in the presence of IL-2 and zoledronic acid (ZOL).
- ZOL zoledronic acid
- suitable gd T-cells can be derived from tumor tissue (e.g., tumor-infiltrating gd T-cells).
- suitable gd T-cells that can be engineered to express a heterologous targeting construct can be derived from non-haematopoietic tissue according to methods described below. These cells can be cultured in the presence of one or more factors (e.g., TCR agonists, co-receptor agonists, and/or cytokines, e.g., IL-4, IL-1 5, and/or IFN-g) in gas-permeable bioreactor bags for up to 21 days or more.
- factors e.g., TCR agonists, co-receptor agonists, and/or cytokines, e.g., IL-4, IL-1 5, and/or IFN-g
- V61 T cells can alternatively be obtained using methods described, for example, in International Patent Publications WO2017/197347 and W02016/081518 (US Publ. No. 2016/0175338), each of which is incorporated herein by reference in its entirety.
- the present disclosure provides a pharmaceutical combination, comprising an antibody or antibody fragment specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer.
- a pharmaceutical combination comprising an antibody or antibody fragment specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer.
- the present disclosure provides a pharmaceutical combination, comprising an antibody or antibody fragment specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer
- the antibody comprises a heavy chain variable region comprising an HCDR1 region comprising the sequence SYVMH (SEQ ID NO: 1), an HCDR2 region comprising the sequence NPYNDG (SEQ ID NO: 2), and an HCDR3 region comprising the sequence GTYYYGTRVFDY (SEQ ID NO: 3) and a light chain variable region comprising comprising the sequence LCDR1 region comprising the sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region comprising the sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region comprising the sequence MQHLEYPIT (SEQ ID NO: 6) for use in the treatment of cancer.
- the present disclosure provides a pharmaceutical combination, comprising an antibody or antibody fragment specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer
- the antibody comprises a heavy chain variable region comprising an HCDR1 region of SYVMH (SEQ ID NO: 1), an HCDR2 region of NPYNDG (SEQ ID NO: 2), and an HCDR3 region of GTYYYGTRVFDY (SEQ ID NO: 3) and a light chain variable region comprising an LCDR1 region of RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of MQHLEYPIT (SEQ ID NO: 6) for use in the treatment of cancer.
- the antibody or antibody fragment specific for CD19 comprises a heavy chain variable region of
- the antibody or antibody fragment specific for CD19 has effector function. In another aspect the antibody or antibody fragment specific for CD19 has an enhanced effector function. In one embodiment the effector function is ADCC. In one embodiment the antibody or antibody fragment specific for CD19 has an enhanced ADCC activity. In a further embodiment the antibody or antibody fragment specific for CD19 comprises an Fc domain comprising an amino acid substitution at position S239 and/or I332, wherein the numbering is according to the EU index as in Kabat.
- the antibody or antibody fragment specific for CD19 comprises a heavy chain constant region of
- the antibody specific for CD19 comprises a light chain constant region of
- the antibody specific for CD19 comprises a heavy chain constant region of
- the antibody specific for CD19 comprises a heavy chain region of EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPYNDGTKY NEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGTYYYGTRVFDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPDV FLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFR WSVLTWHQDWLNGKEYKCKVSNKALPAPEEKTISKTKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer wherein the gd T-cells comprise an enriched gd T-cell population.
- the enriched gd T-cell population comprises non-engineered or engineered gd T- cells and/or admixtures thereof.
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and an enriched gd T- cell population for use in the treatment of cancer.
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer wherein the gd T-cells comprise non-engineered or engineered gd T-cells and/or admixtures thereof.
- the gd T-cells are a population of non- engineered gd T-cells.
- the gd T-cells are a population of engineered gd T-cells.
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer wherein the gd T-cells are isolated from peripheral blood, tumor tissue or non-hematopoietic tissue.
- the gd T-cells are isolated from peripheral blood.
- the gd T-cells are a population of gd T-cells isolated from peripheral blood.
- the gd T-cells are a population of ⁇ /g9 ⁇ /d2 T-cells isolated from peripheral blood.
- the gd T-cells are a population of ⁇ /g9 ⁇ /d2 T-cells isolated from peripheral blood wherein the Vy9V62 T-cells were cultivated ex vivo in the presence of IL-1 and zoledronic acid (ZOL).
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer wherein the cancer is a hematological cancer.
- the hematological cancer is chronic lymphocytic leukemia (CLL), non-Hodgkin’s lymphoma (NHL), small lymphocytic lymphoma (SLL) or acute lymphoblastic leukemia (ALL).
- CLL chronic lymphocytic leukemia
- NHL non-Hodgkin’s lymphoma
- SLL small lymphocytic lymphoma
- ALL acute lymphoblastic leukemia
- NHL non-Hodgkin’s lymphoma
- non-Hodgkin’s lymphoma is selected from the group consisting of follicular lymphoma, small lymphocytic lymphoma, mucosa-associated lymphoid tissue, marginal zone lymphoma, diffuse large B cell lymphoma, Burkitt's lymphoma and mantle cell lymphoma.
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer, wherein the antibody specific for CD19 and the gd T-cells are administered in a separate manner.
- a pharmaceutical combination comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer, wherein the antibody specific for CD19 and the gd T-cells are administered in a separate manner.
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer, wherein the antibody specific for CD19 and the gd T-cells are administered in a simultaneous manner.
- a pharmaceutical combination comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer, wherein the antibody specific for CD19 and the gd T-cells are administered in a simultaneous manner.
- kit for use in the treatment of cancer comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell).
- FIG. 1 Representative ADCC assays of MOR00208 at increasing effector to target cell (E:T) ratios. Results for specific cell killing expressed as % dead target cells mediated by MOR00208 (black) or the lgG1 negative control (white) and gd T-cells from healthy donors are depicted for three target cell lines Mino, Daudi and Jeko . Four different E:T ratios between 0.7:1 and 20:1 were tested.
- Figure 2 Representative ADCC assays of MOR00208 at increasing effector to target cell (E:T) ratios.
- Results for specific cell killing expressed as % dead target cells mediated by MOR00208 (black) or the lgG1 control (white) and gd T-cells from healthy donors are depicted for three target cell lines U2932 and REH. Four different E:T ratios between 0.7:1 and 20:1 were tested.
- FIG. 3 Representative ADCC assays of MOR00208 at increasing effector to target cell (E:T) ratios using primary tumor cells from two CLL and one B-ALL patient as target cells. Results for specific cell killing expressed as % dead target cells mediated by MOR00208 (black) or the lgG1 control (white) and gd T-cells from healthy donors are depicted for three experiments using primary tumor cells as target cells. Four different E:T ratios between 0.7:1 and 20:1 were tested.
- E:T effector to target cell
- FIG. 4 Representative ADCC assays of MOR00208 at increasing effector to target cell (E:T) ratios using primary tumor cells from two MCL patients as target cells. Results for specific cell killing expressed as % dead target cells mediated by MOR00208 (black) or the lgG1 control (white) and gd T-cells from healthy donors are depicted for three experiments using primary tumor cells as target cells. Four different E:T ratios between 0.7:1 and 20:1 were tested.
- E:T effector to target cell
- CD19 refers to the protein known as CD19, having the following synonyms: B4, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, CVID3, Differentiation antigen CD19, GC12802, and T-cell surface antigen Leu-12.
- Human CD19 has the amino acid sequence of:
- MOR00208 and XmAb 5574” and “tafasitamab” are used as synonyms for the anti- CD19 antibody according to Table 1.
- Table 1 provides the amino acid sequences of MOR00208/ tafasitamb.
- the MOR00208 antibody is described in US patent application serial number 12/377,251 , which is incorporated by reference in its entirety.
- US patent application serial number 12/377,251 describes the antibody named 4G7 H1.52 Hybrid S239D/I332E/4G7 L1 .155 (later named MOR00208 and tafasitamab).
- antibody refers to a protein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, which interacts with an antigen.
- Each heavy chain is comprised of a variable heavy chain region (abbreviated herein as VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CH1 , CH2 and CH3.
- Each light chain is comprised of a variable light chain region (abbreviated herein as VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FR’s arranged from amino-terminus to carboxy-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, and FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- antibody includes for example, monoclonal antibodies, human antibodies, humanized antibodies, camelised antibodies and chimeric antibodies.
- the antibodies can be of any isotype (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2) or subclass. Both the light and heavy chains are divided into regions of structural and functional homology.
- antibody fragment refers to one or more portions of an antibody that retain the ability to specifically interact with (e.g., by binding, steric hindrance, stabilizing spatial distribution) an antigen.
- binding fragments include, but are not limited to, a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CH1 domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and an isolated complementarity determining region (CDR).
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
- F(ab)2 fragment a bivalent
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al., (1988) Science 242:423-426; and Huston et al., (1988) Proc. Natl. Acad. Sci. 85:5879-5883).
- single chain Fv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term “antibody fragment”.
- Antibody fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
- Antibody fragments can also be incorporated into single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, (2005) Nature Biotechnology 23:1126-1136).
- Antibody fragments can be grafted into scaffolds based on polypeptides such as Fibronectin type III (Fn3) (see U S. Pat. No. 6,703,199, which describes fibronectin polypeptide monobodies).
- Fn3 Fibronectin type III
- Antibody fragments can be incorporated into single chain molecules comprising a pair of tandem Fv segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen-binding sites (Zapata et al., (1995) Protein Eng. 8:1057-1062; and U S. Pat. No. 5,641 ,870).
- administering includes but is not limited to delivery of a drug by an injectable form, such as, for example, an intravenous, intramuscular, intraderm a I or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestible solution, capsule or tablet.
- an injectable form such as, for example, an intravenous, intramuscular, intraderm a I or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestible solution, capsule or tablet.
- the administration is by an injectable form.
- effector function refers to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype.
- antibody effector functions include C1q binding and complement dependent cytotoxicity (CDC); Fc receptor binding and antibody-dependent cell-mediated cytotoxicity (ADCC) and/or antibody-dependent cellular phagocytosis (ADCP); down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
- ADCC antibody-dependent cell-mediated cytotoxicity
- cytotoxic cells e.g. NK cells, neutrophils, and macrophages
- “Complement-dependent cytotoxicity” or “CDC” refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (C1q) to antibodies (of the appropriate subclass) of the present disclosure, which are bound to their cognate antigen.
- ADCP antibody-dependent cellular phagocytosis
- hematologic cancer includes blood-borne tumors and diseases or disorders involving abnormal cell growth and/or proliferation in tissues of hematopoietic origin, such as lymphomas, leukemias, and myelomas.
- Non-Hodgkin’s lymphoma (“NHL”) is a heterogeneous malignancy originating from lymphocytes. In the United States (U.S.), the incidence is estimated at 65,000/year with mortality of approximately 20,000 (American Cancer Society, 2006; and SEER Cancer Statistics Review). The disease can occur in all ages, the usual onset begins in adults over 40 years, with the incidence increasing with age. NHL is characterized by a clonal proliferation of lymphocytes that accumulate in the lymph nodes, blood, bone marrow and spleen, although any major organ may be involved.
- the current classification system used by pathologists and clinicians is the World Health Organization (WHO) Classification of Tumours, which organizes NHL into precursor and mature B-cell or T-cell neoplasms.
- WHO World Health Organization
- the PDQ is currently dividing NHL as indolent or aggressive for entry into clinical trials.
- the indolent NHL group is comprised primarily of follicular subtypes, small lymphocytic lymphoma, MALT (mucosa-associated lymphoid tissue), and marginal zone; indolent encompasses approximately 50% of newly diagnosed B-cell NHL patients.
- Aggressive NHL includes patients with histologic diagnoses of primarily diffuse large B cell (DLBL, “DLBCL ”, or DLCL) (40% of all newly diagnosed patients have diffuse large cell), Burkitt's, and mantle cell (“MCL”).
- DLBL diffuse large B cell
- DLBCL diffuse large B cell
- MCL mantle cell
- the clinical course of NHL is highly variable. A major determinant of clinical course is the histologic subtype. Most indolent types of NHL are considered to be incurable disease. Patients respond initially to either chemotherapy or antibody therapy and most will relapse. Studies to date have not demonstrated an improvement in survival with early intervention. In asymptomatic patients, it is acceptable to "watch and wait" until the patient becomes symptomatic or the disease pace appears to be accelerating. Over time, the disease may transform to a more aggressive histology.
- the median survival is 8 to 10 years, and indolent patients often receive 3 or more treatments during the treatment phase of their disease.
- Initial treatment of the symptomatic indolent NHL patient historically has been combination chemotherapy.
- the most commonly used agents include: cyclophosphamide, vincristine and prednisone (CVP); or cyclophosphamide, adriamycin, vincristine, prednisone (CHOP).
- CVP vincristine and prednisone
- CHOP cyclophosphamide, adriamycin, vincristine, prednisone
- Chronic lymphocytic leukemia also known as “chronic lymphoid leukemia” or “CLL”
- CLL chronic lymphocytic leukemia
- the malignant lymphocytes may look normal and mature, but they are not able to cope effectively with infection.
- CLL is the most common form of leukemia in adults. Men are twice as likely to develop CLL as women.
- the key risk factor is age. Over 75% of new cases are diagnosed in patients over age 50. More than 10,000 cases are diagnosed every year and the mortality is almost 5,000 a year (American Cancer Society, 2006; and SEER Cancer Statistics Review).
- CLL is an incurable disease but progresses slowly in most cases. Many people with CLL lead normal and active lives for many years. Because of its slow onset, early-stage CLL is generally not treated since it is believed that early CLL intervention does not improve survival time or quality of life. Instead, the condition is monitored over time.
- Initial CLL treatments vary depending on the exact diagnosis and the progression of the disease. There are dozens of agents used for CLL therapy. Combination chemotherapy regimens such as FCR (fludarabine, cyclophosphamide and rituximab), and BR (Ibrutinib and rituximab) are effective in both newly-diagnosed and relapsed CLL. Allogeneic bone marrow (stem cell) transplantation is rarely used as a first-line treatment for CLL due to its risk.
- SLL Small lymphocytic lymphoma
- CLL Small lymphocytic lymphoma
- the definition of SLL requires the presence of lymphadenopathy and/or splenomegaly.
- the number of B lymphocytes in the peripheral blood should not exceed 5 x 109/L.
- the diagnosis should be confirmed by histopathologic evaluation of a lymph node biopsy whenever possible (Hallek et al., 2008).
- the incidence of SLL is approximately 25% of CLL in the US (Dores et al., 2007).
- ALL acute lymphoblastic leukemia
- ALL is characterized by the overproduction and continuous multiplication of malignant and immature white blood cells (also known as lymphoblasts) in the bone marrow.
- Acute' refers to the undifferentiated, immature state of the circulating lymphocytes ("blasts"), and that the disease progresses rapidly with life expectancy of weeks to months if left untreated.
- ALL is most common in childhood with a peak incidence of 4-5 years of age. Children of age 12- 16 die more easily from it than others. Currently, at least 80% of childhood ALL are considered curable. Under 4,000 cases are diagnosed every year and the mortality is almost 1 ,500 a year (American Cancer Society, 2006; and SEER Cancer Statistics Review).
- Subject or “patient” as used in this context refers to any mammal, including rodents, such as mouse or rat, and primates, such as cynomolgus monkey (Macaca fascicularis), rhesus monkey (Macaca mulatta) or humans (Homo sapiens).
- rodents such as mouse or rat
- primates such as cynomolgus monkey (Macaca fascicularis), rhesus monkey (Macaca mulatta) or humans (Homo sapiens).
- the subject or patient is a primate, most preferably a human patient, even more preferably an adult human patient.
- engineered or “modified” as used herein includes manipulation of nucleic acids or polypeptides by synthetic means (e.g. by recombinant techniques, in vitro peptide synthesis, by enzymatic or chemical coupling of peptides or some combination of these techniques).
- the antibodies or antibody fragments according to the present disclosure are engineered or modified to improve one or more properties, such as antigen binding, stability, half-life, effector function, immunogenicity, safety and the like.
- the antibodies or antibody fragments according to the present disclosure are engineered or modified to improve effector function, such as ADCC.
- the "Fc region” is used to define the C-terminal region of an immunoglobulin heavy chain.
- the Fc region of an immunoglobulin generally comprises two constant domains, a CH2 domain and a CH3 domain.
- numbering of amino acid residues in the Fc region is according to the EU numbering system, also called the EU index, as described in Kabat et al. , Sequences of Proteins of Immunological Interest, 5 th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
- the antibody which is administered according to the present disclosure is administered to the patient in a therapeutically effective amount.
- a “therapeutically effective amount” refers to an amount sufficient to provide some improvement of the clinical manifestations of a given disease or disorder. The amount that is effective for a particular therapeutic purpose will depend on the severity of the disease or injury as well as on the weight and general state of the subject. It will be understood that determination of an appropriate dosage may be achieved, using routine experimentation, by constructing a matrix of values and testing different points in the matrix, all of which is within the ordinary skills of a trained physician or clinical scientist.
- a first therapy e.g., agent, such as an anti-CD19 antibody
- a first therapy may be administered before (e.g., 1 minute, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, or 12 weeks), concurrently, or after (e.g., 1 minute, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks
- gd T-cells gamma delta T-cells
- TCR T-cell receptor
- y6TCR T-cell receptor
- the term "gd T-cells” specifically includes all subsets of gd T-cells, including, without limitation, nd1 , nd2, nd3 and Vy9V62 T-cells, as well as naive, effector memory, central memory, and terminally differentiated gd T-cells.
- gd T-cells includes nd4, nd5, nd7, and nd8 T cells.
- T lymphocyte or "T-cell” refers to an immune cell expressing CD3 (CD3+) and a T Cell Receptor (TCR+). T cells play a central role in cell- mediated immunity.
- TCR or "T cell receptor” refers to a dimeric heterologous cell surface signaling protein forming an alpha-beta or gamma-delta receptor. a TCR recognize an antigen presented by an MHC molecule, whereas y5TCR recognize an antigen independently of MHC presentation.
- the term "cell population" refers to a number of cells.
- a cell population may be, for example, a mixed cell population derived from a peripheral blood sample, a cord blood sample, a tumor, a stem cell precursor, a tumor biopsy, a tissue, a lymph, or from epithelial sites of a subject directly contacting the external milieu, or derived from stem precursor cells.
- the mixed cell population may be derived from in vitro cultures of mammalian cells, established from a peripheral blood sample, a cord blood sample, a tumor, a stem cell precursor, a tumor biopsy, a tissue, a lymph, or from epithelial sites of a subject directly contacting the external milieu, or derived from stem precursor cells.
- An "enriched" cell population or preparation refers to a cell population derived from a starting mixed cell population that contains a greater percentage of a specific cell type than the percentage of that cell type in the starting population.
- a starting mixed cell population can be enriched for a specific gd T-cell population.
- the enriched gd T-cell population contains a lesser percentage of ab T-cell populations.
- expansion as used herein is meant that the number of the desired or target cell type (e.g., d1 , d2 T-cells and/or ⁇ /g9 ⁇ /d2 T-cells) in the enriched preparation is higher than the number in the initial or starting cell population.
- desired or target cell type e.g., d1 , d2 T-cells and/or ⁇ /g9 ⁇ /d2 T-cells
- CD19 antibody in non-specific B cell lymphomas is discussed in W02007076950 (US2007154473), which are both incorporated by reference.
- CD19 antibody in CLL, NHL and ALL is described in Scheuermann et al., CD19 Antigen in Leukemia and Lymphoma Diagnosis and Immunotherapy, Leukemia and Lymphoma, Vol. 18, 385-397 (1995), which is incorporated by reference in its entirety.
- W02005012493 (US7109304), WO20 10053716 (US12/266,999) (Immunomedics); W02007002223 (US US8097703) (Medarex); W02008022152 (12/377,251) and W02008150494 (Xencor), W02008031056 (US11/852,106) (Medimmune); WO 2007076950 (US 11/648,505 ) (Merck Patent GmbH); WO 2009/052431 (US12/253,895) (Seattle Genetics); and WO2010095031 (12/710,442)
- a pharmaceutical composition includes an active agent, e.g. an antibody for therapeutic use in humans.
- a pharmaceutical composition may additionally include pharmaceutically acceptable carriers or excipients.
- the dose of an antibody or antibody fragment comprised in a pharmaceutical composition according to the present disclosure administered to a patient may vary depending upon the age and the size of the patient, symptoms, conditions, route of administration, and the like.
- the dose is typically calculated according to body weight, or body surface area, age, or per individual.
- Effective dosages and schedules for administering pharmaceutical compositions comprising antibodies or antibody fragments specific for CD19 may be determined empirically; for example, patient progress can be monitored by periodic assessment, and the dose adjusted accordingly.
- interspecies scaling of dosages can be performed using well-known methods in the art (e.g., Mordenti et al., 1991 , Pharmaceut. Res. 8:1351).
- the pharmaceutical composition may include dosage forms for intravenous, subcutaneous, intracutaneous and intramuscular injections, etc.
- injectable preparations may be prepared by known methods.
- the injectable preparations may be prepared, e.g., by dissolving, suspending or emulsifying the antibody or its salt described above in a sterile aqueous medium or an oily medium conventionally used for injections.
- Exemplary pharmaceutical compositions comprising an antibody or antibody fragment specific for CD19 that can be used in the context of the present disclosure are disclosed, e.g., in W02008/022152 or WO2018/002031 .
- intravenous administration it is preferred to administer drug depending on the body weight of the patient.
- other ways of administration e.g. subcutaneous administration, it is preferred to administer drug at a flat, fixed does.
- the skilled person is aware of which dose in one way of administration is equivalent to another dose in another way of administration.
- the pharmacodynamics of a specific drug are typically taken into account in a reasoned decision to administer a drug in the required from and at a required, efficacious dose.
- the antibody which is administered according to the present disclosure is administered to the patient in a therapeutically effective amount.
- a “therapeutically effective amount” refers to an amount sufficient to cure, alleviate or partially arrest the clinical manifestations of a given disease or disorder, i.e. NHL, and its complications.
- the antibodies of the present disclosure are administered at 9 mg/kg.
- the antibodies of the present disclosure are administered at 12 mg/kg.
- the antibodies of the present disclosure are administered at 15 mg/kg or more.
- the antibody of the present disclosure can be administered at different time points and the treatment cycle may have a different length.
- the antibodies may be administered daily, every other day, three times a week, weekly or biweekly.
- the antibodies may also be administered over at least four weeks, over at least five weeks, over at least six weeks, over at least seven weeks, over at least eight weeks, over at least nine weeks, over at least ten weeks, over at least eleven weeks or over at least twelve weeks.
- the antibody is administered at least once weekly over at least eight weeks.
- the gd T-cells of the present disclosure are derived from blood (e.g., peripheral blood) of a subject.
- gd T-cells may be derived from blood-derived V62 cells or blood-derived V61 cells.
- gd T-cells may be derived from blood-derived Vy9V62 T-cells.
- Vy9V62 T-cells can be isolated from peripheral blood and further cultivated ex vivo. Cultivation of Vy9V62 T-cells can be optimized in the presence of IL- 2 and zoledronic acid (ZOL).
- ZOL zoledronic acid
- Vy9V62 T cells derived from peripheral blood Peripheral blood is collected from donors. PBMC are isolated immediately via density gradient centrifugation using LymphoprepTM (Axis Shield, Norway) following manufacturer’s instructions.
- PBMCs to be resuspended to 1 c 10 6 /ml_ in CTSTM OpTmizerTM T Cell Expansion SFM (Life Technologies, Australia) supplemented with OpTmizerTM T cell Expansion Supplement (1 :38 dilution) (Life Technologies, Australia), 10% heat-inactivated FBS (HI-FBS), 100 ILI/mL penicillin, 100 pg/nriL streptomycin, 2 mmol L-glutamine (Life Technologies, Australia), 25 mM HEPES, 0.1% b- mercaptoethanol (Sigma-Aldrich, USA), 100 lU/mL recombinant human interleukin 2 (rhlL-2) (BD Pharmingen, USA) and activated with 5 mM ZOL, and seeded into 6-well plates.
- HI-FBS heat-inactivated FBS
- ILI/mL penicillin 100 pg/nriL streptomycin, 2 mmol L-glu
- Cell culture density to be maintained at 1-2 c 10 6 cells/mL and replenished with fresh medium containing 100 lU/mL rhlL-2 only (without ZOL) every 2-3 days. Following 7-8 days of culture cells were collected and enriched as described below.
- Ex vivo expanded Vy9V52 T cells are enriched using negative selection MACS with the TCR g/d+ T cell Isolation Kit (human) (Miltenyi Biotec, Germany). Cell viability and total cells numbers after enrichment are assessed using trypan blue exclusion. Percentage of Vy9V62 T cells are determined by flow cytometry using PeCy5 conjugated anti-CD3 (clone UCHT 1 ) (eBioscience, San Diego, CA, USA) and FITC conjugated anti-Vy9 TCR from BD Biosciences (San Jose, CA, USA). Percentages of ⁇ /g9 ⁇ /d2 T cells are identified by gating on the lymphocyte population using forward scatter/side scatter then on Vy9+ CD3+ double positive cells.
- peripheral blood mononuclear cells can be obtained from a subject according to any suitable method known in the art.
- PBMCs can be cultured in the presence of aminobisphosphonates (e.g., zoledronic acid), synthetic phosphoantigens (e.g., bromohydrin pyrophosphate; BrHPP), 2M3B1 PP, or 2-methyl-3-butenyl-1- pyrophosphate in the presence of IL-2 for one-to-two weeks to generate an enriched population of V62 cells.
- aminobisphosphonates e.g., zoledronic acid
- synthetic phosphoantigens e.g., bromohydrin pyrophosphate; BrHPP
- 2M3B1 PP 2-methyl-3-butenyl-1- pyrophosphate
- immobilized anti-TCR gd can induce preferential expansion of V62 cells from a population of PBMCs in the presence of IL-2, e.g., for approximately 14 days.
- preferential expansion of V62 cells from PBMCs can be achieved upon culture of immobilized anti-CD3 antibodies (e.g., OKT3) in the presence of IL-2 and IL-4.
- the aforementioned culture is maintained for about seven days prior to subculture in soluble anti-CD3, IL-2, and IL-4.
- artificial antigen presenting cells can be used to promote preferential expansion of gd T cells, such as V62 cells.
- PBMC-derived gd T-cells cultured in the presence of irradiated aAPC, IL-2, and/or IL-21 can expand to generate a population of gd T cells including a high proportion of V62 cells, moderate proportion of V61 cells, and some double negative cells.
- PBMCs can be pre-enriched or post-enriched (e.g. through positive selection with TCRyd- specific agents or negative selection of TCRa - specific agents).
- TCRyd- specific agents e.g. through positive selection with TCRyd- specific agents or negative selection of TCRa - specific agents.
- PBMCs are pre-enriched using magnetic bead sorting, which can yield greater than 90% gd T cells.
- Non-haematopoietic tissue-resident gd T cells obtained as described herein exhibit good tumor penetration and retention capabilities. More detailed methods for isolation and expansion of non-haematopoietic tissue-resident gd T cells can be found, for example, in GB Application No. 1707048.3 (WO2018/202808) and in International Patent Publication No. WO 2017/072367 (US Publ. No. 2018/0312808), each of which is incorporated herein by reference in its entirety.
- Non-haematopoietic tissue-resident gd T cells can be isolated from any human or non-human animal non-haematopoietic tissue that can be removed from a patient to obtain cells suitable for engineering according to the methods of the present invention.
- the non-haematopoietic tissue from which the gd T cells are derived and expanded is skin (e.g., human skin), which can be obtained by methods known in the art.
- the skin is obtained by punch biopsy.
- the methods of isolation and expansion of gd T cells provided herein can be applied to the gastrointestinal tract (e.g., colon), mammary gland, lung, prostate, liver, spleen, and pancreas.
- the gd T cells may also be resident in human cancer tissues, e.g., tumors of the breast or prostate.
- the gd T cells may be from human cancer tissues (e.g., solid tumor tissues).
- the gd T cells may be from non-haematopoietic tissue other than human cancer tissue (e.g., a tissue without a substantial number of tumor cells).
- the gd T cells may be from a region of skin (e.g., healthy skin) separate from a nearby or adjacent cancer tissue.
- the gd T cells that are dominant in the blood are primarily V62 T cells, while the gd T cells that are dominant in the non-haematopoietic tissues are primarily V61 T cells, such that V61 T cells include about 70-80% of the non-haematopoietic tissue-resident gd T cell population.
- some V62 T cells are also found in non-haematopoietic tissues, e.g. in the gut, where they can include about 10-20% of gd T cells.
- gd T cells that are resident in non-haematopoietic tissues express neither V61 nor ⁇ /d2 TCR and we have named them double negative (DN) gd T cells. These DN gd T cells are likely to be mostly V63-expressing with a minority of V65-expressing T cells. Therefore, the gd T cells that are ordinarily resident in non-haematopoietic tissues and that are expanded by the method of the invention are preferably h oh- ⁇ /d2 T cells, e.g. V61 T cells, with the inclusion of a smaller amount of DN gd T cells.
- non-haematopoietic tissue-resident gd T cells are capable of spontaneously expanding upon removal of physical contact with stromal cells (e.g., skin fibroblasts).
- stromal cells e.g., skin fibroblasts
- the scaffold- based culture methods described above can be used to induce such separation, resulting in de repression of the gd T cells to trigger expansion.
- no substantial TCR pathway activation is present during the expansion step (e.g., no exogenous TCR pathway activators are included in the culture).
- the invention provides methods of expanding non-haematopoietic tissue-resident gd T cells, wherein the methods do not involve contact with feeder cells, tumor cells, and/or antigen-presenting cells.
- compositions containing a non-engineered, enriched gd T-cell population, an engineered, enriched gd T-cell population, and/or admixtures thereof, as described herein may be administered for prophylactic and/or therapeutic treatments.
- the compositions can be administered to a subject already suffering from a disease or condition in an amount sufficient to cure or at least partially arrest the symptoms of the disease or condition.
- a non-engineered, enriched gd T-cell population, an engineered, enriched gd T-cell population, and/or admixtures thereof, can also be administered to lessen a likelihood of developing, contracting, or worsening a condition.
- Effective amounts of a population of a non-engineered, enriched gd T-cell population, an engineered, enriched gd T-cell population, and/or admixtures thereof, for therapeutic use can vary based on the severity and course of the disease or condition, previous therapy, the subject's health status, weight, and/or response to the drugs, and/or the judgment of the treating physician.
- a non-engineered, enriched gd T-cell population, an engineered, enriched gd T-cell population, and /or admixtures thereof, of the disclosure can be used to treat a subject in need of treatment for a condition.
- a method of treating a condition in a subject with an enriched gd T-cell population and an antibody or antibody fragment specific for CD19 of the present disclosure may comprise administering to the subject a therapeutically-effective amount of a non-engineered, enriched gd T-cell population, an engineered, enriched gd T-cell population, and/or admixtures thereof.
- An enriched gd T-cell population, and/or admixtures thereof, of the disclosure may be administered at various regimens (e.g., timing, concentration, dosage, spacing between treatment, and/or formulation).
- a subject can also be preconditioned with, for example, chemotherapy, radiation, or a combination of both, prior to receiving a an enriched gd T-cell population and/or admixtures thereof, of the disclosure.
- a non- engineered, enriched gd T-cell population, an engineered, enriched gd T-cell population, and/or admixtures thereof may be administered to a subject at a first regimen and the subject may be monitored to determine whether the treatment at the first regimen meets a given level of therapeutic efficacy.
- An enriched gd T-cell population i.e. , non-engineered or engineered, and/or admixtures thereof, of the disclosure may be used to treat various conditions.
- a non-engineered, enriched gd T-cell population, an engineered, enriched gd T-cell population, and/or admixtures thereof, of the disclosure may be used to treat a cancer, including solid tumors and hematologic cancer.
- One or multiple non-engineered, enriched gd T-cell population, engineered, enriched gd T-cell population, and/or admixtures thereof, of the invention can be administered to a subject in any order or simultaneously. If simultaneously, the multiple non-engineered, enriched gd T-cell population, engineered, enriched gd T-cell population, and/or admixtures thereof, of the invention can be provided in a single, unified form, such as an intravenous injection, or in multiple forms, for example, as multiple intravenous infusions, s.c, injections or pills.
- the non-engineered, enriched gd T-cell population, engineered, enriched gd T-cell population, and/or admixtures thereof, of the invention can be packed together or separately, in a single package or in a plurality of packages.
- One or all of the non-engineered, enriched gd T-cell population, engineered, enriched gd T-cell population, and/or admixtures thereof, of the invention can be given in multiple doses. If not simultaneous, the timing between the multiple doses may vary to as much as about a week, a month, two months, three months, four months, five months, six months, or about a year.
- a non-engineered, enriched gd T-cell population, an engineered, enriched gd T-cell population, and/or admixtures thereof, of the invention can expand within a subject's body, in vivo, after administration to a subject.
- Non- engineered, enriched gd T-cell population, engineered, enriched gd T-cell population, and/or admixtures thereof, can be frozen to provide cells for multiple treatments with the same cell preparation.
- Non-engineered, enriched gd T-cell population, engineered, enriched gd T-cell population, and/or admixtures thereof, of the disclosure, and pharmaceutical compositions comprising the same can be packaged as a kit.
- a kit may include instructions (e.g., written instructions) on the use of the non-engineered, enriched gd T-cell population, the engineered, enriched gd T-cell population, and/or admixtures thereof, and compositions comprising the same.
- a method of treating a cancer comprises administering to a subject a therapeutically-effective amount of a non-engineered, enriched gd T-cell population, an engineered, enriched gd T-cell population, and/or admixtures thereof, wherein the administration treats the cancer.
- the therapeutically-effective amount of the non-engineered, enriched gd T-cell population, the engineered, enriched gd T-cell population, and/or admixtures thereof is administered for at least about 10 seconds, 30 seconds, 1 minute, 10 minutes, 30 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, d hours, 12 hours, 24 hours, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, or 1 year.
- the therapeutically-effective amount of the non-engineered, enriched gd T-cell population, the engineered, enriched gd T-cell population, and/or admixtures thereof is administered for at least one week. In some embodiments the therapeutically-effective amount of the non- engineered, enriched gd T-cell population, the engineered, enriched gd T-cell population, and/or admixtures thereof, is administered for at least two weeks.
- Embodiments The present disclosure provides a pharmaceutical combination, comprising an antibody or antibody fragment specific for CD19 and gamma delta T-cells (gd T-cells) for use in the treatment of cancer.
- a pharmaceutical combination comprising an antibody or antibody fragment specific for CD19 and gamma delta T-cells (gd T-cells) for use in the treatment of cancer.
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer wherein the gd T-cells comprise an enriched gd T-cell population.
- the enriched gd T-cell population comprises non-engineered or engineered gd T- cells and/or admixtures thereof.
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and an enriched gd T- cell population for use in the treatment of cancer.
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer wherein the gd T-cells comprise non-engineered or engineered gd T-cells and/or admixtures thereof.
- the gd T-cells are a population of non- engineered gd T-cells.
- the gd T-cells are a population of engineered gd T-cells.
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer wherein the gd T-cells are isolated from peripheral blood, tumor tissue or non-hematopoietic tissue.
- the gd T-cells are isolated from peripheral blood.
- the gd T-cells are a population of gd T-cells isolated from peripheral blood.
- the present disclosure provides a pharmaceutical combination, comprising an antibody specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer wherein the cancer is a hematological cancer.
- the hematological cancer is chronic lymphocytic leukemia (CLL), non-Hodgkin’s lymphoma (NHL), small lymphocytic lymphoma (SLL) or acute lymphoblastic leukemia (ALL).
- CLL chronic lymphocytic leukemia
- NHL non-Hodgkin’s lymphoma
- SLL small lymphocytic lymphoma
- ALL acute lymphoblastic leukemia
- NHL non-Hodgkin’s lymphoma
- non-Hodgkin’s lymphoma is selected from the group consisting of follicular lymphoma, small lymphocytic lymphoma, mucosa-associated lymphoid tissue, marginal zone lymphoma, diffuse large B cell lymphoma, Burkitt's lymphoma and mantle cell lymphoma.
- the present disclosure provides a pharmaceutical combination, comprising an antibody or antibody fragment specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer wherein said antibody or antibody fragment specific for CD19 is administered at 9 mg/kg.
- said antibody or antibody fragment specific for CD19 is administered at 12 mg/kg. In yet other embodiments at 15 mg/kg or more.
- the antibody or antibody fragment specific for CD19 has a cytotoxic activity. In embodiments, the antibody or antibody fragment specific for CD19 comprises a constant region having ADCC inducing activity. In embodiments, the antibody specific for CD19 induces ADCC.
- the present disclosure provides a pharmaceutical combination, comprising an antibody or antibody fragment specific for CD19 and gamma delta T-cells (gd T-cells) for use in the treatment of cancer wherein the components of the combination, the antibody or antibody fragment specific for CD19 and the gd T-cells are administered separately.
- the gd T-cells are administered prior to administration of the antibody or antibody fragment specific for CD19.
- the the antibody or antibody fragment specific for CD19 are administered prior to administration of the the gd T-cells.
- the components of the combination are administered at a time where both components (drugs) are active in the patient at the same time.
- both drugs are active in the patient at the same time.
- the components of the combination are administered together, simultaneously, separately or subsequently, either physically or in time. In embodiments, the components of the combination are administered simultaneously.
- the present disclosure provides a pharmaceutical combination, comprising an antibody or antibody fragment specific for CD19 and gd T-cells for use in the treatment of cancer wherein the anti-CD19 antibody is administered weekly, bi-weekly or monthly.
- the present disclosure provides a pharmaceutical combination, comprising an antibody or antibody fragment specific for CD19 and gd T-cells for use in the treatment of cancer wherein said antibody or antibody fragment specific for CD19 is administered in a concentration of 12mg/kg.
- the present disclosure provides a pharmaceutical combination, comprising an antibody or antibody fragment specific for CD19 and gd T-cells for use in the treatment of cancer wherein said antibody or antibody fragment specific for CD19 is administered weekly, bi-weekly or monthly after a first administration on Day 1 and wherein the BCL-2 inhibitor is administered for the first time on Day 8.
- the anti-CD19 antibody or antibody fragment thereof after a first administration on Day 1 is administered weekly for the first 3 months and bi-weekly for at least the next 3 months.
- the present disclosure provides an anti-CD19 antibody or antibody fragment thereof for use in the treatment of hematological cancer patients, wherein said hematologic cancer patient has non-Hodgkin's lymphoma and wherein said anti-CD19 antibody or antibody fragment thereof is administered in combination with gd T-cells.
- the present disclosure provides an anti-CD19 antibody or antibody fragment thereof for use in the treatment of hematological cancer patients, wherein said hematologic cancer patient has non-Hodgkin's lymphoma and wherein said anti-CD19 antibody or antibody fragment thereof is administered in combination with gd T-cells.
- the hematological cancer patient has non-Hodgkin's lymphoma, wherein the non- Hodgkin’s lymphoma is selected from the group consisting of follicular lymphoma, small lymphocytic lymphoma, mucosa-associated lymphoid tissue, marginal zone lymphoma, diffuse large B cell lymphoma, Burkitt's lymphoma and mantle cell lymphoma.
- the anti-CD19 antibody or antibody fragment thereof for use in the treatment of hematological cancer patients in combination with gd T-cells comprises an HCDR1 region comprising the sequence SYVMH (SEQ ID NO: 1), an HCDR2 region comprising the sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region comprising the sequence GT Y Y Y GT RVF D Y (SEQ ID NO: 3), an LCDR1 region comprising the sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region comprising the sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region comprising the sequence MQHLEYPIT (SEQ ID NO. 6).
- the anti-CD19 antibody or antibody fragment thereof for use in the treatment of hematological cancer patients in combination with gd T-cells comprises a variable heavy chain of the sequence
- GQGTLVTVSS (SEQ ID NO: 7) and a variable light chain of the sequence DIVMTQSPATLSLSPGERATLSCRSSKSLQNVNGNTYLYWFQQKPGQSPQLLIYRM SNLNSGVPDRFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYPITFGAGTKLEIK (SEQ ID NO: 8).
- the anti-CD19 antibody or antibody fragment thereof is a human, humanized or chimeric antibody or antibody fragment.
- the anti-CD19 antibody or antibody fragment thereof is of the IgG isotype.
- the antibody or antibody fragment is lgG1 , lgG2 or lgG1/lgG2 chimeric.
- the isotype of the anti- CD19 antibody is engineered to enhance antibody-dependent cell-mediated cytotoxicity.
- the heavy chain constant region of the anti-CD19 antibody comprises amino acids 239D and 332E, wherein the Fc numbering is according to the EU index as in Kabat.
- the antibody is lgG1 , lgG2 or lgG1/lgG2 and the chimeric heavy chain constant region of the anti-CD19 antibody comprises amino acids 239D and 332E, wherein the Fc numbering is according to the EU index as in Kabat.
- the anti-CD19 antibody for use in the treatment of hematological cancer patients in combination with gd T-cells comprises a heavy chain having the sequence
- the anti-CD19 antibody or antibody fragment thereof for use in the treatment of hematological cancer patients in combination with gd T-cells comprises a variable heavy chain of the sequence
- DIVMTQSPATLSLSPGERATLSCRSSKSLQNVNGNTYLYWFQQKPGQSPQLLIYRM SNLNSGVPDRFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYPITFGAGTKLEIK (SEQ ID NO: 8) or a variable heavy chain and and a variable light chain that has at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to the variable heavy chain of SEQ ID NO: 7 and to the variable light chain of SEQ ID NO: 8.
- the anti-CD 19 antibody or antibody fragment thereof for use in the treatment of hematological cancer patients in combination with gd T-cells comprises a variable heavy chain of the sequence
- the heavy chain region of the anti-CD19 antibody comprises amino acids 239D and 332E, wherein the Fc numbering is according to the EU index as in Kabat.
- the anti-CD19 antibody or antibody fragment thereof for use in the treatment of hematological cancer patients in combination with gd T-cells comprises a heavy chain having the sequence
- the anti-CD19 antibody or antibody fragment thereof for use in the treatment of hematological cancer patients in combination with gd T-cells comprises a heavy chain having the sequence
- the anti-CD19 antibody comprises an HCDR1 region comprising the sequence SYVMH (SEQ ID NO: 1), an HCDR2 region comprising the sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region comprising the sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region comprising the sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region comprising the sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region comprising the sequence MQHLEYPIT (SEQ ID NO: 6).
- the heavy chain region of the anti-CD19 antibody comprises amino acids 239D and 332E, wherein the
- the present disclosure provides an anti-CD19 antibody or antibody fragment thereof wherein said anti-CD 19 antibody or antibody fragment thereof is administered in a concentration of 12mg/kg.
- the anti-CD19 antibody or antibody fragment thereof is administered weekly, bi-weekly or monthly. In a further embodiment the anti-CD19 antibody or antibody fragment thereof is administered weekly for the first 3 months and bi-weekly for at least the next 3 months. In a further embodiment, the anti-CD19 antibody or antibody fragment thereof is administered weekly for the first 3 months. In a further embodiment the anti-CD19 antibody or antibody fragment thereof is administered weekly for the first 3 months and biweekly for at least the next 3 months. In another embodiment the anti-CD19 antibody or antibody fragment thereof is administered weekly for the first 3 months, bi-weekly for the next 3 months and monthly thereafter. In yet another embodiment the anti-CD19 antibody or antibody fragment thereof is administered weekly for the first 3 months, bi-weekly for the next 3 months and monthly thereafter.
- the present disclosure provides an antibody or antibody fragment specific for CD19 for use in the treatment of cancer wherein said antibody or antibody fragment specific for CD19 is administered in combination with gd T-cells.
- the gd T-cells are isolated from peripheral blood, tumor tissue or non-hematopoietic tissue.
- the gd T-cells are isolated from peripheral blood.
- the gd T-cells are a population of gd T-cells isolated from peripheral blood.
- the gd T-cells are a population of gd T-cells isolated from peripheral blood and cultivated in the presence of IL-2 and ZOL.
- the gd T-cells are a population of blood-derived ⁇ /g9 ⁇ /d2 T- cells.
- the present disclosure provides an antibody or antibody fragment specific for CD19 for use in the treatment of cancer wherein said antibody or antibody fragment specific for CD19 is administered in combination with gd T-cells wherein the step of administering is carried out by administering the antibody specific for CD19 and the gd T-cells in combination in a simultaneous, in order, or in reverse-order manner.
- the present disclosure provides the use of a pharmaceutical combination comprising an antibody or antibody fragment specific for CD19 and gd T-cells for preparing a medicament for treatment of cancer.
- the present disclosure provides a method for use in the treatment of cancer, comprising a step of administering, to a subject, an antibody specific for CD19 and an gd T-cells in combination.
- the present disclosure provides a method for use in the treatment of cancer, comprising a step of administering, to a subject, an antibody specific for CD19 and an gd T-cells in combination wherein the step of administering is carried out by administering the antibody specific for CD19 and the gd T-cells in combination in a simultaneous, in order, or in reverse-order manner.
- the present disclosure provides a pharmaceutical combination, comprising an antibody or antibody fragment specific for CD19 and gamma delta T-cells (gd T-cell) for use in the treatment of cancer wherein the gd T-cells are administered in a therapeutically effective amount.
- a therapeutically effective amount of lymphocytes e.g., gd T cells
- a subject e.g., for treatment of cancer such as hematologic cancer.
- the therapeutically effective amount of lymphocytes is less than 10 x 10 12 cells per dose (e.g., less than 9 x 10 12 cells per dose, less than 8 x 10 12 cells per dose, less than 7 x 10 12 cells per dose, less than 6 x 10 12 cells per dose, less than 5 x 10 12 cells per dose, less than 4 x 10 12 cells per dose, less than 3 x 10 12 cells per dose, less than 2 x 10 12 cells per dose, less than 1 x 10 12 cells per dose, less than 9 x 10 11 cells per dose, less than 8 x 10 11 cells per dose, less than 7 x 10 11 cells per dose, less than 6 x 10 11 cells per dose, less than 5 x 10 11 cells per dose, less than 4 x 10 11 cells per dose, less than 3 x 10 11 cells per dose, less than 2 x 10 11 cells per dose, less than 1 x 10 11 cells per dose, less than 9 x 10 10 10 cells per dose, less than 7.5
- the therapeutically effective amount of gd T-cells is less than 10 x 10 12 cells over the course of treatment (e.g., less than 9 x 10 12 cells, less than 8 x 10 12 cells, less than 7 x 10 12 cells, less than 6 x 10 12 cells, less than 5 x 10 12 cells, less than 4 x 10 12 cells, less than 3 x 10 12 cells, less than 2 x 10 12 cells, less than 1 x 10 12 cells, less than 9 x 10 11 cells, less than 8 x 10 11 cells, less than 7 x 10 11 cells, less than 6 x 10 11 cells, less than 5 x 10 11 cells, less than 4 x 10 11 cells, less than 3 x 10 11 cells, less than 2 x 10 11 cells, less than 1 x 10 11 cells, less than 9 x 10 10 cells, less than 7.5 x 10 10 cells, less than 5 x 10 10 cells, less than 2.5
- a dose of gd T-cells as described herein includes about 1 x 10 ® , 1.1 x 10 ® , 2 x 10 ® , 3.6 x 10 ® , 5 x 10 ® , 1 x 10 7 , 1.8 x 10 7 , 2 x 10 7 , 5 x 10 7 , 1 x 10 ® , 2 x 10 ® , or 5 x 10 ® cells/kg.
- a dose of gd T-cells as described herein includes at least 1 x 10 ® , 1.1 x 10 ® , 2 x 10 ® , 3.6 x 10 ® , 5 x 10 ® , 1 x 10 7 , 1.8 x 10 7 , 2 x 10 7 , 5 x 10 7 , 1 x 10 ® , 2 x 10 ® , or 5 x 10 ® cells/kg.
- a dose of gd T-cells as described herein includes up to 1 x 10 ® , 1.1 x 10 ® , 2 x 10 ® , 3.6 x 10 ® , 5 x 10 ® , 1 x 10 7 , 1.8 x 10 7 , 2 x 10 7 , 5 x 10 7 , 1 x 10 ® , 2 x 10 ® , or 5 x 10 ® cells/kg.
- the present disclosure provides an anti-CD19 antibody or antibody fragment thereof in combination with gd T-cells for use in the treatment of hematological cancer wherein said anti- CD19 antibody or antibody fragment thereof and gd T-cells are administered in combination with one or more pharmaceutical agents.
- said anti-CD19 antibody or antibody fragment thereof and gd T-cells are administered in combination with a pharmaceutical agent.
- said anti-CD19 antibody or antibody fragment thereof and gd T-cells are administered in combination with one or more additional pharmaceutical agents or an additional pharmaceutical agent.
- said pharmaceutical agent is an additional pharmaceutical agent.
- said pharmaceutical agent is a biologic or a chemotherapeutic agent.
- said pharmaceutical agent is a therapeutic antibody or antibody fragment, a nitrogen mustard, a purine analog, a thalidomide analog, a phosphoinositide 3-kinase inhibitor, a BCL-2 inhibitor or a bruton's tyrosine kinase (BTK) inhibitor.
- said pharmaceutical agent is rituximab, R-CHOP, cyclophosphamide, chlorambucil, uramustine, ifosfamide, melphalan, bendamustine, mercaptopurine, azathioprine, thioguanine, fludarabine, thalidomide, lenalidomide, pomalidomide, idelalisib, duvelisib, copanlisib, ibrutinib or venetoclax.
- the present disclosure provides an anti-CD19 antibody or antibody fragment thereof and gd T-cells for use in the treatment of hematological cancer wherein said anti-CD19 antibody or antibody fragment thereof and gd T-cells are administered in combination with rituximab, R-CHOP, cyclophosphamide, chlorambucil, uramustine, ifosfamide, melphalan, bendamustine, mercaptopurine, azathioprine, thioguanine, fludarabine, thalidomide, lenalidomide, pomalidomide, idelalisib, duvelisib, copanlisib, ibrutinib or venetoclax.
- This study was performed to evaluate the cytotoxic activity of the Fc-enhanced anti-CD19 antibody tafasitamab (MOR00208) mediated by gd T-cells from different donors on lymphoma and leukemia cell lines as well as primary patient-derived tumor material from CLL (Chronic Lymphocytic Leukemia), MCL (Mantle Cell Lymphoma) and B-ALL (Acute Lymphoblastic Leukemia). Furthermore, the antibody dependent cell-mediated cytotoxic activity of Tafasitamab in the presence of gd T-cells was evaluated.
- CLL Choronic Lymphocytic Leukemia
- MCL Mantle Cell Lymphoma
- B-ALL Acute Lymphoblastic Leukemia
- Different lymphoma and leukemia cell lines as well as patient-derived primary tumor cells from lymphoma and leukemia patients were evaluated in an antibody dependent cell-mediated cytotoxicity (ADCC) assay with various concentrations of tafasitamab and an lgG1 negative control antibody.
- the gd T-cells were isolated from seven different donors and were used as effector cells at different effector to target cell ratios (E:T ratios 0.7:1 , 2.2:1 , 6.7:1 and 20:1).
- gd T-cells express Vy and N/d variable chains as part of a T-cell receptor (TCR) complex that is structurally and functionally distinctive from the major histocompatibility complex (MHC) binding TCR of ab T-cells.
- TCR T-cell receptor
- MHC major histocompatibility complex
- the V62 chain is preferentially paired with the Vy9 chain.
- the Vy9V62 T-cells account for approximately 5% of peripheral blood T-cells, representing the dominant gd T-cell subpopulation in this compartment gd T-cells from 7 different donors were isolated, stimulated and applied as listed in the following:
- the stimulated cell population used for the described experiments consisted of three main populations. Only a very small portion of CD56+/CD3- NK effector cells was present ( ⁇ 5%), while TCRy6neg/CD3+ cells represented a bigger population in some cases, but these cells do not trigger lysis of target cells. Therefore, mainly the gd T-cells were responsible for antibody-mediated cell killing.
- Mino Mantle cell lymphoma
- Daudi Burkitt’s lymphoma
- Jeko-1 Mantle cell lymphoma
- U2932 U2932
- REH B-ALL
- 2x CLL Choronic Lymphocytic Leukemia
- 2x MCL Mantle Cell Lymphoma
- 1x B-ALL Acute Lymphoblastic Leukemia
- Cell lysis showed gd T-cell dependent donor variations with maximal lysis between 34.0 % and 49.3 % for Jeko and 22.5 % for U2392 cells, respectively.
- a concentration of 1 pg/ml of MOR00208 (Fc-enhanced) was selected as the optimal concentration for further comprehensive analyses of the Fc-dependent effect of antibody-mediated cell killing by gd T- cells towards leukemia and lymphoma cell lines and patient derived tumor cells.
- gd T-cells turned out to be a potential effector cell population in antibody based tumor therapy as demonstrated for the Fc-enhanced CD19-targeting antibody MOR00208 in this study.
- MOR00208 showed strong anti-tumor activity mediated by the presence of gd T-cells towards several lymphoma and leukemia cell lines as well as primary patient-derived CLL, MCL and B-ALL cells and provides a sound rational for combining MOR00208 and gd T-cells as a promising approach for lymphoma and leukemia therapy.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Hematology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Developmental Biology & Embryology (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- Virology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (22)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP25217971.8A EP4706673A2 (en) | 2019-10-31 | 2020-10-30 | Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells |
| RS20251350A RS67602B1 (sr) | 2019-10-31 | 2020-10-30 | Kombinovana antitumorska terapija koja sadrži anti-cd19 antitelo i gama delta t-ćelije |
| IL292213A IL292213A (en) | 2019-10-31 | 2020-10-30 | Combination anti-tumor therapy including anti-cd19 antibody and gamma delta t cells |
| MX2022005033A MX2022005033A (es) | 2019-10-31 | 2020-10-30 | Terapia combinada antitumoral que comprende un anticuerpo anti grupo de diferenciación 19 (cd19) y linfocitos t gamma delta. |
| KR1020227018073A KR20220116154A (ko) | 2019-10-31 | 2020-10-30 | 항-cd19 항체 및 감마 델타 t-세포를 포함하는 항-종양 병용 요법 |
| PL20800121.4T PL4051710T3 (pl) | 2019-10-31 | 2020-10-30 | Przeciwnowotworowa terapia skojarzona zawierająca przeciwciało anty-cd19 i komórki t gamma delta |
| AU2020372646A AU2020372646A1 (en) | 2019-10-31 | 2020-10-30 | Anti-tumor combination therapy comprising anti-CD19 antibody and gamma delta T-cells |
| LTEPPCT/EP2020/080494T LT4051710T (lt) | 2019-10-31 | 2020-10-30 | Priešnavikinė kompleksinė terapija, apimanti anti-cd19 antikūną ir gama delta ląsteles |
| PH1/2022/551009A PH12022551009A1 (en) | 2019-10-31 | 2020-10-30 | Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells |
| DK20800121.4T DK4051710T3 (da) | 2019-10-31 | 2020-10-30 | Antitumor-kombinationsterapi bestående af anti-cd19-antistof og gamma-delta-t-celler |
| HRP20251630TT HRP20251630T1 (hr) | 2019-10-31 | 2020-10-30 | Kombinirana antitumorska terapija koja obuhvaća anti-cd19 protutijelo i gama-delta t stanice |
| ES20800121T ES3062643T3 (en) | 2019-10-31 | 2020-10-30 | Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells |
| JP2022525535A JP7688025B2 (ja) | 2019-10-31 | 2020-10-30 | 抗cd19抗体及びガンマデルタt細胞を含む抗腫瘍併用療法 |
| CN202080090109.2A CN115151565A (zh) | 2019-10-31 | 2020-10-30 | 包含抗CD19抗体和γδT细胞的抗肿瘤组合疗法 |
| MDE20220968T MD4051710T2 (ro) | 2019-10-31 | 2020-10-30 | Terapie antitumorală combinată care cuprinde un anticorp anti-CD19 și celule T gamma-delta |
| SI202030692T SI4051710T1 (sl) | 2019-10-31 | 2020-10-30 | Protitumorsko kombinirano zdravljenje, ki obsega protitelo proti cd-19 in gamadelta t-celice |
| EP20800121.4A EP4051710B1 (en) | 2019-10-31 | 2020-10-30 | Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells |
| SM20260082T SMT202600082T1 (it) | 2019-10-31 | 2020-10-30 | Terapia combinata anti-tumorale comprendente anticorpo anti-cd19 e cellule t gamma delta |
| MA69251A MA69251B1 (fr) | 2019-10-31 | 2020-10-30 | Thérapie combinée antitumorale comprenant un anticorps anti-cd19 et des cellules t gamma delta |
| CA3158984A CA3158984C (en) | 2019-10-31 | 2020-10-30 | Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells |
| FIEP20800121.4T FI4051710T3 (fi) | 2019-10-31 | 2020-10-30 | Kasvainta estävä yhdistelmähoito, joka käsittää cd19-vasta-ainetta ja gamma-delta-t-soluja |
| JP2025085318A JP2025134705A (ja) | 2019-10-31 | 2025-05-22 | 抗cd19抗体及びガンマデルタt細胞を含む抗腫瘍併用療法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP19206479 | 2019-10-31 | ||
| EP19206479.8 | 2019-10-31 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021084063A1 true WO2021084063A1 (en) | 2021-05-06 |
Family
ID=68424789
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2020/080494 Ceased WO2021084063A1 (en) | 2019-10-31 | 2020-10-30 | Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells |
Country Status (23)
| Country | Link |
|---|---|
| US (1) | US20210130461A1 (https=) |
| EP (2) | EP4706673A2 (https=) |
| JP (2) | JP7688025B2 (https=) |
| KR (1) | KR20220116154A (https=) |
| CN (1) | CN115151565A (https=) |
| AU (1) | AU2020372646A1 (https=) |
| DK (1) | DK4051710T3 (https=) |
| ES (1) | ES3062643T3 (https=) |
| FI (1) | FI4051710T3 (https=) |
| HR (1) | HRP20251630T1 (https=) |
| IL (1) | IL292213A (https=) |
| LT (1) | LT4051710T (https=) |
| MA (1) | MA69251B1 (https=) |
| MD (1) | MD4051710T2 (https=) |
| MX (1) | MX2022005033A (https=) |
| PH (1) | PH12022551009A1 (https=) |
| PL (1) | PL4051710T3 (https=) |
| PT (1) | PT4051710T (https=) |
| RS (1) | RS67602B1 (https=) |
| SI (1) | SI4051710T1 (https=) |
| SM (1) | SMT202600082T1 (https=) |
| TW (1) | TWI883067B (https=) |
| WO (1) | WO2021084063A1 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12194095B2 (en) | 2015-08-21 | 2025-01-14 | Incyte Corporation | Combinations and uses thereof |
| US12358983B2 (en) | 2016-10-28 | 2025-07-15 | Incyte Corporation | Combination of anti CD19 antibody with a BCL-2 inhibitor and uses thereof |
| US12491244B2 (en) | 2018-09-12 | 2025-12-09 | GC Cell Corporation | Pharmaceutical combinations for treating tumor comprising anti-CD19 antibody and natural killer cell |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102617497B1 (ko) | 2022-09-15 | 2023-12-27 | 주식회사 엘지에너지솔루션 | 음극용 자성 정렬 장치 및 이를 이용한 음극의 제조방법 |
Citations (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US6703199B1 (en) | 1997-06-12 | 2004-03-09 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| WO2005012493A2 (en) | 2003-07-31 | 2005-02-10 | Immunomedics, Inc. | Anti-cd19 antibodies |
| WO2007002223A2 (en) | 2005-06-20 | 2007-01-04 | Medarex, Inc. | Cd19 antibodies and their uses |
| US20070154473A1 (en) | 2005-12-30 | 2007-07-05 | Merck Patent Gmbh | Anti-CD19 antibodies with reduced immunogenicity |
| WO2008022152A2 (en) | 2006-08-14 | 2008-02-21 | Xencor, Inc. | Optimized antibodies that target cd19 |
| WO2008031056A2 (en) | 2006-09-08 | 2008-03-13 | Medimmune, Llc | Humanized anti-cd19 antibodies and their use in treatment of oncology, transplantation and autoimmune disease |
| WO2008150494A1 (en) | 2007-05-30 | 2008-12-11 | Xencor, Inc. | Methods and compositions for inhibiting cd32b expressing cells |
| WO2009052431A2 (en) | 2007-10-19 | 2009-04-23 | Seattle Genetics, Inc. | Cd19 binding agents and uses thereof |
| WO2010053716A1 (en) | 2008-11-07 | 2010-05-14 | Immunomedics, Inc. | Improved anti-cd19 antibodies |
| WO2010095031A2 (en) | 2009-02-23 | 2010-08-26 | Glenmark Pharmaceuticals S.A. | Humanized antibodies that bind to cd19 and their uses |
| WO2011147834A1 (en) | 2010-05-26 | 2011-12-01 | Roche Glycart Ag | Antibodies against cd19 and uses thereof |
| WO2012010562A1 (en) | 2010-07-19 | 2012-01-26 | International - Drug - Development - Biotech | Anti-cd19 antibody having adcc and cdc functions and improved glycosylation profile |
| WO2012010561A1 (en) | 2010-07-19 | 2012-01-26 | International - Drug - Development - Biotech | Anti-cd19 antibody having adcc function with improved glycosylation profile |
| WO2012156455A1 (en) | 2011-05-17 | 2012-11-22 | Sanofi | Use of anti-cd19 maytansinoid immunoconjugate antibody for the treatment of b-cell malignancies symptoms |
| WO2016081518A2 (en) | 2014-11-17 | 2016-05-26 | Adicet Bio, Inc. | Engineered gamma delta t-cells |
| US20160175338A1 (en) | 2010-10-28 | 2016-06-23 | Shire Viropharma Incorporated | Maribavir isomers, compositions, methods of making and methods of using |
| US9499788B2 (en) | 2011-05-19 | 2016-11-22 | Instituto De Medicina Molecular | Cell line of lymphocytes comprising gamma-delta T cells, composition and production method thereof |
| WO2016198480A1 (en) | 2015-06-09 | 2016-12-15 | Lymphact - Lymphocyte Activation Technologies, S.A. | Methods for the production of tcr gamma delta+ t cells |
| WO2017072367A1 (en) | 2015-10-30 | 2017-05-04 | Cancer Research Technology Limited | EXPANSION OF NON-HAEMATOPOIETIC TISSUE-RESIDENT γδ T CELLS AND USES OF THESE CELLS |
| WO2017197347A1 (en) | 2016-05-12 | 2017-11-16 | Adicet Bio, Inc. | METHODS FOR SELECTIVE EXPANSION OF γδ T-CELL POPULATIONS AND COMPOSITIONS THEREOF |
| WO2018002031A1 (en) | 2016-06-27 | 2018-01-04 | Morphosys Ag | Anti-cd19 antibody formulations |
| WO2018202808A2 (en) | 2017-05-03 | 2018-11-08 | King's College, London | Expansion of gamma delta t cells, compositions, and methods of use thereof |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2015277516A1 (en) * | 2014-06-16 | 2016-12-22 | Xencor, Inc. | Treatment for chronic lymphocytic leukemia (CLL) |
| LT3302550T (lt) * | 2015-05-26 | 2019-11-11 | Morphosys Ag | Anti-cd19 antikūno ir brutono tirozino kinazės inhibitoriaus derinys ir jo naudojimas |
| WO2018081648A2 (en) * | 2016-10-29 | 2018-05-03 | Genentech, Inc. | Anti-mic antibidies and methods of use |
| TWI687227B (zh) * | 2017-10-03 | 2020-03-11 | 生倍科技股份有限公司 | 用於t細胞免疫療法之組合及其用途 |
-
2020
- 2020-10-30 CN CN202080090109.2A patent/CN115151565A/zh active Pending
- 2020-10-30 PL PL20800121.4T patent/PL4051710T3/pl unknown
- 2020-10-30 JP JP2022525535A patent/JP7688025B2/ja active Active
- 2020-10-30 FI FIEP20800121.4T patent/FI4051710T3/fi active
- 2020-10-30 AU AU2020372646A patent/AU2020372646A1/en active Pending
- 2020-10-30 MX MX2022005033A patent/MX2022005033A/es unknown
- 2020-10-30 SM SM20260082T patent/SMT202600082T1/it unknown
- 2020-10-30 EP EP25217971.8A patent/EP4706673A2/en active Pending
- 2020-10-30 EP EP20800121.4A patent/EP4051710B1/en active Active
- 2020-10-30 PT PT208001214T patent/PT4051710T/pt unknown
- 2020-10-30 KR KR1020227018073A patent/KR20220116154A/ko active Pending
- 2020-10-30 LT LTEPPCT/EP2020/080494T patent/LT4051710T/lt unknown
- 2020-10-30 WO PCT/EP2020/080494 patent/WO2021084063A1/en not_active Ceased
- 2020-10-30 SI SI202030692T patent/SI4051710T1/sl unknown
- 2020-10-30 RS RS20251350A patent/RS67602B1/sr unknown
- 2020-10-30 US US17/084,783 patent/US20210130461A1/en active Pending
- 2020-10-30 IL IL292213A patent/IL292213A/en unknown
- 2020-10-30 MD MDE20220968T patent/MD4051710T2/ro unknown
- 2020-10-30 TW TW109137982A patent/TWI883067B/zh active
- 2020-10-30 ES ES20800121T patent/ES3062643T3/es active Active
- 2020-10-30 DK DK20800121.4T patent/DK4051710T3/da active
- 2020-10-30 MA MA69251A patent/MA69251B1/fr unknown
- 2020-10-30 PH PH1/2022/551009A patent/PH12022551009A1/en unknown
- 2020-10-30 HR HRP20251630TT patent/HRP20251630T1/hr unknown
-
2025
- 2025-05-22 JP JP2025085318A patent/JP2025134705A/ja active Pending
Patent Citations (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US6703199B1 (en) | 1997-06-12 | 2004-03-09 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| WO2005012493A2 (en) | 2003-07-31 | 2005-02-10 | Immunomedics, Inc. | Anti-cd19 antibodies |
| US7109304B2 (en) | 2003-07-31 | 2006-09-19 | Immunomedics, Inc. | Humanized anti-CD19 antibodies |
| US8097703B2 (en) | 2005-06-20 | 2012-01-17 | Medarex, Inc. | CD19 antibodies and their uses |
| WO2007002223A2 (en) | 2005-06-20 | 2007-01-04 | Medarex, Inc. | Cd19 antibodies and their uses |
| WO2007076950A1 (en) | 2005-12-30 | 2007-07-12 | Merck Patent Gmbh | Anti-cd19 antibodies with reduced immunogenicity |
| US20070154473A1 (en) | 2005-12-30 | 2007-07-05 | Merck Patent Gmbh | Anti-CD19 antibodies with reduced immunogenicity |
| WO2008022152A2 (en) | 2006-08-14 | 2008-02-21 | Xencor, Inc. | Optimized antibodies that target cd19 |
| WO2008031056A2 (en) | 2006-09-08 | 2008-03-13 | Medimmune, Llc | Humanized anti-cd19 antibodies and their use in treatment of oncology, transplantation and autoimmune disease |
| WO2008150494A1 (en) | 2007-05-30 | 2008-12-11 | Xencor, Inc. | Methods and compositions for inhibiting cd32b expressing cells |
| WO2009052431A2 (en) | 2007-10-19 | 2009-04-23 | Seattle Genetics, Inc. | Cd19 binding agents and uses thereof |
| WO2010053716A1 (en) | 2008-11-07 | 2010-05-14 | Immunomedics, Inc. | Improved anti-cd19 antibodies |
| WO2010095031A2 (en) | 2009-02-23 | 2010-08-26 | Glenmark Pharmaceuticals S.A. | Humanized antibodies that bind to cd19 and their uses |
| WO2011147834A1 (en) | 2010-05-26 | 2011-12-01 | Roche Glycart Ag | Antibodies against cd19 and uses thereof |
| WO2012010562A1 (en) | 2010-07-19 | 2012-01-26 | International - Drug - Development - Biotech | Anti-cd19 antibody having adcc and cdc functions and improved glycosylation profile |
| WO2012010561A1 (en) | 2010-07-19 | 2012-01-26 | International - Drug - Development - Biotech | Anti-cd19 antibody having adcc function with improved glycosylation profile |
| US20160175338A1 (en) | 2010-10-28 | 2016-06-23 | Shire Viropharma Incorporated | Maribavir isomers, compositions, methods of making and methods of using |
| WO2012156455A1 (en) | 2011-05-17 | 2012-11-22 | Sanofi | Use of anti-cd19 maytansinoid immunoconjugate antibody for the treatment of b-cell malignancies symptoms |
| US9499788B2 (en) | 2011-05-19 | 2016-11-22 | Instituto De Medicina Molecular | Cell line of lymphocytes comprising gamma-delta T cells, composition and production method thereof |
| WO2016081518A2 (en) | 2014-11-17 | 2016-05-26 | Adicet Bio, Inc. | Engineered gamma delta t-cells |
| WO2016198480A1 (en) | 2015-06-09 | 2016-12-15 | Lymphact - Lymphocyte Activation Technologies, S.A. | Methods for the production of tcr gamma delta+ t cells |
| WO2017072367A1 (en) | 2015-10-30 | 2017-05-04 | Cancer Research Technology Limited | EXPANSION OF NON-HAEMATOPOIETIC TISSUE-RESIDENT γδ T CELLS AND USES OF THESE CELLS |
| US20180312808A1 (en) | 2015-10-30 | 2018-11-01 | Cancer Research Technology Limited | Expansion of non-haematopoietic tissue-resident gamma delta t cells and uses of these cells |
| WO2017197347A1 (en) | 2016-05-12 | 2017-11-16 | Adicet Bio, Inc. | METHODS FOR SELECTIVE EXPANSION OF γδ T-CELL POPULATIONS AND COMPOSITIONS THEREOF |
| WO2018002031A1 (en) | 2016-06-27 | 2018-01-04 | Morphosys Ag | Anti-cd19 antibody formulations |
| WO2018202808A2 (en) | 2017-05-03 | 2018-11-08 | King's College, London | Expansion of gamma delta t cells, compositions, and methods of use thereof |
Non-Patent Citations (15)
| Title |
|---|
| ALMEIDA ET AL., CLINICAL CANCER RESEARCH, vol. 22, no. 23, 2016, pages 5795 - 5805 |
| ANNA CAPSOMIDIS ET AL: "Chimeric Antigen Receptor-Engineered Human Gamma Delta T Cells: Enhanced Cytotoxicity with Retention of Cross Presentation", MOLECULAR THERAPY : THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 26, no. 2, 1 February 2018 (2018-02-01), US, pages 354 - 365, XP055590617, ISSN: 1525-0016, DOI: 10.1016/j.ymthe.2017.12.001 * |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| DENIGER ET AL., FRONTIERS IN IMMUNOLOGY, vol. 636, no. 5, 2014, pages 1 - 10 |
| HOERES T ET AL: "Improving the efficiency of V[gamma]9V[delta]2 T-cell immunotherapy in cancer", FRONTIERS IN IMMUNOLOGY, FRONTIERS RESEARCH FOUNDATION, CH, vol. 9, no. APR, 19 April 2018 (2018-04-19), pages 1 - 18, XP002797164, ISSN: 1664-3224 * |
| HOLLINGERHUDSON, NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 1126 - 1136 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI., vol. 85, 1988, pages 5879 - 5883 |
| JONATHAN FISHER ET AL: "Engineering Approaches in Human Gamma Delta T Cells for Cancer Immunotherapy", FRONTIERS IN IMMUNOLOGY, vol. 9, 26 June 2018 (2018-06-26), XP055564688, DOI: 10.3389/fimmu.2018.01409 * |
| JUNG HYUN HER, 9 December 2019 (2019-12-09), XP055688839, Retrieved from the Internet <URL:https://www.morphosys.de/sites/default/files/downloads/functional_characterization_of_gamma_delta_t_cells_and_allogeneic_activated_nk_cells_as_effector_cells_for_tafasitamab_mor208.pdf> [retrieved on 20200423] * |
| MARKUS RISCHER ET AL: "Human gammadelta T cells as mediators of chimaeric-receptor redirected anti-tumour immunity", BRITISH JOURNAL OF HAEMATOLOGY, vol. 126, no. 4, 1 August 2004 (2004-08-01), GB, pages 583 - 592, XP055278529, ISSN: 0007-1048, DOI: 10.1111/j.1365-2141.2004.05077.x * |
| MORDENTI ET AL., PHARMACEUT. RES., vol. 8, 1991, pages 1351 |
| SCHEUERMANN ET AL.: "CD19 Antigen in Leukemia and Lymphoma Diagnosis and Immunotherapy", LEUKEMIA AND LYMPHOMA, vol. 18, 1995, pages 385 - 397, XP009155469, DOI: 10.3109/10428199509059636 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| YIYANG XU ET AL: "A novel antibody-TCR (AbTCR) platform combines Fab-based antigen recognition with gamma/delta-TCR signaling to facilitate T-cell cytotoxicity with low cytokine release", CELL DISCOVERY, vol. 4, no. 1, 20 November 2018 (2018-11-20), XP055583500, DOI: 10.1038/s41421-018-0066-6 * |
| ZAPATA ET AL., PROTEIN ENG, vol. 8, 1995, pages 1057 - 1062 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12194095B2 (en) | 2015-08-21 | 2025-01-14 | Incyte Corporation | Combinations and uses thereof |
| US12358983B2 (en) | 2016-10-28 | 2025-07-15 | Incyte Corporation | Combination of anti CD19 antibody with a BCL-2 inhibitor and uses thereof |
| US12491244B2 (en) | 2018-09-12 | 2025-12-09 | GC Cell Corporation | Pharmaceutical combinations for treating tumor comprising anti-CD19 antibody and natural killer cell |
Also Published As
| Publication number | Publication date |
|---|---|
| RS67602B1 (sr) | 2026-01-30 |
| SI4051710T1 (sl) | 2026-01-30 |
| EP4051710B1 (en) | 2025-11-26 |
| JP7688025B2 (ja) | 2025-06-03 |
| LT4051710T (lt) | 2026-03-10 |
| MA69251B1 (fr) | 2025-12-31 |
| DK4051710T3 (da) | 2025-12-15 |
| US20210130461A1 (en) | 2021-05-06 |
| PL4051710T3 (pl) | 2026-04-20 |
| FI4051710T3 (fi) | 2026-01-12 |
| EP4051710A1 (en) | 2022-09-07 |
| IL292213A (en) | 2022-06-01 |
| TWI883067B (zh) | 2025-05-11 |
| CA3158984A1 (en) | 2021-05-06 |
| TW202131949A (zh) | 2021-09-01 |
| AU2020372646A1 (en) | 2022-05-12 |
| PT4051710T (pt) | 2026-02-09 |
| EP4706673A2 (en) | 2026-03-11 |
| KR20220116154A (ko) | 2022-08-22 |
| PH12022551009A1 (en) | 2023-03-20 |
| HRP20251630T1 (hr) | 2026-02-13 |
| JP2022554324A (ja) | 2022-12-28 |
| MD4051710T2 (ro) | 2026-04-30 |
| JP2025134705A (ja) | 2025-09-17 |
| MX2022005033A (es) | 2022-09-09 |
| TW202547555A (zh) | 2025-12-16 |
| CN115151565A (zh) | 2022-10-04 |
| SMT202600082T1 (it) | 2026-03-09 |
| ES3062643T3 (en) | 2026-04-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP4051710B1 (en) | Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells | |
| US20130058921A1 (en) | Use of autologous effector cells and antibodies for treatment of multiple myeloma | |
| CN110730789A (zh) | 抗cd70抗体argx-110用于治疗急性骨髓性白血病的用途 | |
| JP2022503685A (ja) | 抗cd19抗体及びナチュラルキラー細胞を含む、腫瘍を治療する薬学的組み合わせ | |
| JP2025175307A (ja) | 逐次抗cd19治療 | |
| WO2021084062A1 (en) | Anti-cd19 therapy in combination with lenalidomide for the treatment of leukemia or lymphoma | |
| US20230014026A1 (en) | Anti-Tumor Combination Therapy comprising Anti-CD19 Antibody and Polypeptides Blocking the SIRPalpha-CD47 Innate Immune Checkpoint | |
| CA3158984C (en) | Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells | |
| TWI922280B (zh) | 包含抗CD19抗體及γδ T細胞之抗腫瘤組合療法 | |
| EA050676B1 (ru) | Противоопухолевая комбинированная терапия, включающая антитело к cd19 и гамма-дельта т-клетки | |
| AU2020209425B2 (en) | Antibody | |
| KR20250060146A (ko) | 종양 치료를 위한 항-cd 19 항체 및 자연살해세포를 포함하는 약학적 조합물 | |
| CA3126869A1 (en) | Antibody |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20800121 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3158984 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022525535 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020372646 Country of ref document: AU Date of ref document: 20201030 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020800121 Country of ref document: EP Effective date: 20220531 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2020800121 Country of ref document: EP |