WO2021081232A1 - Modified cytotoxic t cells and methods of use thereof - Google Patents
Modified cytotoxic t cells and methods of use thereof Download PDFInfo
- Publication number
- WO2021081232A1 WO2021081232A1 PCT/US2020/056901 US2020056901W WO2021081232A1 WO 2021081232 A1 WO2021081232 A1 WO 2021081232A1 US 2020056901 W US2020056901 W US 2020056901W WO 2021081232 A1 WO2021081232 A1 WO 2021081232A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- amino acid
- cases
- cells
- terminus
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/08—Clostridium, e.g. Clostridium tetani
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/32—T-cell receptors [TCR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/55—IL-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70539—MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
- C12N15/625—DNA sequences coding for fusion proteins containing a sequence coding for a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
- C12N5/0638—Cytotoxic T lymphocytes [CTL] or lymphokine activated killer cells [LAK]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16111—Cytomegalovirus, e.g. human herpesvirus 5
- C12N2710/16134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- An adaptive immune response involves the engagement of the T cell receptor (TCR), present on the surface of a T cell, with a small peptide antigen non-covalently presented on the surface of an antigen presenting cell (APC) by a major histocompatibility complex (MHC; also referred to in humans as a human leukocyte antigen (HLA) complex).
- TCR T cell receptor
- APC antigen presenting cell
- MHC major histocompatibility complex
- HLA human leukocyte antigen
- TCR is specific for a given epitope; however, the costimulatory protein not epitope specific and instead is generally expressed on all T cells or on large T cell subsets.
- the present disclosure provides in vitro modified cytotoxic T cells (CTLs) that comprise: a) a T- cell receptor (TCR) specific for a preselected antigen in a human; and b) a nucleic acid(s) encoding a chimeric antigen receptor (CAR) specific for a cancer-associated antigen.
- CTLs in vitro modified cytotoxic T cells
- TCR T- cell receptor
- CAR chimeric antigen receptor
- FIG. 1 is a schematic depiction of generation and use of modified CTLs according to the present disclosure.
- FIG. 2A-2D provide schematic depictions of exemplary embodiments of TMMPs.
- FIGs. 3A-3G provide amino acid sequences (from top to bottom SEQ ID NOs: 376-387) of immunoglobulin Fc polypeptides.
- FIG. 4 provides a multiple amino acid sequence alignment of beta-2 microglobulin ( ⁇ 2M) precursors (i.e., including the leader sequence) from Homo sapiens (NP_004039.1; SEQ ID NO:388), Pan troglodytes (NP_001009066.1; SEQ ID NO:388), Macaca mulatto (NP_001040602.1; SEQ ID NO:389), Bos taurus (NP 776318.1; SEQ ID NO:390) and Mus musculus (NP_033865.2; SEQ ID NO:391).
- Amino acids 1-20 are a signal peptide.
- FIGs. 5A-5C provide amino acid sequences of full-length human HLA heavy chains of alleles A*0101 (SEQ ID NO:392), A* 1101 (SEQ ID NO:393), A*2402 (SEQ ID NO:394), and A*3303 (SEQ ID NO:395) (FIG. 5A); full-length human HLA heavy chain of allele B*0702 (FIG. 5B; SEQ ID NO:396); and a full-length human HLA-C heavy chain (FIG. 5C; SEQ ID NO:397).
- FIG. 6 provides an alignment of eleven mature MHC class I heavy chain amino acid sequences without their leader sequences, transmembrane domains, and intracellular domains.
- FIGs. 7A-7B provide an alignment of HLA-A heavy chain amino acid sequences (FIG. 7A; from top to bottom SEQ ID NOs: 406, 185, 407-413) and a consensus sequence (FIG. 7B; SEQ ID NO: 184).
- FIGs. 8A-8B provide an alignment of HLA-B heavy chain amino acid sequences (FIG. 8A; from top to bottom SEQ ID NOs: 195, 414-419) and a consensus sequence (FIG. 8B; SEQ ID NO: 194).
- FIGs. 9A-9B provide an alignment of HLA-C heavy chain amino acid sequences (FIG. 9A; from top to bottom SEQ ID NOs: 420-424, 199, 425-427) and a consensus sequence (FIG. 9B; SEQ ID NO: 198).
- FIG. 10 provides a consensus amino acid sequence for each of HLA-E (SEQ ID NO:428), -F (SEQ ID NO:429), and -G (SEQ ID NO:430) heavy chains.
- Variable amino acid (aa) positions are indicated as “X” residues sequentially numbered; the locations of amino acids 84, 139, and 236 are double underlined.
- FIG. 11 provides an alignment of consensus amino acid sequences for HLA-A (SEQ ID NO: 184), -B (SEQ ID NO: 194), -C (SEQ ID NO: 198), -E (SEQ ID NO:431), -F (SEQ ID NO:432), and -G (SEQ ID NO:433).
- polynucleotide and “nucleic acid,” used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides.
- this term includes, but is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
- polypeptide refers to a polymeric form of amino acids of any length, which can include coded and non-coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones.
- a polynucleotide or polypeptide has a certain percent "sequence identity" to another polynucleotide or polypeptide, meaning that, when aligned, that percentage of bases or amino acids are the same, and in the same relative position, when comparing the two sequences. Sequence identity can be determined in a number of different ways.
- sequences can be aligned using various convenient methods and computer programs (e.g., BLAST, T-COFFEE, MUSCLE, MAFFT, etc.), available over the world wide web at sites including ncbi.nlm.nili.gov/BLAST, ebi.ac.uk/Tools/msa/tcoffee/, ebi.ac.uk/Tools/msa/muscle/, mafft.cbrc.jp/alignment/software/. See, e.g., Altschul et al. (1990), J. Mol. Biol. 215:403-10.
- a group of amino acids having aliphatic side chains consists of glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains consists of serine and threonine; a group of amino acids having amide containing side chains consisting of asparagine and glutamine; a group of amino acids having aromatic side chains consists of phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains consists of lysine, arginine, and histidine; a group of amino acids having acidic side chains consists of glutamate and aspartate; and a group of amino acids having sulfur containing side chains consists of cysteine and methionine.
- Exemplary conservative amino acid substitution groups are: valine- leucine-isoleucine,
- immunological synapse or “immune synapse” as used herein generally refers to the natural interface between two interacting immune cells of an adaptive immune response including, e.g., the interface between an antigen-presenting cell (APC) or target cell and an effector cell, e.g., a lymphocyte, an effector T cell, a natural killer cell, and the like.
- An immunological synapse between an APC and a T cell is generally initiated by the interaction of a T cell antigen receptor and major histocompatibility complex molecules, e.g., as described in Bromley et al., Annu Rev Immunol. 2001;19:375-96; the disclosure of which is incorporated herein by reference in its entirety.
- T cell includes all types of immune cells expressing CD3, including T-helper cells (CD4 + cells), cytotoxic T-cells (CD8 + cells), T-regulatory cells (Treg), and NK-T cells.
- CD4 + cells T-helper cells
- CD8 + cells cytotoxic T-cells
- Treg T-regulatory cells
- NK-T cells NK-T cells
- immunomodulatory polypeptide includes a polypeptide on an antigen presenting cell (APC) (e.g., a dendritic cell, a B cell, and the like) that specifically binds a cognate co-immunomodulatory polypeptide on a T cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with a major histocompatibility complex (MHC) polypeptide loaded with peptide, mediates a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
- APC antigen presenting cell
- MHC major histocompatibility complex
- An immunomodulatory polypeptide can include, but is not limited to, CD7, B7-1 (CD80), B7-2 (CD86), PD-L1, PD-L2, 4-1BBL, OX40L, Fas ligand (FasL), inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM), CD30L, CD40, CD70, CD83, HLA-G, MICA, MICB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, FiVEM, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-FI3.
- an “immunomodulatory polypeptide” (also referred to herein as a “MOD”) specifically binds a cognate co-immunomodulatory polypeptide on a T cell.
- An “immunomodulatory domain” (“MOD”) of a TMMP binds a cognate co-immunomodulatory polypeptide, which may be present on a target T cell.
- a T-cell modulatory polypeptide comprises a polypeptide that preferentially binds to and activates target T cells bearing a T cell receptor (TCR) specific for an antigen of interest.
- a T-cell modulatory multimeric polypeptide comprises a multimeric T-cell modulatory polypeptide that preferentially binds to and activates target T cells bearing a T cell receptor (TCR) specific for an antigen of interest.
- a TMMP can comprise at least one heterodimer comprising 2 polypeptide chains: a) a first polypeptide comprising: i) a peptide epitope (e.g., a peptide that is at least 4 amino acids in length (e.g., from 4 amino acids to about 25 amino acids in length); and ii) first MFiC polypeptide; b) a second polypeptide comprising a second MFiC polypeptide, and c) at least one immunomodulatory polypeptide, where the first and/or the second polypeptide comprises the immunomodulatory polypeptide.
- a TMP or a TMMP also may be referred to as a “synTac” or an “Tmmnno-ST ATTM.”
- “Fieterologous,” as used herein, means a nucleotide or polypeptide that is not found in the native nucleic acid or protein, respectively.
- expression construct or “DNA construct” are used interchangeably herein to refer to a DNA molecule comprising a vector and at least one insert.
- affinity refers to the equilibrium constant for the reversible binding of two agents (e.g., an antibody and an antigen) and is expressed as a dissociation constant (K D ).
- Affinity can be at least 1-fold greater, at least 2-fold greater, at least 3-fold greater, at least 4-fold greater, at least 5-fold greater, at least 6-fold greater, at least 7-fold greater, at least 8-fold greater, at least 9-fold greater, at least 10-fold greater, at least 20-fold greater, at least 30-fold greater, at least 40-fold greater, at least 50-fold greater, at least 60-fold greater, at least 70-fold greater, at least 80-fold greater, at least 90-fold greater, at least 100-fold greater, or at least 1,000-fold greater, or more, than the affinity of an antibody for unrelated amino acid sequences.
- Affinity of an antibody to a target protein can be, for example, from about 100 nanomolar (nM) to about 0.1 nM, from about 100 nM to about 1 picomolar (pM), or from about 100 nM to about 1 femtomolar (fM) or more.
- the term “avidity” refers to the resistance of a complex of two or more agents to dissociation after dilution.
- the terms “immunoreactive” and “preferentially binds” are used interchangeably herein with respect to antibodies and/or antigen- binding fragments. Unless otherwise indicated herein, when the word “about” is used in reference to a numeric value, it means a range of ⁇ 10% of the stated numeric value, e.g., “about 10” means a value from 9 to 11.
- binding refers to a non-covalent interaction between two molecules.
- Non-covalent binding refers to a direct association between two molecules, due to, for example, electrostatic, hydrophobic, ionic, and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges.
- Non-covalent binding interactions are generally characterized by a dissociation constant (K D ) of less than 10 -6 M, less than 10 -7 M, less than 10 -8 M, less than 10 -9 M, less than 10 -10 M, less than 10 -11 M, less than 10 -12 M, less than 10 -13 M, less than 10 -14 M, or less than 10 15 M.
- K D dissociation constant
- Affinity refers to the strength of non-covalent binding, increased binding affinity being correlated with a lower K D .
- Specific binding generally refers to binding with an affinity of at least about 10 -7 M or greater, e.g., 5x 10 -7 M, 10 -8 M, 5 x 10 -8 M, 10 -9 M, and greater.
- Non-specific binding generally refers to binding (e.g., the binding of a ligand to a moiety other than its designated binding site or receptor) with an affinity of less than about 10 -7 M (e.g., binding with an affinity of 10 -6 M, 10 -5 M, 10 -4 M).
- specific binding can be in the range of from 1 ⁇ M to 100 ⁇ M, or from 100 ⁇ M to 1 mM.
- treatment used herein to generally mean obtaining a desired pharmacologic and/or physiologic effect.
- the effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease.
- Treatment covers any treatment of a disease or symptom in a mammal, and includes: (a) preventing the disease or symptom from occurring in a subject which may be predisposed to acquiring the disease or symptom but has not yet been diagnosed as having it; (b) inhibiting the disease or symptom, i.e., arresting its development; and/or (c) relieving the disease, i.e., causing regression of the disease.
- the therapeutic agent may be administered before, during or after the onset of disease or injury.
- the treatment of ongoing disease, where the treatment stabilizes or reduces the undesirable clinical symptoms of the patient, is of particular interest. Such treatment is desirably performed prior to complete loss of function in the affected tissues.
- the subject therapy will desirably be administered during the symptomatic stage of the disease, and in some cases after the symptomatic stage of the disease.
- the terms "individual,” “subject,” “host,” and “patient,” are used interchangeably herein and refer to any mammalian subject for whom diagnosis, treatment, or therapy is desired. Mammals include, e.g., humans, non-human primates, rodents (e.g., rats; mice), lagomorphs (e.g., rabbits), ungulates (e.g., cows, sheep, pigs, horses, goats, and the like), etc.
- the present disclosure provides in vitro modified cytotoxic T cells (CTLs) that comprise: a) a T- cell receptor (TCR) specific for a preselected antigen in a human; and b) a nucleic acid(s) encoding a chimeric antigen receptor (CAR) specific for a cancer-associated antigen.
- CTLs in vitro modified cytotoxic T cells
- TCR T- cell receptor
- CAR chimeric antigen receptor
- the present disclosure provides in vitro modified T cells that comprise: a) a TCR specific for a preselected antigen present in a human; and b) one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain that binds to a cancer- associated antigen.
- the present disclosure provides an in vitro composition comprising a quantity of (a population of) target modified T cells that comprise: a) a TCR specific for a preselected antigen present in a human; and b) one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain that binds to a cancer-associated antigen.
- the present disclosure provides in vitro modified CTLs that comprise: a) a TCR specific for a preselected antigen present in a human; and b) one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain that binds to a cancer-associated antigen.
- the present disclosure provides an in vitro composition
- a quantity of (a population of) target modified CTLs that comprise: a) a TCR specific for a preselected antigen present in a human; and b) one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain that binds to a cancer-associated antigen.
- An in vitro composition of the present disclosure can comprise a population of modified T cells that may contain modified cells (e.g., T cells, such as CTLs) other than the target modified T cells (e.g., target modified CTLs). Such cells are referred to as “non-target modified T cells,” where non-target T cells can include non-target CTLs. Non-target modified T cells comprise a TCR that is not specific for the preselected antigen.
- an in vitro composition of the present disclosure can be a heterogeneous population comprising target modified T cells (e.g., target modified CTLs) and non-target modified T cells (e.g., non-target modified CTLs).
- target modified T cells e.g., target modified CTLs
- target modified T cells e.g., target modified CTLs
- At least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or more than 99%, of the total number of T cells in the composition are target modified T cells (e.g., target modified CTLs).
- target modified T cells e.g., target modified CTLs
- from 20% to 30%, from 30% to 40%, from 40% to 50%, from 50% to 60%, from 60% to 70%, from 70% to 80%, from 80% to 90%, or from 90% to 100%, of the total number of T cells in the composition are target modified T cells (e.g., target modified CTLs).
- the population of T cells in the composition is a substantially homogeneous population of target modified T cells (e.g., target modified CTLs).
- target modified T cells e.g., target modified CTLs
- target modified T cells comprise (e.g., express on their cell surface) a TCR specific for a preselected antigen present in a human.
- antigens can be antigens of pathogens that infect humans.
- antigens can be antigens present in vaccines administered to humans.
- the antigen is a viral antigen.
- a viral antigen is encoded by a virus that infects a majority of the human population, where such viruses include, e.g., cytomegalovirus (CMV), Epstein-Barr virus (EBV), human papilloma virus, influenza virus, adenovirus, and the like.
- the antigen is a bacterial epitope, e.g., a bacterial epitope that is included in a vaccine and to which a majority of the human population has immunity.
- the antigen is a tetanus antigen.
- an in vitro composition comprising modified target T cells is depicted schematically in FIG. 1.
- the in vitro cell population is modified to express a chimeric antigen receptor (CAR) specific for a cancer-associated antigen.
- Target modified T cells in the population comprise TCRs specific for preselected antigens present in humans.
- the in vitro composition comprising target modified T cells can be administered to an individual in need thereof, e.g., an individual having a cancer.
- a T-cell modulatory multimeric polypeptide (TMMP) that comprises a peptide epitope that is bound by the TCR present on the modified target T cells can also be administered to the individual.
- TMMP T-cell modulatory multimeric polypeptide
- the TMMP comprises an immunomodulatory polypeptide that provides for activation of T cells comprising TCRs that bind the peptide epitope present in the TMMP.
- the modified target T cells e.g., modified CTLs
- the modified target T cells will target cancer cells expressing the cancer-associated antigen to which the CAR present.
- the TMMP will activate the modified target T cells by binding to TCRs present on the modified target T cells.
- Such a method takes advantage of the presence in human populations of T cells (e.g., CTLs) specific for antigens such as those associated with common human pathogens and/or commonly administered human vaccines.
- a modified T cell is modified to express a CAR specific for a cancer- associated antigen.
- a CAR generally comprises: a) an extracellular domain comprising an antigen- binding domain (antigen-binding polypeptide); b) a transmembrane region; and c) a cytoplasmic domain comprising an intracellular signaling domain (intracellular signaling polypeptide).
- a CAR comprises: a) an extracellular domain comprising the antigen-binding domain; b) a transmembrane region; and c) a cytoplasmic domain comprising: i) one or more co-stimulatory polypeptides; and ii) an intracellular signaling domain.
- a CAR comprises hinge region between the extracellular antigen-binding domain and the transmembrane domain.
- a CAR comprises: a) an extracellular domain comprising the antigen-binding domain; b) a hinge region; c) a transmembrane region; and d) a cytoplasmic domain comprising an intracellular signaling domain.
- a CAR comprises: a) an extracellular domain comprising the antigen-binding domain; b) a hinge region; c) a transmembrane region; and d) a cytoplasmic domain comprising: i) one or more co-stimulatory polypeptides; and ii) an intracellular signaling domain.
- a CAR is a single polypeptide chain. In some cases, a CAR comprises two polypeptide chains. Generally, any CAR structure known to those skilled in the art may be used to modify T cells in order to prepare compositions as disclosed herein.
- CARs specific for a variety of tumor antigens are known in the art; for example CD171- specific CARs (Park et al., Mol Ther (2007) 15(4):825-833), EGFRvIII-specific CARs (Morgan et al., Hum Gene Ther (2012) 23(10): 1043-1053), EGF-R-specific CARs (Kobold et al., J. Natl Cancer Inst (2014) 107(1):364), carbonic anhydrase IX-specific CARs (Lamers et al., Biochem Soc Trans (2016) 44(3):951-959), folate receptor-a (FR-a)-specific CARs (Kershaw et al., Clin Cancer Res (2006)
- a CAR comprises an extracellular domain comprising an antigen-binding domain.
- the antigen-binding domain present in a CAR can be any antigen-binding polypeptide, a wide variety of which are known in the art.
- the antigen-binding domain is a single chain Fv (scFv).
- Other antibody-based recognition domains cAb VHH (camelid antibody variable domains) and humanized versions, IgNAR VH (shark antibody variable domains) and humanized versions, sdAb VH (single domain antibody variable domains) and “camelized” antibody variable domains are suitable.
- the antigen-binding domain is a nanobody.
- the antigen bound by the antigen-binding domain of a CAR is selected from: a MUC1 polypeptide, an LMP2 polypeptide, an epidermal growth factor receptor (EGFR) vTTT polypeptide, a HER-2/neu polypeptide, a melanoma antigen family A, 3 (MAGE A3) polypeptide, a p53 polypeptide, a mutant p53 polypeptide, an NY-ESO-1 polypeptide, a folate hydrolase (prostate-specific membrane antigen; PSMA) polypeptide, a carcinoembryonic antigen (CEA) polypeptide, a melanoma antigen recognized by T-cells (melanA/MARTl) polypeptide, a Ras polypeptide, a gplOO polypeptide, a proteinase3 (PR1) polypeptide, a bcr-abl polypeptide, a tyrosinase polypeptide, a
- the antigen is a human papilloma virus (HPV) antigen. In some cases, the antigen is an alpha-feto protein (AFP) antigen. In some cases, the antigen is a Wilms tumor-1 (WT1) antigen.
- HPV human papilloma virus
- AFP alpha-feto protein
- WT1 Wilms tumor-1
- the antigen-binding polypeptide of a CAR can bind any of a variety of cancer- associated antigens, including, e.g., CD19, CD20, CD38, CD30, Her2/neu, ERBB2, CA125, MUC-1, prostate-specific membrane antigen (PSMA), CD44 surface adhesion molecule, mesothelin, carcinoembryonic antigen (CEA), epidermal growth factor receptor (EGFR), EGFRvIII, vascular endothelial growth factor receptor-2 (VEGFR2), B-cell maturation antigen (BCMA), high molecular weight-melanoma associated antigen (HMW-MAA), MAGE-A1, IL-13R-a2, GD2, and the like.
- cancer-associated antigens including, e.g., CD19, CD20, CD38, CD30, Her2/neu, ERBB2, CA125, MUC-1, prostate-specific membrane antigen (PSMA), CD44 surface adhesion molecule, mesothelin
- Cancer- associated antigens also include, e.g., 4-1BB, 5T4, adenocarcinoma antigen, alpha-fetoprotein (AFP), BAFF, B -lymphoma cell, C242 antigen, CA-125, carbonic anhydrase 9 (CA-IX), C-MET, CCR4,
- CD 152 CD19, CD20, CD200, CD22, CD221, CD23 (IgE receptor), CD28, CD30 (TNFRSF8), CD33, CD4, CD40, CD44 v6, CD51, CD52, CD56, CD74, CD80, CEA, CNT0888, CTEA-4, DRS, EGFR, EpCAM, CD3, FAP, fibronectin extra domain-B, folate receptor 1, GD2, GD3 ganglioside, glycoprotein 75, GPNMB, HER2/neu, HGF, human scatter factor receptor kinase, IGF-1 receptor, IGF-I, IgGl, Ll- CAM, IF-13, IF-6, insulin-like growth factor I receptor, integrin a5b1, integrin anb3, MORAb-009, MS4A1, MUC1, mucin CanAg, N-glycolylneuraminic acid, NPC-1C, PDGF-R a, PDF192, phosphatidylserine
- the cancer-associated antigen bound by the antigen-binding polypeptide of a CAR is selected from AFP, BCMA, CD10, CD117, CD123, CD133, CD128, CD171, CD19, CD20, CD22, CD30, CD33, CD34, CD38, CD5, CD56, CD7, CD70, CD80, CD86, CEA, CED18, CEE-1, cMet, EGFR, EGFRvIII, EpCAM, EphA2, GD-2, glypican-3, GPC3, HER-2, kappa immunoglobulin, LeY, LMP1, mesothlin, MG7, MUC1, NKG2D ligand, PD-L1, PSCA, PSMA, ROR1, ROR1R, TACI, and VEGFR2.
- the cancer-associated antigen is BCMA.
- the cancer- associated antigen is MUC1.
- the cancer-associated antigen is CD19.
- VH and VF amino acid sequences of various cancer-associated antigen-binding antibodies are known in the art, as are the light chain and heavy chain CDRs of such antibodies. See, e.g., king et al. (2016) Frontiers Immunol. 9:469; WO 2005/012493; US 2019/0119375; US 2013/0066055. The following are non-limiting examples of antibodies that bind cancer-associated antigens.
- an anti-Her2 antibody comprises: a) a light chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- an anti-Her2 antibody comprises a light chain variable region (VL) present in the light chain amino acid sequence provided above; and a heavy chain variable region (VH) present in the heavy chain amino acid sequence provided above.
- VL light chain variable region
- VH heavy chain variable region
- an anti-Her2 antibody can comprise: a) a VL comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence:
- an anti-Her2 antibody comprises VL CDR1, VL CDR2, and VL CDR3 present in the light chain amino acid sequence provided above; and VH CDR1, CDR2, and CDR3 present in the heavy chain amino acid sequence provided above.
- the V H and V L CDRS are as defined by Rabat (see, e.g., Table 1, above; and Rabat 1991).
- the V H and V L CDRS are as defined by Chothia (see, e.g., Table 1, above; and Chothia 1987).
- an anti-Her2 antibody can comprise a VL CDR1 having the amino acid sequence RASQDVNTAVA (SEQ ID NOG); a VL CDR2 having the amino acid sequence SASFLY (SEQ ID NOG); a VL CDR3 having the amino acid sequence QQHYTTPP (SEQ ID NOG); a VH CDR1 having the amino acid sequence GFNIRDTY (SEQ ID NO:9); a VH CDR2 having the amino acid sequence IYPTNGYT (SEQ ID NO: 10); and a VH CDR3 having the amino acid sequence SRWGGDGFYAMDY (SEQ ID NO: 11).
- an anti-Her2 antibody is a scFv antibody.
- an anti-Her2 scFv can comprise an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- an anti-Her2 antibody comprises: a) a light chain variable region (VL) comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- VL light chain variable region
- an anti-Her2 antibody comprises a VL present in the light chain amino acid sequence provided above; and a VH present in the heavy chain amino acid sequence provided above.
- an anti-Her2 antibody can comprise: a) a VL comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence:
- an anti-Her2 antibody comprises VL CDR1, VL CDR2, and VL CDR3 present in the light chain amino acid sequence provided above; and VH CDR1, CDR2, and CDR3 present in the heavy chain amino acid sequence provided above.
- the V H and V L CDRS are as defined by Rabat (see, e.g., Table 1, above; and Rabat 1991).
- the V H and V L CDRS are as defined by Chothia (see, e.g., Table 1, above; and Chothia 1987).
- an anti-HER2 antibody can comprise a VL CDR1 having the amino acid sequence KASQDVSIGVA (SEQ ID NO: 17); a VL CDR2 having the amino acid sequence SASYRY (SEQ ID NO: 18); a VL CDR3 having the amino acid sequence QQYYIYPY (SEQ ID NO: 19); a VH CDR1 having the amino acid sequence GFTFTDYTMD (SEQ ID NO:20); a VH CDR2 having the amino acid sequence ADVNPNSGGSIYNQRFKG (SEQ ID NO:21); and a VH CDR3 having the amino acid sequence ARNLGPSFYFDY (SEQ ID NO:22).
- an anti-Her2 antibody is a scFv.
- an anti-Her2 scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- Anti-CD19 antibodies are known in the art; and the VH and VL, or the VH and VL
- CDRs, of any anti-CD19 antibody can be included in a CAR. See e.g., WO 2005/012493.
- an anti-CD19 antibody includes a VL CDR1 comprising the amino acid sequence KASQSVDYDGDSYLN (SEQ ID NO:23); a VL CDR2 comprising the amino acid sequence DASNLVS (SEQ ID NO:24); and a VL CDR3 comprising the amino acid sequence QQSTEDPWT (SEQ ID NO:25).
- an anti-CD19 antibody includes a VH CDR1 comprising the amino acid sequence SYWMN (SEQ ID NO:26); a VH CDR2 comprising the amino acid sequence QIWPGDGDTNYNGKFKG (SEQ ID NO:27); and a VH CDR3 comprising the amino acid sequence RETTT V GR Y Y Y AMD Y (SEQ ID NO:28).
- an anti-CD19 antibody includes a VL CDR1 comprising the amino acid sequence KASQSVDYDGDSYLN (SEQ ID NO:23); a VL CDR2 comprising the amino acid sequence DASNLVS (SEQ ID NO:24); a VL CDR3 comprising the amino acid sequence QQSTEDPWT (SEQ ID NO:25); a VH CDR1 comprising the amino acid sequence SYWMN (SEQ ID NO:26); a VH CDR2 comprising the amino acid sequence QIWPGDGDTNYNGKFKG (SEQ ID NO:27); and a VH CDR3 comprising the amino acid sequence RETTTVGRYYYAMDY (SEQ ID NO:28).
- an anti-CD19 antibody is a scFv.
- an anti-CD19 antibody is a scFv.
- CD ⁇ scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- Anti-mesothelin antibodies are known in the art; and the VH and VL, or the VFI and VL
- CDRs of any anti-mesothelin antibody can be included in a CAR. See, e.g., U.S. 2019/0000944; WO 2009/045957; WO 2014/031476; USPN 8,460,660; US 2013/0066055; and WO 2009/068204.
- an anti-mesothelin antibody comprises: a) a light chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- a heavy chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- an anti-mesothelin antibody comprises a VL present in the light chain amino acid sequence provided above; and a VH present in the heavy chain amino acid sequence provided above.
- an anti-mesothelin antibody can comprise: a) a VL comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence:
- an anti-mesothelin antibody comprises VL CDR1, VL CDR2, and VL
- V H and V L CDRS are as defined by Rabat (see, e.g., Table 1, above; and Rabat 1991). In some cases, the V H and V L CDRS are as defined by Chothia (see, e.g., Table 1, above; and Chothia 1987).
- an anti-mesothelin antibody can comprise a VL CDR1 having the amino acid sequence TGTSSDIGGYNSVS (SEQ ID NO:34); a VL CDR2 having the amino acid sequence LMI Y GVNNRPS (SEQ ID NO:35); a VL CDR3 having the amino acid sequence SSYDIESATP (SEQ ID NO:36); a VH CDR1 having the amino acid sequence GYSFTSYWIG (SEQ ID NO:37); a VH CDR2 having the amino acid sequence WMGIIDPGDSRTRYSP (SEQ ID NO:38); and a VH CDR3 having the amino acid sequence GQLYGGTYMDG (SEQ ID NO:39).
- An anti-mesothelin antibody can be a scFv.
- an anti- mesothelin scFv can comprise the following amino acid sequence:
- an anti-mesothelin scFv can comprise the following amino acid sequence:
- Anti-BCMA B-cell maturation antigen antibodies are known in the art. and the VH and
- an anti-BCMA antibody comprises: a) a light chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- a heavy chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- an anti-BCMA antibody comprises a VL present in the light chain amino acid sequence provided above; and a VH present in the heavy chain amino acid sequence provided above.
- an anti-BCMA antibody can comprise: a) a VL comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: NO:44); and b) a VH comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence:
- an anti-BCMA antibody comprises VL CDR1, VL CDR2, and VL CDR3 present in the light chain amino acid sequence provided above; and VH CDR1, CDR2, and CDR3 present in the heavy chain amino acid sequence provided above.
- the V H and V L CDRS are as defined by Rabat (see, e.g., Table 1, above; and Rabat 1991).
- the V H and V L CDRS are as defined by Chothia (see, e.g., Table 1, above; and Chothia 1987).
- an anti-BCMA antibody can comprise a VL CDR1 having the amino acid sequence SSNIGSNT (SEQ ID NO:46), a VL CDR2 having the amino acid sequence NYH, a VL CDR3 having the amino acid sequence AAWDDSLNGWV (SEQ ID NO:47)), a VH CDR1 having the amino acid sequence GFTFGDYA (SEQ ID NO:48), a VH CDR2 having the amino acid sequence SRSKAYGGTT (SEQ ID NO:49), and a VH CDR3 having the amino acid sequence ASSGYSSGWTPFDY (SEQ ID NO:50).
- An anti-BCMA antibody can be a scFv.
- an anti-BCMA scFv can comprise the following amino acid sequence:
- an anti-BCMA scFv can comprise the following amino acid sequence:
- an anti-BCMA antibody can comprise a VL CDR1 having the amino acid sequence SASQDISNYLN (SEQ ID NO:53); a VL CDR2 having the amino acid sequence YTSNLHS (SEQ ID NO:54); a VL CDR3 having the amino acid sequence QQYRKLPWT (SEQ ID NO:55); a VH CDR1 having the amino acid sequence NYWMH (SEQ ID NO:56); a VH CDR2 having the amino acid sequence ATYRGHSDTYYNQKFKG (SEQ ID NO:57); and a VH CDR3 having the amino acid sequence GAIYNGYDVLDN (SEQ ID NO:58).
- an anti-BCMA antibody comprises: a) a light chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- an anti-BCMA antibody comprises: a) a heavy chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- an anti-BCMA antibody (e.g., an antibody referred to in the literature as belantamab) comprises a light chain comprising the amino acid sequence:
- the anti-BCMA antibody has a cancer chemotherapeutic agent linked to the antibody.
- the anti-BCMA antibody is GSK2857916 (belantamab- mafodotin), where monomethyl auristatin F (MMAF) is linked via a maleimidocaproyl linker to the anti- BCMA antibody belantamab.
- GSK2857916 belantamab- mafodotin
- MMAF monomethyl auristatin F
- an antigen-binding polypeptide present in a CAR is a single-chain Fv specific for MUC1. See, e.g., Singh et al. (2007) Mol. Cancer Ther. 6:562; Thie et al. (2011) PLoSOne 6:el5921; Imai et al. (2004) Leukemia 18:676; Posey et al. (2016) Immunity 44:1444; EP3130607; EP3164418; WO 2002/044217; and US 2018/0112007.
- an antigen-binding polypeptide present in a CAR is a scFv specific for the MUC1 peptide VTSAPDTRPAPGSTAPPAHG (SEQ ID NO:61).
- a TTP is a scFv specific for the MUC1 peptide
- an antigen-binding polypeptide present in a CAR is a scFv specific for the MUC1 peptide SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:63).
- a TTP is a scFv specific for the MUC1 peptide LAFREGTINVHDVETQFNQY (SEQ ID NO:64).
- an antigen-binding polypeptide present in a CAR is a scFv specific for the MUC1 peptide SNIKFRPGS V V V QLTL A AFREGTIN (SEQ ID NO:65).
- an anti-MUCl antibody can comprise: a VH CDR1 having the amino acid sequence RYGMS (SEQ ID NO:66); a VH CDR2 having the amino acid sequence TISGGGTYIYYPDSVKG (SEQ ID NO:67); a VH CDR3 having the amino acid sequence DNYGRNYDYGMDY (SEQ ID NO:68); a VL CDR1 having the amino acid sequence SATSSVSYIH (SEQ ID NO:69); a VL CDR2 having the amino acid sequence STSNLAS (SEQ ID NO:70); and a VL CDR3 having the amino acid sequence QQRSSSPFT (SEQ ID NO:71). See, e.g., US 2018/0112007.
- an anti-MUCl antibody can comprise a VH CDR1 having the amino acid sequence GY AMS (SEQ ID NO:72); a VH CDR2 having the amino acid sequence TISSGGTYIYYPDSVKG (SEQ ID NO:73); a VH CDR3 having the amino acid sequence LGGDNYYEYFDV (SEQ ID NO:74); a VL CDR1 having the amino acid sequence RASKSVSTSGYSYMH (SEQ ID NO:75); a VL CDR2 having the amino acid sequence LASNLES (SEQ ID NO:76); and a VL CDR3 having the amino acid sequence QHSRELPFT (SEQ ID NO:77). See, e.g., US 2018/0112007.
- an anti-MUCl antibody can comprise a VH CDR1 having the amino acid sequence DYAMN (SEQ ID NO:78); a VH CDR2 having the amino acid sequence VISTFSGNINFNQKFKG (SEQ ID NO:79); a VH CDR3 having the amino acid sequence SDYYGPYFDY (SEQ ID NO:80); a VL CDR1 having the amino acid sequence RSSQTIVHSNGNTYLE (SEQ ID NO:81); a VL CDR2 having the amino acid sequence KVSNRFS (SEQ ID NO:82); and a VL CDR3 having the amino acid sequence (FQGSHVPFT (SEQ ID NO:83).
- an anti-MUCl antibody can comprise a VH CDR1 having the amino acid sequence GY AMS (SEQ ID NO:72); a VH CDR2 having the amino acid sequence TISSGGTYIYYPDSVKG (SEQ ID NO:73); a VH CDR3 having the amino acid sequence LGGDNYYEY (SEQ ID NO:84); a VL CDR1 having the amino acid sequence TASKSVSTSGYSYMH (SEQ ID NO:85); a VL CDR2 having the amino acid sequence LVSNLES (SEQ ID NO:86); and a VL CDR3 having the amino acid sequence QHIRELTRSE (SEQ ID NO:87). See, e.g., US 2018/0112007.
- an antigen-binding polypeptide present in a CAR is specific for a MUC16 polypeptide present on a cancer cell. See, e.g., US 2018/0118848; and US 2018/0112008.
- a MUC 16-specific antigen-binding polypeptide is a scFv.
- a MUC 16-specific antigen- binding polypeptide is a nanobody.
- an anti-MUC16 antibody can comprise a VH CDR1 having the amino acid sequence GFTFSNYY (SEQ ID NO:88); a VH CDR2 having the amino acid sequence ISGRGSTI (SEQ ID NO:89); a VH CDR3 having the amino acid sequence VKDRGGYSPY (SEQ ID NO:90); a VL CDR1 having the amino acid sequence QSISTY (SEQ ID NO:91); a VL CDR2 having the amino acid sequence TAS; and a VL CDR3 having the amino acid sequence QQSYSTPPIT (SEQ ID NO:92). See, e.g., US 2018/0118848.
- a suitable CAR comprises a scFv specific for CD19.
- an anti-CD19 scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- a suitable CAR comprises a scFv specific for mesothelin.
- an anti-mesothelin scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- an anti-mesothelin scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- a suitable CAR comprises a scFv specific for B-cell maturation antigen
- an anti-BCMA scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- an anti-BCMA scFv comprises an amino acid sequence having at least
- amino acid sequence identity to the following amino acid sequence:
- a CAR can include a hinge region between the extracellular domain and the transmembrane domain.
- the term “hinge region” refers to a flexible polypeptide connector region (also referred to herein as “hinge” or “spacer”) providing structural flexibility and spacing to flanking polypeptide regions and can consist of natural or synthetic polypeptides.
- the hinge region can include complete hinge region derived from an antibody of a different class or subclass from that of the CHI domain.
- the term “hinge region” can also include regions derived from CD8 and other receptors that provide a similar function in providing flexibility and spacing to flanking regions.
- the hinge region can have a length of from about 4 amino acids to about 50 amino acids, e.g., from about 4 aa to about 10 aa, from about 10 aa to about 15 aa, from about 15 aa to about 20 aa, from about 20 aa to about 25 aa, from about 25 aa to about 30 aa, from about 30 aa to about 40 aa, or from about 40 aa to about 50 aa.
- an immunoglobulin hinge region can include one of the following amino acid sequences: DKTHT (SEQ ID NO:93); CPPC (SEQ ID NO:94); CPEPKSCDTPPPCPR (SEQ ID NO:95); ELKTPLGDTTHT (SEQ ID NO:96); KSCDKTHTCP (SEQ ID NO:97); KCCVDCP (SEQ ID NO:98); KYGPPCP (SEQ ID NO:99); EPKSCDKTHTCPPCP (SEQ ID NO: 100) (human IgGl hinge); ERKCCVECPPCP (SEQ ID NO: 101) (human IgG2 hinge); ELKTPLGDTTHTCPRCP (SEQ ID NO: 102) (human IgG3 hinge); SPNMVPHAHHAQ (SEQ ID NO: 103) (human IgG4 hinge); and the like.
- the hinge region can comprise an amino acid sequence derived from human CD8; e.g., the hinge region can comprise the amino acid sequence: TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 104), or a variant thereof.
- transmembrane (TM) domain that provides for insertion of a polypeptide into the cell membrane of a eukaryotic (e.g., mammalian) cell is suitable for use.
- the transmembrane region of a CAR can be derived from (i.e.
- CD28 comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8 (e.g., CD8 alpha, CD8 beta), CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154, KIRDS2, 0X40, CD2, CD27, LFA-1 (CDlla, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD160, CD19, IL2R beta, IL2R gamma, IL7R .alpha., ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDlld, ITGAE, CD
- the transmembrane domain can be synthetic, in which case it can comprise predominantly hydrophobic residues such as leucine and valine. In some cases, a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
- the intracellular portion (cytoplasmic domain) of a CAR can comprise one or more co- stimulatory polypeptides.
- suitable co-stimulatory polypeptides include, but are not limited to, 4-1BB (CD137), CD28, ICOS, OX-40, BTLA, CD27, CD30, GITR, and HVEM.
- Suitable co-stimulatory polypeptides include, e.g.: 1) a 4- IBB polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence: KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 112); 2) a CD28 polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence:
- FWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 113); 3) an ICOS polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence: TKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL (SEQ ID NO: 114); 4) an 0X40 polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence:
- RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI (SEQ ID NO: 115); 5) a BTLA polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence: CD27 polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence: CD30 polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence: NO:118); 8) a GITR polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence: NO: 119); and 9) an HVEM polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence: ID NO: 120).
- the co-stimulatory polypeptide can have a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, or from about 65 aa to about 70 aa.
- Intracellular domain - signaling polypeptide Intracellular domain - signaling polypeptide
- the intracellular portion of a CAR can comprise a signaling polypeptide.
- Suitable signaling polypeptides include, e.g., an immunoreceptor tyrosine-based activation motif (ITAM)- containing intracellular signaling polypeptide.
- ITAM immunoreceptor tyrosine-based activation motif
- An IT AM motif is YX1X2L/I , (SEQ ID NO: 121) where X 1 and X2 are independently any amino acid.
- the intracellular signaling domain of a subject CAR comprises 1, 2, 3, 4, or 5 IT AM motifs.
- an IT AM motif is repeated twice in an intracellular signaling domain, where the first and second instances of the IT AM motif are separated from one another by 6 to 8 amino acids, e.g., (YX 1 X 2 L/I)(X 3 ) n (YX 1 X 2 L/I) (SEQ ID NO: 122), where n is an integer from 6 to 8, and each of the 6-8 X 3 can be any amino acid.
- the intracellular signaling domain of a CAR comprises 3 IT AM motifs.
- a suitable intracellular signaling domain can be an ITAM motif-containing portion that is derived from a polypeptide that contains an ITAM motif.
- a suitable intracellular signaling domain can be an ITAM motif-containing domain from any ITAM motif-containing protein.
- a suitable intracellular signaling domain need not contain the entire sequence of the entire protein from which it is derived.
- ITAM motif-containing polypeptides include, but are not limited to: DAP12; FCER1G (Fc epsilon receptor I gamma chain); CD3D (CD3 delta); CD3E (CD3 epsilon); CD3G (CD3 gamma); CD3Z (CD3 zeta); and CD79A (antigen receptor complex-associated protein alpha chain).
- target modified T cells comprise (e.g., express on their cell surface) a TCR specific for a preselected antigen present in a human.
- antigens can be antigens of pathogens that infect humans.
- antigens can be antigens present in vaccines administered to humans.
- the antigen is a viral antigen.
- a viral antigen is encoded by a virus that infects a majority of the human population, where such viruses include, e.g., cytomegalovirus (CMV), Epstein-Barr virus (EBV), human papilloma virus, influenza virus, adenovirus, and the like.
- the antigen is a bacterial epitope, e.g., a bacterial epitope that is included in a vaccine and to which a majority of the human population has immunity.
- the antigen is a tetanus antigen.
- the TCR present on the surface of a target modified T cell binds a CMV peptide. In some cases, the TCR present on the surface of a target modified T cell binds a peptide from CMV pp65. In some cases, the TCR present on the surface of a target modified T cell binds a peptide from CMV gB (glycoprotein B).
- the TCR present on the surface of a target modified T cell binds a CMV polypeptide having a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa, including within a range of from 4 to 20 aa., from 6 to 18 aa., from 8 to 15 aa.
- the TCR present on the surface of a target modified T cell binds a peptide having the amino acid sequence NLVPMVATV (SEQ ID NO: 172) and having a length of 9 amino acids.
- the TCR present on the surface of a target modified T cell binds a peptide having a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa,
- CMV polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following CMV gB amino acid sequence:
- the TCR present on the surface of a target modified T cell binds a CMV peptide when presented with an HLA complex comprising an MHC class I heavy chain selected from HLA-A*0101, A*0201, A*0301, A* 1101, A*2301, A*2402, A*2407, A*3303, and A*3401.
- the TCR present on the surface of a target modified T cell binds a CMV peptide that is restricted to HLA- B*0702, B*0801, B*1502, B*3802, B*4001, B*4601, and/or B*5301.
- the TCR present on the surface of a target modified T cell binds a CMV peptide that is restricted to C*0102, C*0303, C*0304, C*0401, C*0602, C*0701, C*702, C*0801, and/or C*1502.
- the TCR present on the surface of a target modified T cell binds a peptide epitope having amino acid sequence NLVPMVATV (SEQ ID NO: 172) and having a length of 9 amino acids; where the CMV peptide is presented in a complex comprising: i) an HLA-A*0201 class I heavy chain polypeptide; and ii) a ⁇ 2M polypeptide.
- the TCR present on the surface of a target modified T cell binds a peptide of an HPV E6 polypeptide or an HPV E7 polypeptide.
- the HPV epitope can be an epitope of HPV of any of a variety of genotypes, including, e.g., HPV16, HPV18, HPV31, HPV33, HPV35, HPV39, HPV45, HPV51, HPV52, HPV56, HPV58, HPV59, HPV68, HPV73, or HPV82.
- the epitope is an HPV E6 epitope.
- the epitope is an HPV E7 epitope.
- HPV E6 peptides that can be bound by the TCR present on the surface of a
- HPV E7 peptides that can be bound by the TCR present on the surface of a
- the TCR present on the surface of a target modified T cell binds an HPV peptide, where the HPV peptide is an HPV E6 peptide that is bound to an MHC complex comprising a ⁇ 2M polypeptide and an HLA-A24 heavy chain.
- HPV E6 peptides Non-limiting examples of such HPV E6 peptides
- the TCR present on the surface of a target modified T cell binds an HPV [00128] In some cases, the TCR present on the surface of a target modified T cell binds an HPV peptide that presents an HLA-A*2401 -restricted epitope.
- HPV peptides presenting an HLA-A*2401 -restricted epitope are: VYDFAFRDL (SEQ ID NO: 127); RAHYNIVTF (SEQ ID NO: 160); CDSTLRLCV (SEQ ID NO: 134); and LCVQSTHVDI (SEQ ID NO: 135).
- the TCR present on the surface of a target modified T cell binds the peptide VYDFAFRDL (SEQ ID NO: 126). In some cases, the TCR present on the surface of a target modified T cell binds the peptide RAHYNIVTF (SEQ ID NO: 133). In some cases, the TCR present on the surface of a target modified T cell binds the peptide CDSTLRLCV (SEQ ID NO: 134). In some cases, the TCR present on the surface of a target modified T cell binds the peptide LCVQSTHVDI (SEQ ID NO: 135).
- Influenza virus peptides that can be bound by the TCR present on the surface of a target modified T cell include peptides of from 4 amino acids to 25 amino acids in length of an influenza polypeptide, e.g., an influenza polypeptide that is included in a vaccine, or that is present in an influenza virus that infects a human.
- the TCR present on the surface of a target modified T cell binds an influenza virus peptide of from 4 amino acids to 25 amino acids in length of an influenza virus nucleoprotein.
- the TCR present on the surface of a target modified T cell binds a peptide of from 4 amino acids to 25 amino acids in length of an influenza virus hemagglutinin polypeptide.
- the TCR present on the surface of a target modified T cell binds a peptide of from 4 amino acids to 25 amino acids in length of an influenza A virus Matrix protein 1.
- the TCR present on the surface of a target modified T cell binds a peptide of from 4 amino acids to 25 amino acids in length of an influenza virus neuraminidase polypeptide.
- the peptide is a peptide that presents an immunodominant influenza virus protein epitope.
- a suitable influenza peptide is a peptide having the sequence GILGFVFTL (SEQ ID NO: 160) and having a length of 9 amino acids.
- the TCR present on the surface of a target modified T cell binds a tetanus peptide (e.g., a peptide of an antigen present in a tetanus vaccine).
- Tetanus peptides that can be bound by the TCR present on the surface of a target modified T cell include peptides of from 4 amino acids to 25 amino acids in length of a tetanus toxin. Examples of such tetanus peptides include, but are not limited METHODS OF MAKING A MODIFIED CTL
- the present disclosure provides a method of making an in vitro composition of cells of the present disclosure.
- the method comprises: a) providing a composition comprising a quantity of T cells, wherein the quantity comprises target T cells having a TCR specific for a preselected antigen; b) at least partially separating target T cells from non-target T cells comprising a TCR that is not specific for the preselected antigen, thereby generating an enriched target T cell population; and c) modifying the target T cells in the enriched target T cell population by introducing into the target T cells one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain specific for a cancer-associated antigen.
- the method comprises: a) at least partially separating target T cells having a TCR specific for a preselected antigen from non-target T cells comprising a TCR that is not specific for the preselected antigen present in a heterogeneous population of T cells, thereby generating an enriched target T cell population; and b) modifying the target T cells in the enriched target T cell population by introducing into the target T cells one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain specific for a cancer-associated antigen.
- Target T cells e.g., CTLs having a TCR specific for a preselected antigen
- CTLs CTLs
- TCR specific for a preselected antigen can be enriched from a quantity of cells (a “starting cell population”; or “heterogeneous cell population”; or “heterogeneous starting cell population”) obtained from an individual, e.g., a patient who has been vaccinated with a particular antigen of interest or who has been infected with a virus.
- the starting cell population can be whole blood, peripheral blood mononuclear cells (PBMCs), cells obtained by leukapheresis, or other starting cell population that includes leukocytes.
- PBMCs peripheral blood mononuclear cells
- the starting cell population comprises cells having a TCR specific for a preselected antigen (e.g., a viral antigen; a bacterial antigen; as described above). T cells having a TCR specific for a preselected antigen are collectively referred to as “target T cells.”
- the starting cell population also comprises T cells having a TCR specific for an antigen other than the preselected antigen; such cells are referred to as “non-target T cells.”
- the starting cell population comprises both target T cells and non-target T cells.
- the proportion of target T cells in the starting T cell population generally will be low, e.g., well less than 1%, but it also can be higher, e.g., if a patient is experiencing an active infection such as the flu that causes a natural increase in target T cells that are specific for a flu antigen.
- the proportion can range, e.g., from less than 0.01% to about 10% or higher.
- the proportion of target T cells in the starting cell population can be from less than 0.01% to 0.01%, from 0.01% to 0.05%, from 0.05% to 0.1%, from 0.1% to 0.5%, from 0.5% to 1%, from 1% to 2%, from 2% to 5%, or from 5% to 10%.
- the proportion of target T cells in the starting cell population can be more than 10% (e.g., from 10% to about 50%).
- the proportion of target T cells in the enriched target T cell population typically will be higher than 10 percent, but can be lower, e.g., less than 1%, about 1%, about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8% about 9%, or 10%. As noted, however, the proportion of target T cells in the enriched target T cell population typically will be higher than 10 percent and often much higher, however, e.g. at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%.
- the population of T cells in the composition is a substantially homogeneous population of target modified T cells (e.g., target modified CTLs).
- the proportion of target T cells in the enriched target T cell population can be from 10% to 15%, from 15% to 20%, from 20% to 25%, from 25% to 30%, from 30% to 35%, from 35% to 40%, from 40% to 45%, from 45% to 50%, from 50% to 55%, from 55% to 60%, from 60% to 65%, from 65% to 70%, from 70% to 75%, from 75% to 80%, from 80% to 85% from 85% to 90%, from 90% to 95%, or from 95% to 100%.
- the proportion of target T cells in the enriched target T cell population can be from 10% to 25%, from 25% to 50%, from 50% to 75%, from 75% to 95%, or from 95% to 100%, e.g. 96%, 97%, 98% or 99%.
- the separation step provides for a fold enrichment (an increase in the proportion of total cells in the enriched target T cell population that are target T cells, compared to the proportion of total cells in the starting cell population that are target T cells) of at least 2-fold, at least 2.5-fold, at least 5-fold, at least 10-fold, at least 25-fold, at least 50-fold, at least 100-fold, at least 250- fold, at least 500-fold, at least 1000-fold, at least 1500-fold, or at least 2000-fold.
- a fold enrichment an increase in the proportion of total cells in the enriched target T cell population that are target T cells, compared to the proportion of total cells in the starting cell population that are target T cells
- Sorting or positively selecting antigen-specific T cells can be carried out using peptide-loaded MHC multimers (e.g., trimers; tetramers; or pentamers); peptide/MHC-coated magnetic beads; or antibody-coated magnetic beads; or some combination of the foregoing.
- peptide-loaded MHC multimers e.g., trimers; tetramers; or pentamers
- peptide/MHC-coated magnetic beads e.g., peptide/MHC-coated magnetic beads
- antibody-coated magnetic beads or some combination of the foregoing. See, e.g., US 2002/0151690; Altman et al. (1996) Science 274:94; Tubb et al. (2016) J. Immunother. Cancer 6:70; Cobbold et al. (2005) J. Exp. Med. 202:379; and Luxembourg et al. (1998) Nat. Biotechnol. 16:281.
- Antigen-specific T cells can additionally be positively selected by contacting a starting population of cells, or a population of cells that has been enriched for specificity for a pre-selected antigen, with antibodies specific for T cell markers (e.g., where the antibody is attached to a bead, such as a magnetic bead).
- Antibodies that can be used include, but are not limited to, anti-CD3, anti-CD8, anti-CD25, anti-CD54, anti-CD69, anti-CD38, anti-CD45RO, anti-CD49d, anti- CD40L, anti-CD 137, and anti-CD 134 antibodies.
- a starting population of cells is enriched for CD8 + T cells.
- a method of the present disclosure comprises: a) at least partially separating target T cells from non-target T cells, thereby generating an enriched target T cell population; b) optionally, at least partially separating CD8 + T cells from CD8- T cells in the enriched target T cell population, thereby generating a CD8 + enriched target T cell population; and c) genetically modifying the enriched target T cells or CD8 + enriched target T cells with one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain specific for a cancer-associated antigen.
- a method of the present disclosure comprises: a) at least partially separating CD8 + T cells from CD8- T cells in a starting cell population, thereby generating an enriched CD8 + cell population; b) at least partially separating target T cells from non-target T cells present in the enriched CD8 + cell population, thereby generating a CD8 + enriched target T cell population; and c) genetically modifying the CD8 + enriched target T cells with one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain specific for a cancer-associated antigen.
- MHC multimers and methods for generating such multimers, are known in the art.
- an MHC class I heavy chain can be modified to include biotin.
- the MHC class I heavy chain is allowed to form a complex with a ⁇ 2M polypeptide.
- the biotinylated MHC class I heavy chain/ ⁇ 2M complex is multimerized by contacting the complex with avidin or streptavidin.
- MHC multimers can be modified to include, e.g., phycoerythrin.
- a biotinylated MHC class I heavy chain/ ⁇ 2M complex can be multimerized by contacting the complex with PE-labeled avidin or streptavidin. See, e.g., Altman et al. (1996) Science 274:94.
- a population of PBMCs is obtained from a CMV- seropositive individual. This starting population of PBMCs contains less than 0.1% CMV-specific T cells. CMV has a prevalence of 50% to 90% in human adults.
- Magnetic beads are coated with HLA- A*0201 heavy chains.
- Class I MHC complexes are formed by contacting the coated beads with ⁇ 2M polypeptides, forming magnetic beads coated with an MHC complex comprising HLA-A*0201 heavy chain ⁇ 2M heterodimers.
- the peptide NLMPMVATV (SEQ ID NO: 171) is loaded onto the magnetic beads coated with the MHC complexes, forming magnetic beads coated with MHC/peptide.
- the MHC/peptide-coated magnetic beads are mixed with PBMCs.
- Application of a magnetic field provides for separation of CMV-specific T cells from the starting population, generating an enriched CMV- specific T cell population.
- the enriched CMV-specific T cell population can include over 90% CMV- specific T cells.
- a population of PBMCs is obtained from a CMV- seropositive individual. This starting population of PBMCs contains less than 0.1% CMV-specific T cells.
- the starting population of PBMCs is coated with MHC multimers (e.g., trimers; tetramers; pentamers) loaded with the CMV peptide NLMPMVATV (SEQ ID NO: 171), generating a population of MHC/peptide-coated PBMCs.
- the MHC multimers comprises multiple copies of HLA-A*0201 heavy chain/p2M heterodimers loaded with the CMV peptide.
- Magnetic beads are coated with antibody specific for the MHC heavy chain present in the MHC multimers.
- the antibody-coated magnetic beads are mixed with the MHC/peptide-coated PBMCs.
- Application of a magnetic field provides for separation of CMV-specific T cells from the starting population, generating an enriched CMV-specific T cell population.
- the enriched CMV-specific T cell population can include over 90% CMV-specific T cells.
- a population of PBMCs is obtained from a CMV- seropositive individual. This starting population of PBMCs contains less than 0.1% CMV-specific T cells.
- the starting population of PBMCs is coated with phycoerythrin (PE)-labeled MHC multimers (e.g., trimers; tetramers; pentamers) loaded with the CMV peptide NLMPMVATV (SEQ ID NO:171), generating a population of MHC/peptide-coated PBMCs.
- the CMV peptide-loaded, PE-labeled MHC multimers comprises multiple copies of HLA-A*0201 heavy chain/ ⁇ 2M heterodimers loaded with the CMV peptide.
- Magnetic beads are coated with antibody specific for PE.
- the antibody-coated magnetic beads are mixed with the MHC/peptide-coated PBMCs.
- Application of a magnetic field provides for separation of CMV-specific T cells from the starting population, generating an enriched CMV-specific T cell population.
- the enriched CMV-specific T cell population can include over 90% CMV-specific T cells.
- the patient’s blood optionally may be pre-screened to determine if it contains an appropriate target T cell for modification with a CAR.
- the patient’s blood may be drawn and T cells screened using the methods described above to determine if the patient already has T cells that are specific for a particular antigen, e.g., CMV, EBD, HPV, tetanus, influenza, etc.
- the composition comprising a quantity of T cells is contacted in vitro or in vivo with a composition comprising a T-cell modulatory polypeptide (e.g., a TMMP, as described herein) that binds to and activates substantially only the T cells comprising a TCR specific for the preselected antigen.
- a T-cell modulatory polypeptide e.g., a TMMP, as described herein
- a TMMP that binds to and activates substantially only the T cells comprising a TCR specific for the preselected antigen is thus a TMMP that either wholly or largely (but not wholly) binds to and activates only the T cells comprising a TCR specific for the preselected antigen.
- a TMMP that binds to and activates substantially only the T cells comprising a TCR specific for the preselected antigen may bind to and activate a relatively small percentage of T cells that are non-target T cells.
- in vitro is intended to connote any process, system, container, apparatus, equipment, etc. that is outside of the patient, i.e., ex vivo, for making, holding and/or delivering to the patient the mCTLs described herein.
- the starting cell population is obtained from an individual to be treated with a composition of the present disclosure, where the composition comprises a quantity of modified T cells (e.g., modified CTLs), and where, before the starting cell population is obtained from the individual, one or more doses of a TMMP, as described herein, has been administered to the individual.
- Administration of a TMMP to the individual, before obtaining the starting cell population from the individual, can increase the number of target T cells in the individual and therefore can increase the proportion of target T cells in the starting cell population.
- a TMMP comprising a peptide epitope is administered to an individual; and, at a time after such administration (e.g., 2-3 weeks), a starting cell population is obtained from the individual, where the starting cell population comprises target T cells comprising a TCR specific for the peptide epitope present in the TMMP.
- a method of the present disclosure for making an in vitro composition of cells of the present disclosure comprises: a) administering to an individual a TMMP comprising a peptide epitope; b) obtaining from the individual a composition comprising a quantity of T cells, where the quantity comprises target T cells having a TCR specific for the peptide epitope (a peptide epitope present in a preselected antigen); c) at least partially separating target T cells from non-target T cells comprising a TCR that is not specific for the peptide epitope, thereby generating an enriched target T cell population; and d) modifying the target T cells in the enriched target T cell population by introducing into the target T cells one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain specific for a cancer-associated antigen.
- a method of the present disclosure for making an in vitro composition of cells of the present disclosure comprises: a) administering to an individual a TMMP comprising a peptide epitope; b) at least partially separating target T cells having a TCR specific for the peptide epitope (a peptide epitope present in a preselected antigen) from non-target T cells comprising a TCR that is not specific for the peptide epitope present in a heterogeneous population of T cells obtained from the individual, thereby generating an enriched target T cell population; and c) modifying the target T cells in the enriched target T cell population by introducing into the target T cells one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain specific for a cancer-associated antigen.
- the TMMP is administered to the individual at a period of time of from 1 day to 1 month (e.g., from 1 day to 4 days, from 4 days to 7 days, from 1 week to 2 weeks, from 2 weeks to 3 weeks, or from 3 weeks to 1 month) before the starting cell population is obtained from the individual.
- multiple doses of the TMMP are administered to the individual before the starting cell population is obtained from the individual.
- step (ii) i.e., prior to the step of at least partially separating target
- the composition comprising a quantity of T cells is contacted in vitro with a composition comprising a TMMP that binds to and activates substantially only the T cells comprising a TCR specific for the preselected antigen.
- a composition comprising a TMMP that binds to and activates substantially only the T cells comprising a TCR specific for the preselected antigen Suitable TMMPs are described elsewhere herein.
- Contacting the T cells with a TMMP that binds to and activates substantially only the target T cells comprising a TCR specific for the preselected antigen stimulates proliferation of the target T cells, thereby increasing the number of target T cells.
- a method of the present disclosure for making an in vitro composition of cells of the present disclosure comprises modifying the target T cells in the enriched target T cell population by introducing into the target T cells one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain specific for a cancer- associated antigen.
- Any method known to those skilled in the art may be used to introduce into the target T cells one or more nucleic acids comprising nucleotide sequences encoding a CAR. A discussion of some known materials and methods is provided below.
- a nucleic acid comprising a nucleotide sequence encoding a CAR can be an expression vector, e.g., recombinant expression vector.
- the recombinant expression vector is a viral construct, e.g., a recombinant adeno-associated virus (AAV) construct, a recombinant adenoviral construct, a recombinant lentiviral construct, a recombinant retroviral construct, etc.
- a nucleic acid comprising a nucleotide sequence encoding a CAR is a recombinant lentivirus vector.
- a nucleic acid comprising a nucleotide sequence encoding a CAR is a recombinant AAV vector.
- the nucleotide sequences encoding the CAR can be operably linked to a transcriptional control element such as a promoter.
- a transcriptional control element such as a promoter
- the transcriptional control element e.g., a promoter
- Suitable promoters include constitutive promoters and regulatable (e.g., inducible) promoters.
- a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of an operably linked nucleotide sequence.
- CMV immediate early cytomegalovirus
- EF-la Elongation Growth Factor-la
- constitutive promoter sequences may also be used, including, but not limited to, the simian virus 40 (SV40) early promoter, MND (myeloproliferative sarcoma virus) promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, Moloney Murine Leukemia Virus (MoMuLV) promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter.
- SV40 simian virus 40
- MND myeloproliferative sarcoma virus
- MMTV mouse mammary tumor virus
- HSV human immunodeficiency virus
- LTR long terminal repeat
- MoMuLV Molone
- inducible promoters include, but are not limited to, a metallothionine promoter, a glucocorticoid-inducible promoter, a progesterone-inducible promoter, and a tetracycline-inducible promoter.
- the promoter is a CD8 cell-specific promoter, a CD4 cell-specific promoter, a neutrophil-specific promoter, or an NK-specific promoter.
- a CD4 gene promoter can be used; see, e.g., Salmon et al. (1993) Proc. Natl. Acad. Sci. USA 90: 7739; and Marodon et al. (2003) Blood 101:3416.
- a CD8 gene promoter can be used.
- NK cell-specific expression can be achieved by use of an Ncrl (p46 ) promoter; see, e.g., Eckelhart et al. (2011) Blood 117:1565.
- Any method of introducing nucleic acids into cells can be used to introduce nucleic acid(s) encoding a CAR into target T cells. Suitable methods include viral transfection (e.g., where the nucleic acid is a lentiviral vector or other viral vector comprising a nucleotide sequence encoding a CAR), electroporation, diethylaminoethyl (DEAE)-dextran-mediated transfection, lipofection, and the like.
- viral transfection e.g., where the nucleic acid is a lentiviral vector or other viral vector comprising a nucleotide sequence encoding a CAR
- electroporation e.g., where the nucleic acid is a lentiviral vector or other viral vector comprising a nucleotide sequence encoding a CAR
- electroporation e.g., where the nucleic acid is a lentiviral vector or other viral vector comprising a nucleotide sequence
- allogeneic T cells can be used instead of (or in addition to) T cells removed from the patient. If a heterogenous population of allogeneic T cells is employed as a starting material, then an enriched population optionally can be prepared as described above.
- the target modified T cells made from allogeneic T cells thus can contain both a TCR specific for a preselected antigen (including such TCRs expressed as a result of gene-editing), as well as one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain specific for a cancer-associated antigen.
- the target modified T cells prepared from allogeneic T cells then would be employed for treatment in the same manner as described herein for patient-derived target modified T cells.
- the present disclosure provides a method of treating cancer in an individual having a cancer.
- the method comprises: (a) administering to the individual a composition comprising a quantity of genetically modified CTLs of the present disclosure (e.g., modified CTLs prepared according to a method of the present disclosure), where the genetically modified CTLs express a CAR on their cell surface, where the CAR comprises an antigen-binding domain (e.g., an antibody) specific for a cancer- associated peptide; and (b) administering to the individual a composition comprising a TMMP.
- the TMMP selectively binds to and activates T cells comprising a TCR specific for the preselected antigen.
- T cells comprising a TCR specific for the preselected antigen will in many cases be genetically modified CTLs as described herein.
- the number and activity of such cells is increased, such that activated, genetically modified CTLs target and kill tumor cells that bear on their surface the cancer-associated epitope for which the CAR is specific.
- a method of the present disclosure comprises administering an effective amount of a modified CTL of the present disclosure and an effective amount of a TMMP.
- TMMP are amounts that, when administered in one or more doses to an individual in need thereof, lead to a reduction in the number of cancer cells in the individual.
- the amount that is an effective amount may depend on whether the patient is receiving additional treatments in combination with the modified CTL, including additional treatments with TMMPs as discussed herein.
- “effective amounts” of a modified CTL of the present disclosure and a TMMP are amounts that, when administered in one or more doses to an individual in need thereof, leads to a reduction in the number of cancer cells in the individual by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, compared to the number of cancer cells in the individual before administration of the modified CTL and the TMMP, or in the absence of administration with the modified CTL and the TMMP.
- “effective amounts” of a modified CTL of the present disclosure and a TMMP are amounts that, when administered in one or more doses to an individual in need thereof, leads to a reduction in the number of cancer cells in the individual to undetectable levels. [00159] In some cases, “effective amounts” of a modified CTL of the present disclosure and a
- TMMP are amounts that, when administered in one or more doses to an individual in need thereof, leads to a reduction in the tumor mass in the individual.
- “effective amounts” of a modified CTL of the present disclosure and a TMMP are amounts that, when administered in one or more doses to an individual in need thereof (an individual having a tumor), leads to a reduction in the tumor mass in the individual by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, compared to the tumor mass in the individual before administration of the modified CTL and the TMMP, or in the absence of administration of the modified CTL and the TMP.
- “effective amounts” of a modified CTL of the present disclosure and a TMMP are amounts that, when administered in one or more doses to an individual in need thereof (an individual having a tumor), leads to a reduction in the tumor volume in the individual.
- “effective amounts” of a modified CTL of the present disclosure and a TMMP are amounts that, when administered in one or more doses to an individual in need thereof (an individual having a tumor), reduces the tumor volume in the individual by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, compared to the tumor volume in the individual before administration of the modified CTL and the TMMP, or in the absence of administration with the modified CTL and the TMMP.
- “effective amounts” of a modified CTL of the present disclosure and a TMMP are amounts that, when administered in one or more doses to an individual in need thereof, leads to an increase in survival time of the individual.
- “effective amounts” of a modified CTL of the present disclosure and a TMMP are amounts that, when administered in one or more doses to an individual in need thereof, leads to an increase in survival time of the individual by at least 1 month, at least 2 months, at least 3 months, from 3 months to 6 months, from 6 months to 1 year, from 1 year to 2 years, from 2 years to 5 years, from 5 years to 10 years, or more than 10 years, compared to the expected survival time of the individual in the absence of administration with the modified CTL and the TMMP.
- the modified CTL and the TMMP are administered at the same time. In some cases, the modified CTL and the TMMP are administered to an individual within about 1 minute to about 24 hours (e.g., within about 1 minute, within about 5 minutes, within about 15 minutes, within about 30 minutes, within about 1 hour, within about 4 hours, within about 8 hours, within about 12 hours, or within about 24 hours) of one another.
- a method of the present disclosure comprises: a) administering a TMMP; and b) after a period of time, administering a modified CTL.
- a TMMP is administered from 1 week to 4 weeks (e.g., 1 week, 2 weeks, 3 weeks, or 4 weeks) before the modified CTL is administered.
- multiple doses of a TMMP are administered to an individual before a modified CTL is administered to the individual.
- a method of the present disclosure comprises: a) administering multiple doses of a TMMP; and b) after a period of time, administering a modified CTL.
- a method of the present disclosure comprises: a) administering a modified
- a modified CTL is administered from 1 week to 4 weeks (e.g., 1 week, 2 weeks, 3 weeks, or 4 weeks) before the TMMP is administered.
- multiple doses of a TMMP are administered to an individual after the modified CTL is administered to the individual.
- a method of the present disclosure comprises: a) administering a modified CTL; and b) after a period of time, administering multiple doses of a TMMP to the individual.
- a method of the present disclosure comprises: a) a) administering a
- TMMP TMMP
- b after a period of time, administering a modified CTL
- c after a period of time, administering the TMMP.
- a TMMP is administered from 1 week to 4 weeks (e.g., 1 week, 2 weeks, 3 weeks, or 4 weeks) before the modified CTL is administered; and, after the CTL is administered, one or more additional doses of the TMMP is administered to the individual.
- multiple doses of a TMMP are administered to an individual before a modified CTL is administered to the individual; and multiple doses of the TMMP are administered to the individual after the modified CTL is administered.
- Cancers that can be treated with a method of the present disclosure include any cancer that can be targeted with a CAR. Cancers that can be treated with a method of the present disclosure include carcinomas, sarcomas, melanoma, leukemias, and lymphomas. Cancers that can be treated with a method of the present disclosure include solid tumors. Cancers that can be treated with a method of the present disclosure include metastatic cancers.
- Carcinomas that can treated by a method disclosed herein include, but are not limited to, esophageal carcinoma, hepatocellular carcinoma, basal cell carcinoma (a form of skin cancer), squamous cell carcinoma (various tissues), bladder carcinoma, including transitional cell carcinoma (a malignant neoplasm of the bladder), bronchogenic carcinoma, colon carcinoma, colorectal carcinoma, gastric carcinoma, lung carcinoma, including small cell carcinoma and non-small cell carcinoma of the lung, adrenocortical carcinoma, thyroid carcinoma, pancreatic carcinoma, breast carcinoma, ovarian carcinoma, prostate carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinoma, cystadenocarcinoma, medullary carcinoma, renal cell carcinoma, ductal carcinoma in situ or bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical carcinoma, uterine carcinoma, testicular carcinoma,
- Sarcomas that can be treated by a method disclosed herein include, but are not limited to, fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, chordoma, osteogenic sarcoma, osteosarcoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's sarcoma, leiomyosarcoma, rhabdomyosarcoma, and other soft tissue sarcomas.
- solid tumors that can be treated by a method disclosed herein include, but are not limited to, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma, and retinoblastoma.
- Leukemias that can be amenable to therapy by a method disclosed herein include, but are not limited to, a) chronic myeloproliferative syndromes (neoplastic disorders of multipotential hematopoietic stem cells); b) acute myelogenous leukemias (neoplastic transformation of a multipotential hematopoietic stem cell or a hematopoietic cell of restricted lineage potential; c) chronic lymphocytic leukemias (CLL; clonal proliferation of immunologically immature and functionally incompetent small lymphocytes), including B-cell CLL, T-cell CLL prolymphocytic leukemia, and hairy cell leukemia; and d) acute lymphoblastic leukemias (characterized by accumulation of lymphoblasts).
- CLL chronic lymphocytic leukemias
- Lymphomas that can be treated using a subject method include, but are not limited to, B-cell lymphomas (e.g., Burkitt's lymphoma); Hodgkin's lymphoma; non-Hodgkin's lymphoma, and the like.
- B-cell lymphomas e.g., Burkitt's lymphoma
- Hodgkin's lymphoma e.g., Hodgkin's lymphoma
- non-Hodgkin's lymphoma e.g., Hodgkin's lymphoma
- cancers that can be treated according to the methods disclosed herein include atypical meningioma, islet cell carcinoma, medullary carcinoma of the thyroid, mesenchymoma, hepatocellular carcinoma, hepatoblastoma, clear cell carcinoma of the kidney, and neurofibroma mediastinum.
- Suitable formulations comprising a modified CTL, or a TMMP include a pharmaceutically acceptable excipient.
- a suitable formulation comprises: a) a modified CTL of the present disclosure; and b) a pharmaceutically acceptable excipient.
- a suitable formulation comprises: a) a TMMP; and b) a pharmaceutically acceptable excipient.
- the composition may comprise a pharmaceutically acceptable excipient, a variety of which are known in the art and need not be discussed in detail herein. Pharmaceutically acceptable excipients have been amply described in a variety of publications, including, for example, “Remington: The Science and Practice of Pharmacy”,
- a pharmaceutical composition can comprise a modified CTL of the present disclosure, and a pharmaceutically acceptable excipient; or can comprise a TMMP and a pharmaceutically acceptable excipient.
- a subject pharmaceutical composition will be suitable for administration to a subject, e.g., will be sterile.
- a subject pharmaceutical composition will be suitable for administration to a human subject, e.g., where the composition is sterile and is free of detectable pyrogens and/or other toxins.
- a suitable dosage of a TMMP or a modified CTL can be determined by an attending physician or other qualified medical personnel, based on various clinical factors. As is well known in the medical arts, dosages for any one patient depend upon many factors, including the patient's size, body surface area, age, the particular TMMP or modified CTL to be administered, sex of the patient, time, and route of administration, general health, and other drugs being administered concurrently.
- a TMMP may be administered in amounts between 1 ng/kg body weight and 20 mg/kg body weight per dose, e.g. between 0.1 mg/kg body weight to 10 mg/kg body weight, e.g. between 0.1 mg/kg body weight and 4 mg/kg body weight, between 0.5 mg/kg body weight and 2 mg/kg body weight, or between 0.5 mg/kg body weight and 5 mg/kg body weight; however, doses below or above this exemplary range are envisioned, especially considering the aforementioned factors. If the regimen is a continuous infusion, it can also be in the range of 1 pg to 10 mg per kilogram of body weight per minute.
- a TMMP can be administered in an amount of from about 1 mg/kg body weight to 50 mg/kg body weight, e.g., from about 1 mg/kg body weight to about 5 mg/kg body weight, from about 5 mg/kg body weight to about 10 mg/kg body weight, from about 10 mg/kg body weight to about 15 mg/kg body weight, from about 15 mg/kg body weight to about 20 mg/kg body weight, from about 20 mg/kg body weight to about 25 mg/kg body weight, from about 25 mg/kg body weight to about 30 mg/kg body weight, from about 30 mg/kg body weight to about 35 mg/kg body weight, from about 35 mg/kg body weight to about 40 mg/kg body weight, or from about 40 mg/kg body weight to about 50 mg/kg body weight.
- a suitable dose of a TMMP is from 0.01 pg to 100 g per kg of body weight, from 0.1 pg to 10 g per kg of body weight, from 1 pg to 1 g per kg of body weight, from 10 pg to 100 mg per kg of body weight, from 100 pg to 10 mg per kg of body weight, or from 100 pg to 1 mg per kg of body weight.
- Persons of ordinary skill in the art can easily estimate repetition rates for dosing based on measured residence times and concentrations of the administered agent in bodily fluids or tissues.
- a TMMP is administered in maintenance doses, ranging from 0.01 pg to 100 g per kg of body weight, from 0.1 pg to 10 g per kg of body weight, from 1 pg to 1 g per kg of body weight, from 10 pg to 100 mg per kg of body weight, from 100 pg to 10 mg per kg of body weight, or from 100 pg to 1 mg per kg of body weight.
- a suitable dose of modified CTLs that is equal to or less than a number selected from the group consisting of 10 cells/kg body weight, 10 2 cells/kg body weight, 10 3 cells/kg body weight, 10 4 cells/kg body weight, 10 5 cells/kg body weight, 10 6 cells/kg body weight, 10 7 cells/kg body weight, 10 8 cells/kg body weight, and 10 9 cells/kg body weight.
- a suitable dose of modified CTLs is from about 10 cells/kg body weight to about 10 2 cells/kg body weight, from about 10 2 cells/kg body weight to about 10 3 cells/kg body weight, from about 10 3 cells/kg body weight to about 10 4 cells/kg body weight, from about 10 4 cells/kg body weight to about 10 5 cells/kg body weight, from about 10 5 cells/kg body weight to about 10 6 cells/kg body weight, from about 10 6 cells/kg body weight to about 10 7 cells/kg body weight, from about 10 7 cells/kg body weight to about 10 8 cells/kg body weight, or from about 10 8 cells/kg body weight to about 10 9 cells/kg body weight.
- modified CTLs can be employed, e.g., less than about 10 7 cells/kg body weight, less than about 10 6 cells/kg body weight, less than about 10 5 cells/kg body weight, less than about 10 4 cells/kg body weight or less than about 10 3 cells/kg body weight.
- dose levels can vary as a function of the specific TMMP or the modified CTL, the severity of the symptoms, and the susceptibility of the subject to side effects. Preferred dosages for a given TMMP or modified CTL are readily determinable by those of skill in the art by a variety of means.
- An active agent (a modified CTL; a TMMP) is administered to an individual using any available method and route suitable for drug delivery, including in vivo and ex vivo methods, as well as systemic and localized routes of administration.
- routes of administration include intratumoral, peritumoral, intramuscular, intralymphatic, intratracheal, intracranial, subcutaneous, intradermal, topical application, intravenous, intraarterial, rectal, nasal, oral, and other enteral and parenteral routes of administration. Routes of administration may be combined, if desired, or adjusted depending upon the TMMP, the modified CTL, and/or the desired effect.
- a modified CTL of the present disclosure can be administered in a single dose or in multiple doses.
- a TMMP can be administered in a single dose or in multiple doses.
- a modified CTL can be administered via the same route of administration as the TMMP.
- a modified CTL can be administered via a different route of administration from the TMMP.
- a modified CTL of the present disclosure is administered intravenously.
- a modified CTL of the present disclosure is administered intralymphatically. In some cases, a modified CTL of the present disclosure is administered locally. In some cases, a modified CTL of the present disclosure is administered intratumorally. In some cases, a modified CTL of the present disclosure is administered peritumorally. In some cases, a modified CTL of the present disclosure is administered intracranially.
- a TMMP is administered intravenously. In some cases, a TMMP is administered intramuscularly. In some cases, a TMMP is administered intralymphatically. In some cases, a TMMP is administered locally. In some cases, a TMMP is administered intratumorally. In some cases, a TMMP is administered peritumorally. In some cases, a TMMP is administered intracranially. In some cases, a TMMP is administered subcutaneously.
- a method of the present disclosure for treating cancer in an individual comprises: a) administering a modified CTL of the present disclosure; b) administering a TMMP; and c) administering at least one additional therapeutic agent or therapeutic treatment.
- additional therapeutic agents include, but are not limited to, small molecule cancer chemotherapeutic agents, biologic anti-cancer agents, e.g., antibodies, fusion proteins and bi-specific antibodies, and immune checkpoint inhibitors.
- Suitable additional therapeutic treatments include, e.g., radiation, surgery (e.g., surgical resection of a tumor), and the like.
- a treatment method of the present disclosure can comprise co- administration of: a) a modified CTL of the present disclosure; b) a TMMP; and c) an immune checkpoint inhibitor, such as an antibody specific for an immune checkpoint.
- a modified CTL of the present disclosure and a TMMP are administered to an individual who is undergoing treatment with, or who has undergone treatment with, an antibody or other agent specific for an immune checkpoint.
- immune checkpoint inhibitors include inhibitors that target immune checkpoint polypeptides such as CD27, CD28, CD40, CD122, CD96, CD73, CD47, 0X40, GITR, CSF1R, JAK, PI3K delta, PI3K gamma, TAM, arginase, CD137 (also known as 4-1BB), ICOS, A2AR, B7-H3, B7-H4, BTLA, CTLA-4, LAG3, TIM3, VISTA, CD96, TIGIT, CD122, PD-1, PD-L1, and PD- L2.
- target immune checkpoint polypeptides such as CD27, CD28, CD40, CD122, CD96, CD73, CD47, 0X40, GITR, CSF1R, JAK, PI3K delta, PI3K gamma, TAM, arginase, CD137 (also known as 4-1BB), ICOS, A2AR, B7-H3, B7-H4, BT
- the immune checkpoint polypeptide is a stimulatory checkpoint molecule selected from CD27, CD28, CD40, ICOS, 0X40, GITR, CD122 and CD137. In some cases, the immune checkpoint polypeptide is an inhibitory checkpoint molecule selected from A2AR, B7-H3, B7-H4, BTLA, CTLA-4, IDO, KIR, LAG3, PD-1, TIM3, CD96, TIGIT and VISTA.
- the immune checkpoint inhibitor is an antibody specific for an immune checkpoint.
- the anti-immune checkpoint antibody is a monoclonal antibody.
- the anti-immune checkpoint antibody is humanized, or de-immunized such that the antibody substantially does not elicit an immune response in a human, or elicits an immune response that is acceptable for at least some percentage of patients.
- the anti-immune checkpoint antibody is a humanized monoclonal antibody.
- the anti -immune checkpoint antibody is a de- immunized monoclonal antibody.
- the anti -immune checkpoint antibody is a fully human monoclonal antibody.
- the anti-immune checkpoint antibody inhibits binding of the immune checkpoint polypeptide to a ligand for the immune checkpoint polypeptide. In some cases, the anti-immune checkpoint antibody inhibits binding of the immune checkpoint polypeptide to a receptor for the immune checkpoint polypeptide.
- Suitable anti -immune checkpoint antibodies include, but are not limited to, nivolumab
- the immune checkpoint inhibitor is an anti-PD-1 antibody.
- Suitable anti-PD-1 antibodies include, e.g., nivolumab, pembrolizumab (also known as MK-3475), pidilizumab, SHR-1210, PDR001, and AMP-224.
- the anti-PD-1 monoclonal antibody is nivolumab, pembrolizumab or PDR00F Suitable anti-PDl antibodies are described in U.S. Patent Publication No. 2017/0044259. For pidilizumab, see, e.g., Rosenblatt et al. (2011) J. Immunother. 34:409-18.
- the immune checkpoint inhibitor is an anti-CTLA-4 antibody.
- the anti-CTLA-4 antibody is ipilimumab or tremelimumab.
- the immune checkpoint inhibitor is an anti-PD-Ll antibody.
- the anti-PD- L1 monoclonal antibody is BMS-935559, MEDI4736, MPDL3280A (also known as RG7446), KN035, or MSB0010718C.
- the anti-PD-Ll monoclonal antibody is MPDL3280A (atezolizumab) or MEDI4736 (durvalumab).
- durvalumab see, e.g., WO 2011/066389.
- atezolizumab see, e.g., U.S. Patent No. 8,217,149.
- Subjects suitable for treatment with a method of the present disclosure include individuals who have cancer, including individuals who have been diagnosed as having cancer but have not yet undergone treatment, individuals who have been treated for cancer but who failed to respond to the treatment, and individuals who have been treated for cancer and who initially responded but subsequently became refractory to the treatment.
- the individual already will have been treated with an immune checkpoint inhibitor, e.g., nivolumab or pembrolizumab, as described above.
- the individual being treated according to a method of the present disclosure has not undergone a lymphodepleting regimen prior to administration of a modified CTL of the present disclosure and/or prior to administration of a TMMP.
- the individual being treated according to a method of the present disclosure has undergone a lymphodepleting regimen prior to administration of a modified CTL of the present disclosure and/or prior to administration of a TMMP.
- the lymphodepletion regimen is a non-myeloablative lymphodepletion regimen. Lymphodepletion can be accomplished by administering to the individual: i) cyclophosphamide/fludarabine combination; or ii) cyclophosphamide alone.
- a TMMP suitable for use in a method of the present disclosure comprises a heterodimer comprising: a) a first polypeptide comprising: i) a peptide epitope, wherein the peptide epitope is a peptide having a length of at least 4 amino acids (e.g., from 4 amino acids to about 25 amino acids); and ii) a first major histocompatibility complex (MHC) polypeptide; b) a second polypeptide comprising a second MHC polypeptide; and c) at least one immunomodulatory polypeptide, where the first and/or the second polypeptide comprises the at least one immunomodulatory polypeptide.
- the TMMP optionally also includes an immunoglobulin (Ig) Fc polypeptide or a non-Ig scaffold, where the first and/or the second polypeptide comprises the Ig Fc polypeptide or the non-Ig scaffold.
- peptide epitope means a peptide that, when complexed with
- a peptide epitope has a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa, including within a range of from 4 to 20 aa., from 6 to 18 aa., from 8 to 15 aa.
- a peptide epitope can present one or more epitopes to one or more TCRs.
- the peptide epitope present in a TMMP presents an infectious disease- associated epitope (e.g., a virus-encoded peptide).
- a TMMP comprises a heterodimeric polypeptide comprising: a) a first polypeptide comprising: i) a peptide epitope; and ii) a first MHC polypeptide; b) a second polypeptide comprising a second MHC polypeptide; c) at least one immunomodulatory polypeptide, where the first and/or the second polypeptide comprises the at least one (i.e., one or more) immunomodulatory polypeptide; and, optionally, d) an Ig Fc polypeptide or a non-Ig scaffold, where the first and/or the second polypeptide comprises the Ig Fc polypeptide or the non-Ig scaffold.
- the at least one immunomodulatory polypeptide is wild-type, i.e., comprises an amino acid sequence of a naturally- occurring immunomodulatory polypeptide.
- At least one of the one or more immunomodulatory polypeptides is a variant immunomodulatory polypeptide that exhibits reduced affinity to a cognate co- immunomodulatory polypeptide compared to the affinity of a corresponding wild-type immunomodulatory polypeptide for the cognate co-immunomodulatory polypeptide.
- the peptide epitope present in a TMMP of the present disclosure binds to a T-cell receptor (TCR) on a T cell with an affinity of at least 100 ⁇ M (e.g., at least 10 ⁇ M, at least 1 ⁇ M, at least 100 nM, at least 10 nM, or at least 1 nM).
- a TMMP of the present disclosure binds to a first T cell with an affinity that is at least 25% higher than the affinity with which the TMMP binds a second T cell, where the first T cell expresses on its surface the cognate co-immunomodulatory polypeptide and a TCR that binds the epitope with an affinity of at least 100 ⁇ M, and where the second T cell expresses on its surface the cognate co-immunomodulatory polypeptide but does not express on its surface a TCR that binds the epitope with an affinity of at least 100 ⁇ M (e.g., at least 10 ⁇ M, at least 1 ⁇ M, at least 100 nM, at least 10 nM, or at least 1 nM).
- a TMMP is: [00193] A) a heterodimer comprising: a) a first polypeptide comprising a first MHC polypeptide; and b) a second polypeptide comprising a second MHC polypeptide, wherein the first polypeptide or the second polypeptide comprises a peptide epitope, wherein the first polypeptide and/or the second polypeptide comprises one or more immunomodulatory polypeptides that can be the same or different, and wherein at least one of the one or more immunomodulatory polypeptides may be a wild-type immunomodulatory polypeptide or a variant of a wild- type immunomodulatory polypeptide, wherein the variant immunomodulatory polypeptide comprises 1, 2, 3, 4, 5, 6, 7, 8, 9,10, 11, 12, 13, 14, 15, 16, 17,
- first polypeptide and/or the second polypeptide comprises an Ig Fc polypeptide or a non-Ig scaffold;
- a heterodimer comprising: a) a first polypeptide comprising a first MHC polypeptide; and b) a second polypeptide comprising a second MHC polypeptide, wherein the first polypeptide or the second polypeptide comprises an epitope; wherein the first polypeptide and/or the second polypeptide comprises one or more immunomodulatory polypeptides that can be the same or different,
- the one or more immunomodulatory polypeptides is a variant of a wild-type immunomodulatory polypeptide, wherein the variant immunomodulatory polypeptide comprises 1, 2, 3, 4, 5, 6, 7, 8, 9,10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid substitutions compared to the amino acid sequence of the corresponding wild- type immunomodulatory polypeptide, [00196] wherein at least one of the one or more immunomodulatory domains is a variant immunomodulatory polypeptide that exhibits reduced affinity to a cognate co-immunomodulatory polypeptide compared to the affinity of a corresponding wild-type immunomodulatory polypeptide for the cognate co-immunomodulatory polypeptide, and wherein the epitope binds to a TCR on a T cell with an affinity of at least 10 -7 M, such that: i) the TMMP polypeptide binds to a first T cell with an affinity that is at least 25% higher than the affinity with which the TMMP binds
- C) a heterodimer comprising: a) a first polypeptide comprising, in order from N-terminus to C-terminus: i) an epitope; ii) a first MHC polypeptide; and b) a second polypeptide comprising, in order from N-terminus to C-terminus: i) a second MHC polypeptide; and ii) optionally an immunoglobulin (Ig) Fc polypeptide or a non-Ig scaffold, wherein the TMMP comprises one or more immunomodulatory domains that can be the same or different, wherein at least one of the one or more immunomodulatory domain is: A) at the C-terminus of the first polypeptide; B) at the N-terminus of the second polypeptide; C) at the C-terminus of the second polypeptide; or D) at the C-terminus of the first polypeptide and at the N-terminus of the second polypeptide, and wherein at least one of the one or more immunomodul
- the epitope present in a TMMP binds to a TCR on a T cell with an affinity of from about 10 -4 M to about 5 x 10 -4 M, from about 5 x 10 -4 M to about 10 -5 M, from about 10 -5 M to 5 x 10 -5 M, from about 5 x 10 -5 M to 10 -6 M, from about 10 -6 M to about 5 x 10 -6 M, from about 10 -6 M to about 5 x 10 -6 M, from about 5 x 10 -6 M to about 10 -7 M, from about 10 -7 M to about 5 x 10 -7 M, from about 5 x 10 -7 M to about 10 -8 M, or from about 10 -8 M to about 10 -9 M.
- the epitope present in a TMMP of the present disclosure binds to a TCR on a T cell with an affinity of from about 1 nM to about 5 nM, from about 5 nM to about 10 nM, from about 10 nM to about 50 nM, from about 50 nM to about 100 nM, from about 0.1 ⁇ M to about 0.5 ⁇ M, from about 0.5 ⁇ M to about 1 ⁇ M, from about 1 ⁇ M to about 5 ⁇ M, from about 5 ⁇ M to about 10 ⁇ M, from about 10 ⁇ M to about 25 ⁇ M, from about 25 ⁇ M to about 50 ⁇ M, from about 50 ⁇ M to about 75 ⁇ M, from about 75 ⁇ M to about 100 ⁇ M.
- an immunomodulatory polypeptide present in a TMMP comprises a wild- type (naturally-occurring) amino acid sequence.
- an immunomodulatory polypeptide present in a TMMP binds to its cognate co-immunomodulatory polypeptide with an affinity that it at least 10% less, at least 15% less, at least 20% less, at least 25% less, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the affinity of a corresponding wild-type immunomodulatory polypeptide for the cognate co- immunomodulatory polypeptide.
- a variant immunomodulatory polypeptide present in a TMMP has a binding affinity for a cognate co-immunomodulatory polypeptide that is from 1 nM to 100 nM, or from 100 nM to 100 ⁇ M.
- a variant immunomodulatory polypeptide present in a TMMP has a binding affinity for a cognate co-immunomodulatory polypeptide that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ M, to about 1 ⁇ M to about 5 ⁇ M, from about 5 ⁇ M to about 10 ⁇ M, from about 10 ⁇ M to about 15 ⁇ M, from about 15 ⁇ M to about 20 ⁇ M,
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure has a binding affinity for a cognate co-immunomodulatory polypeptide that is from about 1 nM to about 5 nM, from about 5 nM to about 10 nM, from about 10 nM to about 50 nM, from about 50 nM to about 100 nM [00204]
- the combination of the reduced affinity of the immunomodulatory polypeptide for its cognate co-immunomodulatory polypeptide, and the affinity of the epitope for a TCR provides for enhanced selectivity of a TMMP.
- a TMMP binds selectively to a first T cell that displays both: i) a TCR specific for the epitope present in the TMMP; and ii) a co- immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP, compared to binding to a second T cell that displays: i) a TCR specific for an epitope other than the epitope present in the TMMP; and ii) a co-immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP.
- a TMMP binds to the first T cell with an affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 2-fold, at least 2.5-fold, at least 5-fold, at least 10-fold, at least 15-fold, at least 20-fold, at least 25-fold, at least 50-fold, at least 100-fold, or more than 100-fold, higher than the affinity to which it binds the second T cell.
- a TMMP when administered to an individual in need thereof, induces both an epitope-specific T cell response and an epitope non-specific T cell response.
- a TMMP when administered to an individual in need thereof, induces an epitope-specific T cell response by modulating the activity of a first T cell that displays both: i) a TCR specific for the epitope present in the TMMP; ii) a co-immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP; and induces an epitope non-specific T cell response by modulating the activity of a second T cell that displays: i) a TCR specific for an epitope other than the epitope present in the TMMP; and ii) a co-immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP.
- the ratio of the epitope-specific T cell response to the epitope-non-specific T cell response is at least 2:1, at least 5:1, at least 10:1, at least 15:1, at least 20:1, at least 25:1, at least 50:1, or at least 100:1.
- the ratio of the epitope-specific T cell response to the epitope-non-specific T cell response is from about 2:1 to about 5:1, from about 5:1 to about 10:1, from about 10:1 to about 15:1, from about 15:1 to about 20:1, from about 20:1 to about 25:1, from about 25:1 to about 50:1, or from about 50:1 to about 100:1, or more than 100:1.
- Modulating the activity” of a T cell can include one or more of: i) activating a cytotoxic (e.g., CD8 + ) T cell; ii) inducing cytotoxic activity of a cytotoxic (e.g., CD8 + ) T cell; iii) inducing production and release of a cytotoxin (e.g., a perforin; a granzyme; a granulysin) by a cytotoxic (e.g., CD8 + ) T cell; iv) inhibiting activity of an autoreactive T cell; and the like.
- a cytotoxic e.g., CD8 +
- a cytotoxic activity of a cytotoxic e.g., CD8 +
- a cytotoxin e.g., a perforin; a granzyme; a granulysin
- TMMP binds with higher avidity to a first T cell that displays both: i) a TCR specific for the epitope present in the TMMP; and ii) a co- immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP, compared to the avidity to which it binds to a second T cell that displays: i) a TCR specific for an epitope other than the epitope present in the TMMP; and ii) a co-immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP.
- Binding affinity between an immunomodulatory polypeptide and its cognate co- immunomodulatory polypeptide can be determined by bio-layer interferometry (BLI) using purified immunomodulatory polypeptide and purified cognate co-immunomodulatory polypeptide.
- Binding affinity between a TMMP and its cognate co-immunomodulatory polypeptide can be determined by BLI using purified TMMP and the cognate co-immunomodulatory polypeptide.
- BLI methods are well known to those skilled in the art. See, e.g., Lad et al. (2015) J. Biomol. Screen. 20(4):498-507; and Shah and Duncan (2014) J. Vis. Exp. 18:e51383.
- a BLI assay can be carried out using an Octet RED 96 (Pal ForteBio) instrument, or a similar instrument, as follows.
- a TMMP e.g., a TMMP of the present disclosure; a control TMMP (where a control TMMP comprises a wild-type immunomodulatory polypeptide)
- the immobilized TMMP is the “target.” Immobilization can be effected by immobilizing a capture antibody onto the insoluble support, where the capture antibody immobilizes the TMMP.
- immobilization can be effected by immobilizing anti-Fc (e.g., anti-human IgG Fc) antibodies onto the insoluble support, where the immobilized anti-Fc antibodies bind to and immobilize the TMMP (where the TMMP comprises an IgFc polypeptide).
- a co- immunomodulatory polypeptide is applied, at several different concentrations, to the immobilized TMMP, and the instrument’s response recorded.
- Assays are conducted in a liquid medium comprising 25mM HEPES pH 6.8, 5% poly(ethylene glycol) 6000, 50 mM KC1, 0.1% bovine serum albumin, and 0.02% Tween 20 nonionic detergent.
- Binding of the co-immunomodulatory polypeptide to the immobilized TMMP is conducted at 30°C.
- an anti-MHC Class I monoclonal antibody can be used as a positive control for binding affinity.
- anti-HLA Class I monoclonal antibody W6/32 (American Type Culture Collection No. HB-95; Parham et al. (1979) J. Immunol. 123:342), which has a K D of 7 nM, can be used.
- a standard curve can be generated using serial dilutions of the anti-MHC Class I monoclonal antibody.
- the co-immunomodulatory polypeptide, or the anti-MHC Class I mAh is the “analyte.”
- BLI analyzes the interference pattern of white light reflected from two surfaces: i) from the immobilized polypeptide (“target”); and ii) an internal reference layer.
- a change in the number of molecules (“analyte”; e.g., co-immunomodulatory polypeptide; anti-HLA antibody) bound to the biosensor tip causes a shift in the interference pattern; this shift in interference pattern can be measured in real time.
- the two kinetic terms that describe the affinity of the target/analyte interaction are the association constant (k a ) and dissociation constant (k d ). The ratio of these two terms (kjp gives rise to the affinity constant KD-
- the BLI assay is carried out in a multi-well plate.
- the plate layout is defined, the assay steps are defined, and biosensors are assigned in Octet Data Acquisition software.
- the biosensor assembly is hydrated.
- the hydrated biosensor assembly and the assay plate are equilibrated for 10 minutes on the Octet instrument.
- the acquired data are loaded into the Octet Data Analysis software.
- the data are processed in the Processing window by specifying method for reference subtraction, y-axis alignment, inter-step correction, and Savitzky-Golay filtering.
- Data are analyzed in the Analysis window by specifying steps to analyze (Association and Dissociation), selecting curve fit model (1:1), fitting method (global), and window of interest (in seconds).
- K D values for each data trace can be averaged if within a 3 -fold range.
- K D error values should be within one order of magnitude of the affinity constant values; R 2 values should be above 0.95. See, e.g., Abdiche et al. (2008) J. Anal. Biochem. 377:209.
- the affinity of a TMMP for a cognate co- immunomodulatory polypeptide, or the affinity of a control TMMP (where a control TMMP comprises a wild-type immunomodulatory polypeptide) for a cognate co-immunomodulatory polypeptide is determined using BLI, as described above.
- the ratio of: i) the binding affinity of a control TMMP (where the control comprises a wild-type immunomodulatory polypeptide) to a cognate co-immunomodulatory polypeptide to ii) the binding affinity of a TMMP of the present disclosure comprising a variant of the wild-type immunomodulatory polypeptide to the cognate co-immunomodulatory polypeptide, when measured by BLI (as described above), is at least 1.5:1, at least 2:1, at least 5:1, at least 10:1, at least 15:1, at least 20:1, at least 25:1, at least 50:1, at least 100:1, at least 500:1, at least 10 2 : 1 , at least 5 x 10 2 : 1 , at least 10 3 : 1 , at least 5 x 10 3 : 1 , at least 10 4 : 1 , at least 10 5 : 1 , or at least 10 6 :1.
- the ratio of: i) the binding affinity of a control TMMP (where the control comprises a wild-type immunomodulatory polypeptide) to a cognate co-immunomodulatory polypeptide to ii) the binding affinity of a TMMP comprising a variant of the wild-type immunomodulatory polypeptide to the cognate co- immunomodulatory polypeptide, when measured by BLI, is in a range of from 1.5:1 to 10 6 : 1 , e.g., from 1.5:1 to 10:1, from 10:1 to 50:1, from 50:1 to 10 2 : 1 , from 10 2 : 1 to 10 3 : 1 , from10 3 :l to 10 4 : 1 , from 10 4 : 1 to 10 5 : 1 , or from 10 5 : 1 to 10 6 :1.
- a control TMMP comprises a wild-type IL-2 polypeptide
- a TMMP comprises a variant IL-2 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type IL-2 polypeptide) as the immunomodulatory polypeptide
- the ratio of: i) the binding affinity of the control TMMP to an IL-2 receptor (i.e., the cognate co-immunomodulatory polypeptide) to ii) the binding affinity of the TMMP to the IL-2 receptor, when measured by BLI, is in a range of from 1.5:1 to 10 6 : 1 , e.g., from 1.5:1 to 10:1, from 10:1 to 50:1, from 50:1 to 10 2 : 1 , from 10 2 : 1 to 10 3 : 1 , froml0 3 :l to 10 4 : 1 , from 10 4 : 1 to 10 s : 1, or from 10 s : 1 to 10 6
- a control TMMP comprises a wild-type CD80 polypeptide
- a TMMP of the present disclosure comprises a variant CD80 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type CD80 polypeptide) as the immunomodulatory polypeptide
- a control TMMP comprises a wild-type CD80 polypeptide
- a TMMP of the present disclosure comprises a variant CD80 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type CD80 polypeptide) as the immunomodulatory polypeptide
- a control TMMP comprises a wild-type 4-1BBL polypeptide
- a TMMP of the present disclosure comprises a variant 4-1BBL polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type 4-1BBL polypeptide) as the immunomodulatory polypeptide
- a control TMMP comprises a wild-type CD86 polypeptide
- a TMMP of the present disclosure comprises a variant CD86 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type CD86 polypeptide) as the immunomodulatory polypeptide
- Binding affinity of a TMMP of the present disclosure to a target T cell can be measured in the following manner: A) contacting a TMMP of the present disclosure with a target T-cell expressing on its surface: i) a cognate co-immunomodulatory polypeptide that binds the parental wild- type immunomodulatory polypeptide; and ii) a T-cell receptor that binds to the epitope, where the TMMP comprises an epitope tag, such that the TMMP binds to the target T-cell; B) contacting the target T-cell- bound TMMP with a fluorescently labeled binding agent (e.g., a fluorescently labeled antibody) that binds to the epitope tag, generating a TMMP/target T-cell/binding agent complex; C) measuring the mean fluorescence intensity (MFI) of the TMMP/target T-cell/binding agent complex using flow cytometry.
- MFI mean fluorescence intensity
- the epitope tag can be, e.g., a FLAG tag, a hemagglutinin tag, a c-myc tag, a poly(histidine) tag, etc.
- the MFI measured over a range of concentrations of the TMMP library member provides a measure of the affinity.
- the MFI measured over a range of concentrations of the TMMP library member provides a half maximal effective concentration (ECso) of the TMMP.
- the ECso of a TMMP of the present disclosure for a target T cell is in the nM range; and the ECso of the TMMP for a control T cell (where a control T cell expresses on its surface: i) a cognate co-immunomodulatory polypeptide that binds the parental wild- type immunomodulatory polypeptide; and ii) a T-cell receptor that does not bind to the epitope present in the TMMP) is in the ⁇ M range.
- the ratio of the ECso of a TMMP of the present disclosure for a control T cell to the ECso of the TMMP for a target T cell is at least 1.5:1, at least 2:1, at least 5:1, at least 10:1, at least 15:1, at least 20:1, at least 25:1, at least 50:1, at least 100:1, at least 500:1, at least 10 2 : 1 , at least 5 x 10 2 : 1 , at least 10 3 : 1 , at least 5 x 10 3 : 1 , at least 10 4 : 1 , at lease 10 5 : 1 , or at least 10 6 :1.
- the ratio of the ECso of a TMMP of the present disclosure for a control T cell to the ECso of the TMMP for a target T cell is an expression of the selectivity of the TMMP.
- a TMMP when measured as described in the preceding paragraph, exhibits selective binding to target T-cell, compared to binding of the TMMP library member to a control T cell that comprises: i) the cognate co-immunomodulatory polypeptide that binds the parental wild- type immunomodulatory polypeptide; and ii) a T-cell receptor that binds to an epitope other than the epitope present in the TMMP library member.
- a peptide epitope present in a TMMP can have a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids in length (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa, including within a range of from 4 to 20 amino acids, from 6 to 18 amino acids, from 8 to 15 amino acids, from 8 to 12 amino acids, from 5 to 10 amino acids, from 10 to 20 amino acids, and from 15 to 25 amino acids in length).
- a TMMP can comprise any of a variety of peptide epitopes.
- a peptide epitope present in a TMMP is a peptide that, when complexed with MHC polypeptides, presents an epitope to a T-cell receptor (TCR).
- TCR T-cell receptor
- An epitope-specific T cell binds an epitope having a given amino acid sequence, i.e., a “reference” amino acid sequence, but substantially does not bind an epitope that differs from the reference amino acid sequence, or if it binds at all, binds an epitope that differs from the reference amino acid sequence with only low affinity, e.g., less than 10 -6 M, less than 10 -5 M, or less than 10 -4 M.
- an epitope-specific T cell binds an epitope that differs from the reference amino acid sequence, if at all, with an affinity that is less than 10 -6 M, less than 10 -5 M, or less than 10 -4 M.
- An epitope-specific T cell can bind an epitope having a reference amino acid sequence, i.e., for which it is specific, with an affinity of at least 10 -7 M, at least 10 -8 M, at least 10 -9 M, or at least 10 -10 M.
- the epitope peptide present in a TMMP presents an epitope specific to an HLA-A, -B, -C, -E, -F, or -G allele.
- the epitope peptide present in a TMMP presents an epitope restricted to HLA-A*0101, A*0201, A*0301, A* 1101, A*2301, A*2402, A*2407, A*3303, and/or A*3401.
- the epitope peptide present in a TMMP presents an epitope restricted to HLA- B*0702, B*0801, B*1502, B*3802, B*4001, B*4601, and/or B*5301.
- the epitope peptide present in a TMMP presents an epitope restricted to C*0102, C*0303, C*0304, C*0401, C*0602, C*0701, C*702, C*0801, and/or C*1502.
- the peptide epitope is a viral epitope.
- a viral epitope is an epitope present in a viral antigen encoded by a virus that infects a majority of the human population, where such viruses include, e.g., cytomegalovirus (CMV), Epstein-Barr virus (EBV), human papilloma virus, influenza virus, adenovirus, and the like.
- the peptide epitope is a bacterial epitope, e.g., a bacterial epitope that is included in a vaccine and to which a majority of the human population has immunity.
- a TMMP comprises a CMV peptide epitope, i.e., a peptide that when in an MHC/peptide complex (e.g., an HLA/peptide complex), presents a CMV epitope (i.e., an epitope present in a CMV antigen) to a T cell.
- a CMV peptide epitope i.e., a peptide that when in an MHC/peptide complex (e.g., an HLA/peptide complex), presents a CMV epitope (i.e., an epitope present in a CMV antigen) to a T cell.
- a CMV peptide epitope has a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa,
- a given CMV epitope-specific T cell binds an epitope having a reference amino acid sequence of a given CMV epitope, but substantially does not bind an epitope that differs from the reference amino acid sequence, or if it binds at all, binds an epitope that differs from the reference amino acid sequence with only low affinity, e.g., less than 10 -6 M, less than 10 -5 M, or less than 10 -4 M.
- a given CMV epitope-specific T cell binds a CMV epitope having a reference amino acid sequence, and binds an epitope that differs from the reference amino acid sequence, if at all, with an affinity that is less than 10 -6 M, less than 10 -5 M, or less than 10 -4 M.
- a given CMV epitope-specific T cell can bind an epitope for which it is specific with an affinity of at least 10 -7 M, at least 10 -8 M, at least 10 -9 M, or at least 10 -10 M.
- a CMV peptide epitope present in a TMMP is a peptide from CMV pp65.
- a CMV peptide epitope present in a TMMP is a peptide from CMV gB (glycoprotein B).
- a CMV peptide epitope present in a TMMP is a peptide of a
- CMV polypeptide having a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa, including within a range of from 4 to 20 aa., from 6 to 18 aa., from 8 to 15 aa.
- a CMV peptide epitope present in a TMMP has the amino acid sequence NLVPMVATV (SEQ ID NO: 172) and has a length of 9 amino acids.
- a CMV peptide epitope present in a TMMP is a peptide having a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa, including within a range of from 4 to 20 aa., from 6 to 18 aa., from 8 to 15 aa.
- CMV polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following CMV gB amino acid sequence:
- the CMV epitope present in a TMMP presents an epitope specific to an
- the epitope peptide present in a TMMP presents an epitope restricted to HLA-A*0101, A*0201, A*0301, A*1101, A*2301, A*2402, A*2407, A*3303, and/or A*3401.
- the CMV epitope present in a TMMP presents an epitope restricted to HLA- B*0702, B*0801, B*1502, B*3802, B*4001, B*4601, and/or B*5301.
- the CMV epitope present in a TMMP presents an epitope restricted to C*0102, C*0303, C*0304, C*0401,
- a TMMP comprises: a) a CMV peptide epitope having amino acid sequence NLVPMVATV (SEQ ID NO: 172) and having a length of 9 amino acids; b) an HLA-A*0201 class I heavy chain polypeptide; and c) a ⁇ 2M polypeptide. 2) HPV epitopes
- An HPV peptide suitable for inclusion in a TMMP can be a peptide of an HPV E6 polypeptide or an HPV E7 polypeptide.
- the HPV epitope can be an epitope of HPV of any of a variety of genotypes, including, e.g., HPV16, HPV18, HPV31, HPV33, HPV35, HPV39, HPV45, HPV51, HPV52, HPV56, HPV58, HPV59, HPV68, HPV73, or HPV82.
- the epitope is an HPV E6 epitope.
- the epitope is an HPV E7 epitope.
- An HPV epitope present in a TMMP is a peptide specifically bound by a T-cell, i.e., the epitope is specifically bound by an HPV epitope-specific T cell.
- An epitope-specific T cell binds an epitope having a reference amino acid sequence, but substantially does not bind an epitope that differs from the reference amino acid sequence, or if it binds at all, binds an epitope that differs from the reference amino acid sequence with only low affinity, e.g., less than 10 -6 M, less than 10 -5 M, or less than 10 -4 M.
- an epitope-specific T cell binds an epitope having a reference amino acid sequence, and binds an epitope that differs from the reference amino acid sequence, if at all, with an affinity that is less than 10 -6 M, less than 10 -5 M, or less than 10 -4 M.
- An epitope-specific T cell can bind an epitope for which it is specific with an affinity of at least 10 -7 M, at least 10 -8 M, at least 10 -9 M, or at least 10 -10 M.
- HPV E6 peptides suitable for inclusion in a TMMP include, but are not
- HPV E7 peptides suitable for inclusion in a TMMP include, but are not
- a suitable HPV peptide is selected from the group consisting of:
- a suitable HPV peptide presents an HLA-A*2401 -restricted epitope.
- HPV peptides presenting an HLA-A*2401 -restricted epitope are: VYDFAFRDL and LCVQSTHVDI (SEQ ID NO: 135).
- an HPV peptide suitable for inclusion in a TMMP is VYDFAFRDL (SEQ ID NO: 126).
- an HPV peptide suitable for inclusion in a TMMP is RAHYNIVTF (SEQ ID NO: 133).
- an HPV peptide suitable for inclusion in a TMMP is CDSTLRLCV (SEQ ID NO: 134). In some cases, an HPV peptide suitable for inclusion in a TMMP is LCVQSTHVDI (SEQ ID NO: 135).
- Influenza virus peptides that are suitable for inclusion as a peptide epitope of a TMMP include peptides of from 4 amino acids to 25 amino acids in length of an influenza polypeptide, e.g., an influenza polypeptide that is included in a vaccine, or that is present in an influenza virus that infects a human.
- a peptide suitable for inclusion as a peptide epitope of a TMMP is an influenza virus peptide of from 4 amino acids to 25 amino acids in length of an influenza virus nucleoprotein.
- a peptide suitable for inclusion as a peptide epitope of a TMMP is a peptide of from 4 amino acids to 25 amino acids in length of an influenza virus hemagglutinin polypeptide.
- a peptide suitable for inclusion as a peptide epitope of a TMMP is a peptide of from 4 amino acids to 25 amino acids in length of an influenza A virus Matrix protein 1.
- a peptide suitable for inclusion as a peptide epitope of a TMMP is a peptide of from 4 amino acids to 25 amino acids in length of an influenza virus neuraminidase polypeptide.
- the peptide is a peptide that presents an immunodominant influenza virus protein epitope.
- a suitable influenza peptide is a peptide having the sequence GILGFVFTL (SEQ ID NO: 160) and having a length of 9 amino acids.
- Tetanus peptides that are suitable for inclusion as a peptide epitope of a TMMP include peptides of from 4 amino acids to 25 amino acids in length of a tetanus toxin. Examples of suitable
- a TMMP includes MHC polypeptides.
- MHC polypeptides include MHC polypeptides of various species, including human MHC (also referred to as human leukocyte antigen (HLA)) polypeptides, rodent (e.g., mouse, rat, etc.) MHC polypeptides, and MHC polypeptides of other mammalian species (e.g., lagomorphs, non-human primates, canines, felines, ungulates (e.g., equines, bovines, ovines, caprines, etc.), and the like.
- MHC polypeptide is meant to include Class I MHC polypeptides (e.g., b-2 microglobulin and MHC class I heavy chain).
- the first MHC polypeptide is an MHC Class I ⁇ 2M ( ⁇ 2M) polypeptide
- the second MHC polypeptide is an MHC Class I heavy chain (H chain) (“MHC-H”)).
- MHC-H MHC Class I heavy chain
- the first MHC polypeptide is an MHC Class I heavy chain polypeptide
- the second MHC polypeptide is a ⁇ 2M polypeptide.
- both the ⁇ 2M and MHC-H chain are of human origin; i.e., the MHC-H chain is an HLA heavy chain, or a variant thereof.
- a TMMP of the present disclosure does not include membrane anchoring domains (transmembrane regions) of an MHC Class I heavy chain, or a part of MHC Class I heavy chain sufficient to anchor the resulting TMMP to a cell (e.g., eukaryotic cell such as a mammalian cell) in which it is expressed.
- the MHC Class I heavy chain present in a TMMP of the present disclosure does not include a signal peptide, a transmembrane domain, or an intracellular domain (cytoplasmic tail) associated with a native MHC Class I heavy chain.
- the MHC Class I heavy chain present in a TMMP of the present disclosure includes only the ⁇ 1, ⁇ 2, and ⁇ 3 domains of an MHC Class I heavy chain.
- the MHC Class I heavy chain present in a TMMP of the present disclosure has a length of from about 270 amino acids (aa) to about 290 aa.
- the MHC Class I heavy chain present in a TMMP of the present disclosure has a length of 270 aa, 271 aa, 272 aa, 273 aa, 274 aa, 275 aa, 276 aa, 277 aa, 278 aa, 279 aa, 280 aa, 281 aa, 282 aa, 283 aa, 284 aa, 285 aa, 286 aa, 287 aa, 288 aa, 289 aa, or 290 aa.
- an MHC polypeptide of a TMMP is a human MHC polypeptide, where human MHC polypeptides are also referred to as “human leukocyte antigen” (“HLA”) polypeptides.
- HLA human leukocyte antigen
- an MHC polypeptide of a TMMP is a Class I HLA polypeptide, e.g., a ⁇ 2-microglobulin polypeptide, or a Class I HLA heavy chain polypeptide.
- Class I HLA heavy chain polypeptides include HLA-A heavy chain polypeptides, HLA-B heavy chain polypeptides, HLA-C heavy chain polypeptides, HLA-E heavy chain polypeptides, HLA-F heavy chain polypeptides, and HLA-G heavy chain polypeptides.
- an MHC Class I heavy chain polypeptide present in a TMMP of the present disclosure comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of the amino acid sequence of any of the human HLA heavy chain polypeptides depicted in FIGs. 5-11.
- the MHC Class I heavy chain has a length of 270 aa, 271 aa, 272 aa, 273 aa, 274 aa, 275 aa, 276 aa, 277 aa, 278 aa, 279 aa, 280 aa, 281 aa, 282 aa, 283 aa, 284 aa, 285 aa, 286 aa, 287 aa, 288 aa, 289 aa, or 290 aa.
- an MHC Class I heavy chain polypeptide present in a TMMP of the present disclosure comprises 1-30, 1-5, 5-10, 10-15, 15-20, 20-25 or 25-30 amino acid insertions, deletions, and/or substitutions (in addition to those locations indicated as being variable in the heavy chain consensus sequences) of any one of the amino acid sequences depicted in FIGs 5-11.
- the MHC Class I heavy chain does not include transmembrane or cytoplasmic domains.
- a MHC Class I heavy chain polypeptide of a TMMP of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to amino acids 25-300 (lacking all, or substantially all, of the leader, transmembrane and cytoplasmic sequence) or amino acids 25-365 (lacking the leader) of a human HLA-A heavy chain polypeptides depicted in any one of FIG. 5A, 5B, and 5C.
- FIGs. 5A, 5B and 5C provide amino acid sequences of human leukocyte antigen (HLA)
- FIG. 5A entry: 3A.1 is the HLA-A heavy chain (HLA-A*01:01:01 or A*0101) (NCBI accession NP_001229687.1), SEQ ID NO:392; entry 3A.2 is from HLA-A*1101 SEQ ID NO:393; entry 3A.3 is from HLA-A*2402 SEQ ID NO:394 and entry 3A.4 is from HLA-A*3303 SEQ ID NO:395.
- HLA-A heavy chain HLA-A*01:01:01:01:01 or A*0101
- FIG. 5B provides the sequence HLA-B *07:02:01 (HLA-B*0702) NCBI GenBank Accession NP_005505.2 (see also GenBank Accession AUV50118.L).
- FIG. 5C provides the sequence HLA- C*0701 (GenBank Accession NP_001229971.1) (HLA-C*07:01:01:01 or HLA-Cw*070101, HLA-Cw*07 see GenBank Accession CA078194.1).
- FIG. 6 provides an alignment of eleven mature MHC class I heavy chain amino acid sequences without their leader sequences or transmembrane domains or intracellular domains.
- the aligned sequences are human HLA-A, HLA-B, and HLA-C, a mouse H2K protein sequence, three variants of HLA-A (var.l, var. 2C, and var.2CP), and 3 human HLA-A variants (HLA-A* 1101; HLA- A*2402; and HLA-A*3303).
- Indicated in the alignment are the locations (84 and 139 of the mature proteins) where cysteine residues may be introduced (e.g., by substitution) for the formation of a disulfide bond to stabilize the MHC H chain - ⁇ 2M complex. Also shown in the alignment is position 236 (of the mature polypeptide), which may be substituted by a cysteine residue that can form an inter- chain disulfide bond with ⁇ 2M (e.g., at aa 12). An arrow appears above each of those locations and the residues are bolded.
- the seventh HLA-A sequence shown in the alignment shows the sequence of variant 2 substituted with C residues at positions 84, 139 and 236.
- the boxes flanking residues 84, 139 and 236 show the groups of five amino acids on either sides of those six sets of five residues, denoted aacl (for “amino acid cluster 1”), aac2 (for “amino acid cluster 2”), aac3 (for “amino acid cluster 3”), aac4 (for “amino acid cluster 4”), aac5 (for “amino acid cluster 5”), and aac6 (for “amino acid cluster 6”), that may be replaced by 1 to 5 amino acids selected independently from (i) any naturally occurring amino acid or (ii) any naturally occurring amino acid except proline or glycine. [00247] With regard to FIG.
- aacl amino acid cluster 1
- aac2 amino acid cluster 2
- YNQSE amino acid sequence YNQSE
- aaac3 amino acid cluster 3
- TAADM amino acid sequence TAADM
- FIGs. 7-9 provide alignments of mature HLA class I heavy chain amino acid sequences
- the aligned amino acid sequences in FIG. 7A are HLA- A class I heavy chains of the following alleles: A*0101, A*0201, A*0301, A*1101, A*2301, A*2402, A*2407, A*3303, and A*3401.
- the aligned amino acid sequences in FIG. 8A are HLA-B class I heavy chains of the following alleles: B*0702, B*0801, B*1502, B*3802, B*4001, B*4601, and B*5301.
- HLA-C class I heavy chains of the following alleles C*0102, C*0303, C*0304, C*0401, C*0602, C*0701, C*0801, and C*1502.
- locations 84 and 139 of the mature proteins
- cysteine residues may be introduced (e.g., by substitution) for the formation of a disulfide bond to stabilize the HLA H chain - ⁇ 2M complex.
- position 236 of the mature polypeptide
- ⁇ 2M e.g., at aa 12
- FIGs. 7A, 8A, and 9A provide alignments of the amino acid sequences of mature HLA-
- A, -B, and -C class I heavy chains are provided for the extracellular portion of the mature protein (without leader sequences or transmembrane domains or intracellular domains).
- FIG. 7B, 8B, and 9B provide consensus amino acid sequences for the HLA-A, -B, and -C sequences, respectively, provide in FIG. 7A, 8A, and 9A.
- aacl amino acid cluster 1
- aac2 amino acid cluster 2
- YNQSE amino acid sequence YNQSE
- aac3 amino acid cluster 3
- TAADM amino acid sequence TAADM
- aacl (amino acid cluster 1) may be the amino acid sequence RNLRG (SEQ ID NO: 180) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., N replaced by T or I; and/or L replaced by A; and/or the second R replaced by L; and/or the G replaced by R);
- aac2 (amino acid cluster 2) may be the amino acid sequence YNQSE (SEQ ID NO: 175) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., N replaced by Q, Q replaced by N, and/or E replaced by D);
- aac3 (amino acid cluster 3) may be the amino acid sequence TAADT (SEQ ID NO: 181) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., the first T replaced by S; and/
- aacl (amino acid cluster 1) may be the amino acid sequence RNLRG (SEQ ID NO: 180) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., N replaced by K; and/or L replaced by A or I; and/or the second R replaced by H; and/or the G replaced by T or S);
- aac2 (amino acid cluster 2) may be the amino acid sequence YNQSE (SEQ ID NO: 175) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., N replaced by Q, Q replaced by N, and/or E replaced by D);
- aac3 (amino acid cluster 3) may be the amino acid sequence TAADT (SEQ ID NO: 181) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., the first T replaced by S;
- a TMMP of the present disclosure comprises an HLA-A heavy chain polypeptide.
- the HLA-A heavy chain peptide sequences, or portions thereof, that may be that may be incorporated into a TMMP of the present disclosure include, but are not limited to, the alleles: A*0101, A*0201, A*0301, A* 1101, A*2301, A*2402, A*2407, A*3303, and A*3401, which are aligned without all, or substantially all, of the leader, transmembrane and cytoplasmic sequences in FIG. 7A. Any of those alleles may comprise a mutation at one or more of positions 84, 139 and/or 236 (as shown in FIG.
- a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- HLA-A sequence having at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of the sequence of those HLA-A alleles may also be employed (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- a TMMP of the present disclosure comprises an HLA-A heavy chain polypeptide comprising the following HLA-A consensus amino acid sequence:
- X2 is K or R
- X3 is Q, G, E, or R
- X4 is N or E
- X5 is R or G
- X6 is N or K
- X7 is M or V;
- an MHC Class I heavy chain polypeptide of a TMMP can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A heavy chain amino acid sequence:
- an HLA-A heavy chain polypeptide suitable for inclusion in a TMMP of the present disclosure comprises the following amino acid sequence: is also referred to as “HLA-A*0201” or simply “HLA-A02.”
- the C-terminal Pro is not included in a TMMP of the present disclosure.
- an HLA-A02 polypeptide suitable for inclusion in a TMMP of the present disclosure comprises the following amino acid sequence:
- the MHC Class I heavy chain polypeptide comprises Y84A and A236C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A heavy chain (Y84A; A236C) amino acid sequence: acid 236 is Cys.
- the Cys-236 forms an interchain disulfide bond with Cys-12 of a variant ⁇ 2M polypeptide that comprises an R12C substitution.
- an HLA-A heavy chain polypeptide suitable for inclusion in a TMMP of the present disclosure is an HLA-A02 (Y84A; A236C) polypeptide comprising the following amino acid sequence:
- an HLA-A heavy chain polypeptide suitable for inclusion in a TMMP of the present disclosure is an HLA-A02 (Y84A; A236C) polypeptide comprising the following amino acid sequence:
- the MHC Class I heavy chain polypeptide comprises Y84C and A139C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A heavy chain (Y84C; A139C) amino acid sequence: acid 139 is Cys.
- Cys-84 forms an intrachain disulfide bond with Cys- 139.
- an MHC Class I heavy chain polypeptide of a TMMP can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA- All heavy chain amino acid sequence: prominent in Asian populations, including populations of individuals of Asian descent.
- the MHC Class I heavy chain polypeptide is an HLA-A11 allele that comprises Y84A and A236C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A All heavy chain (Y84A; A236C) amino acid sequence: acid 236 is Cys.
- the Cys-236 forms an interchain disulfide bond with Cys-12 of a variant ⁇ 2M polypeptide that comprises an R12C substitution.
- HLA-A24 HLA-A *2402
- an MHC Class I heavy chain polypeptide of a TMMP of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A24 heavy chain amino acid sequence: may be prominent in Asian populations, including populations of individuals of Asian descent.
- amino acid 84 is an Ala.
- amino acid 84 is a Cys.
- amino acid 236 is a Cys.
- amino acid 84 is an Ala and amino acid 236 is a Cys.
- amino acid 84 is an Cys and amino acid 236 is a Cys.
- HLA-A33 HLA-A*3303
- an MHC Class I heavy chain polypeptide of a TMMP of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A33 heavy chain amino acid sequence: be prominent in Asian populations, including populations of individuals of Asian descent.
- amino acid 84 is an Ala.
- amino acid 84 is a Cys.
- amino acid 236 is a Cys.
- amino acid 84 is an Ala and amino acid 236 is a Cys.
- amino acid 84 is an Cys and amino acid 236 is a Cys.
- a TMMP of the present disclosure comprises an HLA-B heavy chain polypeptide.
- the HLA-B heavy chain peptide sequences, or portions thereof, that may be that may be incorporated into a TMMP of the present disclosure include, but are not limited to, the alleles: B*0702, B*0801, B*1502, B*3802, B*4001, B*4601, and B*5301, which are aligned without all, or substantially all, of the leader, transmembrane and cytoplasmic sequences in FIG. 8A. Any of those alleles may comprise a mutation at one or more of positions 84, 139 and/or 236 (as shown in FIG.
- a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- a HLA-B polypeptide comprising an amino acid sequence having at least 75 % (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of the sequence of those HLA-B alleles may also be employed (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- a TMMP of the present disclosure comprises an HLA-B heavy chain polypeptide comprising the following HLA-B consensus amino acid sequence: V; X4 is A, S, or T; X5 is Q or L; X6 is A or T; X7 is E, M K, or T; X8 is A or T; X9 is E or N; X10 is I or K; XI 1 is Y, F, S, or C; X12 is N or Q; X13 is A or T; X14 is D or Y; X15 is E or V; X16 is S or N; X17 is T, N, or I; XI 8 is A or L; X19 is L, or R; X20 is R or G; X21 is T or I; X22 is L or I; X23 is R or S; X24 is R or S; X25 is S or T; X26 is L or W; X27 is E OR V
- an MHC Class I heavy chain polypeptide of a TMMP of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-B heavy chain amino acid sequence:
- HLA-B (Y84A; A236C)
- the MHC Class I heavy chain polypeptide is an HLA-B polypeptide that comprises Y84A and A236C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-B heavy chain (Y84A; A236C) amino acid sequence: 236 is Cys.
- the Cys-236 forms an interchain disulfide bond with Cys-12 of a variant ⁇ 2M polypeptide that comprises an R12C substitution.
- the MHC Class I heavy chain polypeptide comprises Y84C and A139C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-B heavy chain (Y84C; A139C) amino acid sequence: 139 is Cys.
- Cys-84 forms an intrachain disulfide bond with Cys- 139.
- TMMP of the present disclosure comprises an amino acid sequence of HLA-B*0702 (SEQ ID NO: 195) in FIG. 8A, or a sequence having at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100%, amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- amino acid sequence identity e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids
- the HLA-B heavy chain polypeptide of TMMP of the present disclosure may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine substitution at position 84 (Y84A); a tyrosine to cysteine substitution at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the HLA-B heavy chain polypeptide of TMMP of the present disclosure comprises Y84A and A236C substitutions.
- the HLA-B *0702 heavy chain polypeptide of TMMP of the present disclosure comprises Y84C and A139C substitutions. In some cases, the HLA-B heavy chain polypeptide of TMMP of the present disclosure comprises Y84C, A139C, and A236C substitutions.
- a TMMP of the present disclosure comprises an HLA-C heavy chain polypeptide.
- the HLA-C heavy chain polypeptide, or portions thereof, that may be that may be incorporated into a TMMP of the present disclosure include, but are not limited to, the alleles: C*0102, C*0303, C*0304, C*0401, C*0602, C*0701, C*0801, and C*1502, which are aligned without all, or substantially all, of the leader, transmembrane and cytoplasmic sequences in FIG. 9A. Any of those alleles may comprise a mutation at one or more of positions 84, 139 and/or 236 (as shown in FIG.
- a tyrosine to alanine substitution at position 84 (Y84A); a tyrosine to cysteine substitution at position 84 (Y84C); an alanine to cysteine substitution at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- an HLA-C polypeptide comprising an amino acid sequence having at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of the sequence of those HLA-C alleles may also be employed (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- a TMMP of the present disclosure comprises an HLA-C heavy chain polypeptide comprising the following HLA-C consensus amino acid sequence: F, Y, S, or D; X4 is R or W; X5 is H or R; X6 is A or S; X7 is Q or R; X8 is A or E; X9 is N or K;X10 is T or A; XI 1 is S or N; X12 is N or K; X13 is A or D; X14 is G or R; X15 is T or I; X16 is L or I; X17 is W or R; X18 is C, Y, F, or S; X19 is L, or V; X20 is Y or H; X21 is D or N; X22 is Y, F, S, or L; X23 is L or W; X24 is E, A, Or T; X25 is R, L, or W; X26 is L or T
- an MHC Class I heavy chain polypeptide of a TMMP of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-C heavy chain amino acid sequence:
- HLA-C (Y84A; A236C)
- the MHC Class I heavy chain polypeptide is an HLA-C polypeptide that comprises Y84A and A236C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-C heavy chain (Y84A; A236C) amino acid sequence: acid 236 is Cys.
- the Cys-236 forms an interchain disulfide bond with Cys-12 of a variant ⁇ 2M polypeptide that comprises an R12C substitution.
- HLA-C (Y84C; A139C)
- the MHC Class I heavy chain polypeptide comprises Y84C and A139C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-C heavy chain (Y84C; A139C) amino acid sequence: acid 139 is Cys.
- Cys-84 forms an intrachain disulfide bond with Cys- 139.
- a MHC Class I heavy chain polypeptide of a TMMP of the present disclosure comprises an amino acid sequence of HLA-C*0701 of FIG. 9A (labeled HLA-C in FIG. 6), or an amino acid sequence having at least 75 % (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the HLA-C heavy chain polypeptide of a TMMP of the present disclosure may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine substitution at position 84 (Y84A); a tyrosine to cysteine substitution at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the HLA-C heavy chain polypeptide of a TMMP of the present disclosure comprises Y84A and A236C substitutions. In some cases, the HLA-C*0701 heavy chain polypeptide of a T-Cell-MMP or its epitope conjugate comprises Y84C and A139C substitutions. In some cases, the HLA-C heavy chain polypeptide of a TMMP of the present disclosure comprises Y84C, A139C, and A236C substitutions.
- a TMMP of the present disclosure comprises a non-classical MHC Class
- HLA heavy chain polypeptide Among the non-classical HLA heavy chain polypeptides, or portions thereof, that may be that may be incorporated into a TMMP of the present disclosure include, but are not limited to, those of HLA-E, -F, and -G alleles.
- Amino acid sequences for HLA-E, -F, and -G heavy chain polypeptides, (and the HLA-A, B and C alleles) may be found on the world wide web hla.alleles.org/ nomenclature/index.html, the European Bioinformatics Institute (www(dot)ebi(dot)ac(dot)uk), which is part of the European Molecular Biology Laboratory(EMBL), and at the National Center for Biotechnology Information (www(dot)ncbi(dot)nlm(dot)nih(dot)gov).
- HLA-E alleles include, but are not limited to, HLA-
- HLA-E*01 :01 :01 :01 HLA-E*01:03(HLA-E*01:03:01:01), HLA-E*01:04, HLA-E*01:05, HLA-E*01:06, HLA-E*01:07, HLA-E*01:09, and HLA-E*01:10.
- suitable HLA-F alleles include, but are not limited to, HLA-F*0101 (HLA-F*01:01:01:01), HLA-F*01:02, HLA- F*01:03(HLA-F*01:03:01:01), HLA-F*01:04, HLA-F*01:05, and HLA-F*01:06.
- HLA-G alleles include, but are not limited to, HLA-G*0101 (HLA-G*01:01:01:01), HLA-G*01:02, HLA-G*01:03(HLA-G*01:03:01:01), HLA-G*01:04 (HLA-G*01:04:01:01), HLA- G*01:06, HLA-G*01:07, HLA-G*01:08, HLA-G*01:09: HLA-G*01:10, HLA-G*01:10, HLA-G*01:11, HLA-G*01:12, HLA-G*01:14, HLA-G*01:15, HLA-G*01:16, HLA-G*01:17, HLA-G*01:18: HLA- G*01:19, HLA-G*01:20, and HLA-G*01:22.
- Consensus sequences for those HLA E, -F and -G alleles without all, or substantially all, of the leader, transmembrane and cytoplasmic sequences are provided in FIG. 10, and aligned with consensus sequences of the above-mentioned HLA-A, -B and -C alleles in FIG. 11.
- FIG. 11 provides a consensus sequence for each of HLA-E, -F, and -G with the variable aa positions indicated as “X” residues sequentially numbered and the locations of aas 84, 139 and 236 double underlined.
- FIG. 11 provides an alignment of the consensus amino acid sequences for HLA-A, -B, -
- any of the above-mentioned HLA-E, -F, and/or -G alleles may comprise a substitution at one or more of positions 84, 139 and/or 236 as shown in FIG. 11 for the consensus sequences.
- the substitutions may be selected from a: position 84 tyrosine to alanine (Y84A) or cysteine (Y84C), or, in the case of HLA-F, an R84A or R84C substitution; a position 139 alanine to cysteine (A139C), or, in the case of HLA-F, a V139C; and an alanine to cysteine substitution at position 236 (A236C).
- an HLA-E, -F and /or -G sequence having at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of any of the consensus sequences of set forth in FIG. 11 may also be employed (e.g., the sequences may comprise 1-25, 1-5, 5-10, 10-15, 15- 20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions in addition to changes at variable residues listed therein).
- a MHC Class I heavy chain polypeptide present in a TMMP of the present disclosure comprises an amino acid sequence of MOUSE H2K (SEQ ID NO:401) (MOUSE H2K in FIG. 6), or a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20- 25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the MOUSE H2K heavy chain polypeptide of a TMMP of the present disclosure may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the MOUSE H2K heavy chain polypeptide of a TMMP of the present disclosure comprises Y84A and A236C substitutions.
- the MOUSE H2K heavy chain polypeptide of a TMMP of the present disclosure comprises Y84C and A139C substitutions. In some cases, the MOUSE H2K heavy chain polypeptide of a TMMP of the present disclosure comprises Y84C, A139C and A236C substitutions.
- Table 2 presents various combinations of MHC Class I heavy chain sequence modifications that can be incorporated in a TMMP of the present disclosure.
- Sequence Identity Range is the permissible range in sequence identity of an MHC-H polypeptide sequence incorporated into a TMMP relative to the corresponding portion of the sequences listed in FIG. 6-11 not counting the variable residues in the consensus sequences.
- a ⁇ 2-microglobulin ( ⁇ 2M) polypeptide of a TMMP of the present disclosure can be a human ⁇ 2M polypeptide, a non-human primate ⁇ 2M polypeptide, a murine ⁇ 2M polypeptide, and the like.
- a ⁇ 2M polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to a ⁇ 2M amino acid sequence depicted in FIG. 4.
- a ⁇ 2M polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to amino acids 21 to 119 of a ⁇ 2M amino acid sequence depicted in FIG. 4.
- a suitable ⁇ 2M polypeptide comprises the following amino acid sequence: and the HLA Class I heavy chain polypeptide comprises the following amino acid sequence: indicated as ⁇ C ⁇ form an disulfide bond between the ⁇ 1 and ⁇ 2-1 helices and til residue forms a disulfide bond with the ⁇ 2M polypeptide cysteine at position 12.
- aal is “amino acid cluster 1”; “aa2” is “amino acid cluster 2”; “aa3” is “amino acid cluster 3”; “aa4” is “amino acid cluster 4”; “aa5” is “amino acid cluster 5”; and “aa6” is “amino acid cluster 6”; see, e.g., FIG. 6.
- Each occurrence of aal, aa2, aa3, aa4, aa5, and aa6 is and independently selected to be 1-5 amino acid residues, wherein the amino acid residues are i) selected independently from any naturally occurring (e.g., encoded) amino acid or ii) any naturally occurring amino acid except proline or glycine.
- an MHC polypeptide comprises a single amino acid substitution relative to a reference MHC polypeptide (where a reference MHC polypeptide can be a wild-type MHC polypeptide), where the single amino acid substitution substitutes an amino acid with a cysteine (Cys) residue.
- cysteine residues when present in an MHC polypeptide of a first polypeptide of a TMMP of the present disclosure, can form a disulfide bond with a cysteine residue present in a second polypeptide chain of a TMMP of the present disclosure.
- a first MHC polypeptide in a first polypeptide of a TMMP of the present disclosure, and/or the second MHC polypeptide in the second polypeptide of a TMMP of the present disclosure includes an amino acid substitution to substitute an amino acid with a cysteine, where the substituted cysteine in the first MHC polypeptide forms a disulfide bond with a cysteine in the second MHC polypeptide, where a cysteine in the first MHC polypeptide forms a disulfide bond with the substituted cysteine in the second MHC polypeptide, or where the substituted cysteine in the first MHC polypeptide forms a disulfide bond with the substituted cysteine in the second MHC polypeptide.
- one of following pairs of residues in an HLA b2- microglobulin and an HLA Class I heavy chain is substituted with cysteines (where residue numbers are those of the mature polypeptide): 1) ⁇ 2M residue 12, HLA Class I heavy chain residue 236; 2) ⁇ 2M residue 12, HLA Class I heavy chain residue 237; 3) ⁇ 2M residue 8, HLA Class I heavy chain residue 234; 4) ⁇ 2M residue 10, HLA Class I heavy chain residue 235; 5) ⁇ 2M residue 24, HLA Class I heavy chain residue 236; 6) ⁇ 2M residue 28, HLA Class I heavy chain residue 232; 7) ⁇ 2M residue 98, HLA Class I heavy chain residue 192; 8) ⁇ 2M residue 99, HLA Class I heavy chain residue 234; 9) ⁇ 2M residue 3, HLA Class I heavy chain residue 120; 10) ⁇ 2M residue 31, HLA Class I heavy chain residue 96; 11) ⁇ 2M residue 53, HLA Class I heavy chain residue 53, HLA Class I heavy chain residue 53,
- the amino acid numbering of the MHC/HLA Class I heavy chain is in reference to the mature MHC/HLA Class I heavy chain, without a signal peptide.
- residue 236 of the mature HLA-A amino acid sequence is substituted with a Cys.
- residue 236 of the mature HLA-B amino acid sequence is substituted with a Cys.
- residue 236 of the mature HLA-C amino acid sequence is substituted with a Cys.
- residue 32 (corresponding to Arg-12 of mature ⁇ 2M) of an amino acid sequence depicted in FIG. 4 is substituted with a Cys.
- an HLA Class I heavy chain polypeptide comprises the amino acid sequence:
- an HLA Class I heavy chain polypeptide comprises the amino acid sequence:
- an HLA Class I heavy chain polypeptide comprises the amino acid sequence:
- the ⁇ 2M polypeptide comprises the following amino acid sequence: and the HLA Class I heavy chain polypeptide of a TMMP of the present disclosure comprises the following amino acid sequence: residues that are underlined and in bold form a disulfide bond with one another in the TMMP.
- the ⁇ 2M polypeptide comprises the amino acid sequence:
- the first polypeptide and the second polypeptide of a TMMP of the present disclosure are disulfide linked to one another through: i) a Cys residue present in a linker connecting the peptide epitope and a ⁇ 2M polypeptide in the first polypeptide chain; and ii) a Cys residue present in an MHC Class I heavy chain in the second polypeptide chain.
- the Cys residue present in the MHC Class I heavy chain is a Cys introduce as a Y84C substitution.
- the linker connecting the peptide epitope and the ⁇ 2M polypeptide in the first polypeptide chain is GCGGS(G4S)n (SEQ ID NO:206), where n is 1, 2, 3, 4, 5, 6, 7, 8, or 9.
- the linker comprises the amino acid sequence GCGGSGGGGSGGGGSGGGGS (SEQ ID NO:207).
- the linker comprises the amino acid sequence GCGGSGGGGSGGGGS (SEQ ID NO:208). Examples of disulfide-linked first and second polypeptides of a TMMP of the present disclosure are depicted schematically in FIG. 1A-1B.
- an immunomodulatory polypeptide present in a TMMP is a wild-type immunomodulatory polypeptide.
- an immunomodulatory polypeptide present in a TMMP of the present disclosure is a variant immunomodulatory polypeptide that has reduced affinity for a co- immunomodulatory polypeptide, compared to the affinity of a corresponding wild-type immunomodulatory polypeptide for the co-immunomodulatory polypeptide.
- Suitable immunomodulatory domains that exhibit reduced affinity for a co-immunomodulatory domain can have from 1 amino acid (aa) to 20 aa differences from a wild-type immunomodulatory domain.
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure differs in amino acid sequence by 1 aa, 2 aa, 3 aa, 4 aa, 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, or 10 aa, from a corresponding wild- type immunomodulatory polypeptide.
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure differs in amino acid sequence by 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, or 20 aa, from a corresponding wild-type immunomodulatory polypeptide.
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions, compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes a single amino acid substitution compared to a corresponding reference (e.g., wild- type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 2 amino acid substitutions (e.g., no more than 2 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 3 amino acid substitutions (e.g., no more than 3 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide. In some cases, variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 4 amino acid substitutions (e.g., no more than 4 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 5 amino acid substitutions (e.g., no more than 5 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide. In some cases, variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 6 amino acid substitutions (e.g., no more than 6 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 7 amino acid substitutions (e.g., no more than 7 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide. In some cases, variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 8 amino acid substitutions (e.g., no more than 8 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 9 amino acid substitutions (e.g., no more than 9 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide. In some cases, variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 10 amino acid substitutions (e.g., no more than 10 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 11 amino acid substitutions (e.g., no more than 11 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 12 amino acid substitutions (e.g., no more than 12 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 13 amino acid substitutions (e.g., no more than 13 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 14 amino acid substitutions (e.g., no more than 14 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 15 amino acid substitutions (e.g., no more than 15 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 16 amino acid substitutions (e.g., no more than 16 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 17 amino acid substitutions (e.g., no more than 17 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 18 amino acid substitutions (e.g., no more than 18 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 19 amino acid substitutions (e.g., no more than 19 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 20 amino acid substitutions (e.g., no more than 20 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- TMMP of the present disclosure exhibits reduced affinity for a cognate co-immunomodulatory polypeptide, compared to the affinity of a corresponding wild- type immunomodulatory polypeptide for the cognate co-immunomodulatory polypeptide.
- Exemplary pairs of immunomodulatory polypeptide and cognate co-immunomodulatory polypeptide include, but are not limited to:
- PD-L1 immunomodulatory polypeptide
- PD1 cognate co-immunomodulatory polypeptide
- IL-2 immunomodulatory polypeptide
- IL-2 receptor cognate co- immunomodulatory polypeptide
- CD80 immunomodulatory polypeptide
- CD86 cognate co-immunomodulatory polypeptide
- CD86 immunomodulatory polypeptide
- CD28 cognate co-immunomodulatory polypeptide
- Fas ligand immunomodulatory polypeptide
- Fas cognate co-immunomodulatory polypeptide
- ICOS-F immunomodulatory polypeptide
- ICOS cognate co-immunomodulatory polypeptide
- ICAM immunomodulatory polypeptide
- FFA-1 cognate co-immunomodulatory polypeptide
- CD30L immunomodulatory polypeptide
- CD30 cognate co-immunomodulatory polypeptide
- CD40 immunomodulatory polypeptide
- CD40L cognate co-immunomodulatory polypeptide
- CD83 immunomodulatory polypeptide
- CD83L cognate co-immunomodulatory polypeptide
- HVEM immunomodulatory polypeptide
- CD160 cognate co- immunomodulatory polypeptide
- JAG1 (CD339) (immunomodulatory polypeptide) and Notch (cognate co- immunomodulatory polypeptide);
- JAG1 immunomodulatory polypeptide
- CD46 cognate co-immunomodulatory polypeptide
- CD80 immunomodulatory polypeptide
- CTLA4 cognate co-immunomodulatory polypeptide
- CD 86 immunomodulatory polypeptide
- CTLA4 cognate co-immunomodulatory polypeptide
- CD70 immunomodulatory polypeptide
- CD27 cognate co-immunomodulatory polypeptide
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure has a binding affinity for a cognate co-immunomodulatory polypeptide that is from 100 nM to 100 ⁇ M.
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure has a binding affinity for a cognate co-immunomodulatory polypeptide that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure exhibits reduced affinity for a cognate co-immunomodulatory polypeptide.
- a TMMP of the present disclosure that comprises a variant immunomodulatory polypeptide exhibits reduced affinity for a cognate co-immunomodulatory polypeptide.
- a TMMP of the present disclosure that comprises a variant immunomodulatory polypeptide has a binding affinity for a cognate co- immunomodulatory polypeptide that is from 100 nM to 100 ⁇ M.
- a TMMP of the present disclosure that comprises a variant immunomodulatory polypeptide has a binding affinity for a cognate co-immunomodulatory polypeptide that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ M, to about 1 ⁇ M to about 5 ⁇ M, from about 5 ⁇ M to about 10 ⁇ M, from about 10 ⁇ M to about 15 ⁇ M, from about 15 ⁇ M to about 20
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure is a variant CD80 polypeptide. Wild-type CD80 binds to CD28. Wild-type CD80 also binds to CD86.
- a wild-type amino acid sequence of the ectodomain of human CD80 can be as follows: disclosure comprises a variant CD80 polypeptide, a “cognate co-immunomodulatory polypeptide” is a CD28 polypeptide comprising the amino acid sequence of SEQ ID NO: 5. [00342] In some cases, a variant CD80 polypeptide exhibits reduced binding affinity to CD28, compared to the binding affinity of a CD80 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:4 for CD28.
- a variant CD80 polypeptide binds CD28 with a binding affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a CD80 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:4 for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in one of SEQ ID NO:436, 437, or 438).
- a variant CD80 polypeptide has a binding affinity to CD28 that is from
- a variant CD80 polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ M, to about 1 ⁇ M to about 5 ⁇ M, from about 5
- a variant CD80 polypeptide has a single amino acid substitution compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has from 2 to 10 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 2 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 3 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435.
- a variant CD80 polypeptide has 4 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 5 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 6 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 7 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 8 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435.
- a variant CD80 polypeptide has 9 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 10 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435.
- Suitable CD80 variants include a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to any one of the following amino acid sequences: any amino acid other than Pro.
- X is Ala.
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure is a variant CD86 polypeptide. Wild-type CD86 binds to CD28.
- a “cognate co- immunomodulatory polypeptide” is a CD28 polypeptide comprising the amino acid sequence of SEQ ID NO:5.
- the amino acid sequence of the full ectodomain of a wild-type human CD86 can be as follows: [00365] The amino acid sequence of the IgV domain of a wild-type human CD86 can be as follows:
- a variant CD86 polypeptide exhibits reduced binding affinity to CD28, compared to the binding affinity of a CD 86 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:226 or SEQ ID NO:227 for CD28.
- a variant CD86 polypeptide binds CD28 with a binding affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a CD86 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:226 or SEQ ID NO:227 for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in one of SEQ ID NO:436, 437, or 438).
- a variant CD86 polypeptide has a binding affinity to CD28 that is from
- a variant CD 86 polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in one of SEQ ID NOs:5, 6, or 7) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ M, to about 1 ⁇ M to about 5 ⁇ M, from about 5 ⁇ M to about 10
- a variant CD86 polypeptide has a single amino acid substitution compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has from 2 to 10 amino acid substitutions compared to the CD 86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 2 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 3 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226.
- a variant CD86 polypeptide has 4 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 5 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 6 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 7 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 8 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226.
- a variant CD86 polypeptide has 9 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 10 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226.
- a variant CD86 polypeptide has a single amino acid substitution compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has from 2 to 10 amino acid substitutions compared to the CD 86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 2 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 3 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227.
- a variant CD86 polypeptide has 4 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 5 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 6 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 7 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 8 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227.
- a variant CD86 polypeptide has 9 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 10 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227.
- Suitable CD86 variants include a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to any one of the following amino acid sequences: Asn and the second X is any amino acid other than His.
- the first and the second X are both Ala; where X 1 is any amino acid other than Asn, X2 is any amino acid other than Asp, and X3 is any amino acid other than His .
- X 1 is Ala
- X2 is Ala
- X3 is Ala.
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure is a variant 4-1BBL polypeptide. Wild-type 4-1BBL binds to 4-1BB (CD137). [00397] In some cases, a variant 4-1BBL polypeptide is a variant of the tumor necrosis factor
- TNF homology domain
- a wild-type amino acid sequence of the THD of human 4-1BBL can be, e.g., one of
- SEQ ID NOs:253-255 as follows: 4-1BBL polypeptide, a “cognate co-immunomodulatory polypeptide” is a 4-1BB polypeptide comprising the amino acid sequence of SEQ ID NO:434.
- a variant 4-1BBL polypeptide exhibits reduced binding affinity to 4-1BB, compared to the binding affinity of a 4-1BBL polypeptide comprising the amino acid sequence set forth in one of SEQ ID NOs:252-255.
- a variant 4-1BBL polypeptide of the present disclosure binds 4-1BB with a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25%, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a 4-1BBL polypeptide comprising the amino acid sequence set forth in one of SEQ ID NOs:252-255 for a 4-1BB polypeptide (e.g., a 4-1BB polypeptide comprising the amino acid sequence set forth in SEQ ID NO:434), when assayed under the same conditions.
- a variant 4-1BBL polypeptide has a binding affinity to 4-1BB that is from
- a variant 4-1BBL polypeptide has a binding affinity for 4-1BB (e.g., a 4-1BB polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 14) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ M, to about 1 ⁇ M to about 5 ⁇ M, from about 5 ⁇ M to about 10 ⁇ M, from about 10
- 4-1BB e.g., a 4-1BB poly
- a variant 4-1BBL polypeptide has a single amino acid substitution compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has from 2 to 10 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has 2 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs: 10-13. In some cases, a variant 4-1BBL polypeptide has 3 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255.
- a variant 4-1BBL polypeptide has 4 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has 5 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has 6 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has 7 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255.
- a variant 4-1BBL polypeptide has 8 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4- 1BBL polypeptide has 9 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has 10 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255.
- Suitable 4-1BBL variants include a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to any one of the following amino acid sequences:
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure is a variant IL-2 polypeptide.
- Wild-type IL-2 binds to IL-2 receptor (IL-2R), i.e., a heterotrimeric polypeptide comprising IL-2R ⁇ , IL-2R ⁇ , and IL-2R ⁇ .
- IL-2R IL-2 receptor
- Wild-type IL2 binds to an IL2 receptor (IL2R) on the surface of a cell.
- An IL2 receptor is in some cases a heterotrimeric polypeptide comprising an alpha chain (IL-2R ⁇ ; also referred to as CD25), a beta chain (IL-2RP; also referred to as CD122: and a gamma chain (IL-2R ⁇ ; also referred to as CD132).
- Amino acid sequences of human IL-2R ⁇ , IL2R ⁇ , and IL-2R ⁇ can be as follows.
- a “cognate co-immunomodulatory polypeptide” is an IL-2R comprising polypeptides comprising the amino acid sequences of SEQ ID NO: 16, 17, and 18.
- a variant IL-2 polypeptide exhibits reduced binding affinity to IL-2R, compared to the binding affinity of a IL-2 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 15.
- a variant IL-2 polypeptide binds IL-2R with a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25%, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of an IL-2 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:340 for an IL-2R (e.g., an IL-2R comprising polypeptides comprising the amino acid sequence set forth in SEQ ID NO:340 for an IL-2R (e.g
- a variant IL-2 polypeptide has a binding affinity to IL-2R that is from 100 nM to 100 ⁇ M.
- a variant IL-2 polypeptide has a binding affinity for IL-2R (e.g., an IL-2R comprising polypeptides comprising the amino acid sequence set forth in SEQ ID NOs:16-18) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM
- a variant IL-2 polypeptide has a single amino acid substitution compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has from 2 to 10 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 2 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 3 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340.
- a variant IL-2 polypeptide has 4 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 5 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 6 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 7 amino acid substitutions compared to the IL- 2 amino acid sequence set forth in SEQ ID NO:340.
- a variant IL-2 polypeptide has 8 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 9 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 10 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. [00501] Suitable IL-2 variants include a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to any one of the following amino acid sequences: some cases, X is Ala.
- X is Met. In some cases, X is Pro. In some cases, X is Ser. In some cases, X is Thr. In some cases, X is Trp. In some cases, X is Tyr. In some cases, X is Val. In some cases, X is His; some cases, X is Ala. In some cases, X is Thr. In some cases, X is Asn. In some cases, X is Cys. In some cases, X is Gin. In some cases, X is Met. In some cases, X is Val. In some cases, X is Trp; some cases, X is Ala. In some cases, X is Arg. In some cases, X is Asn. In some cases, X is Asp.
- X is Cys. In some cases, X is Glu. In some cases, X is Gin. In some cases, X is Gly. In some cases, X is He. I n some cases, X is Lys. In some cases, X is Leu. In some cases, X is Met. In some cases, X is Phe. In some cases, X is Pro. In some cases, X is Ser. In some cases, X is Thr. In some cases, X is Tyr. In some cases, X is Trp. In some cases, X is Val; some cases, X is Ala; where X is any amino acid other than Phe. In some cases, X 1 is Ala. In some cases, X is Ala.
- X 1 is Ala; and X is Ala. In some cases, X 1 is Thr; and X is Ala; where X is any amino acid other than Phe. In some cases, X 1 is Ala. In some cases, X is Ala. In some cases, X 1 is Ala; and X is Ala; where X 2 is any amino acid other than Asp; and where X 3 is any amino acid other than Phe. In some cases, X 1 is Ala. In some cases, X 2 is Ala. In some cases, X 3 is Ala.
- X 1 is Ala; X 2 is Ala; and X 3 is Ala; where X 2 is any amino acid other than Asp; and where X 3 is any amino acid other than Phe.
- X 1 is Ala.
- X 2 is Ala.
- X 3 is Ala.
- X 1 is Ala.
- X 2 is Ala.
- X 3 is Ala.
- X 1 is Ala; X 2 is Ala; and X 3 is Ala; where X 2 is any amino acid other than Phe; and where X 3 is any amino acid other than Tyr.
- X 1 is Ala.
- X 2 is Ala.
- X 3 is Ala.
- X 1 is Ala.
- X 2 is Ala.
- X 3 is Ala.
- X 4 is Ala.
- X 1 is Ala; X 2 is Ala; X 3 is Ala; and X 4 is Ala; where X 2 is any amino acid other than Phe; where X 3 is any amino acid other than Tyr; and where X 4 is any amino acid other than Gin.
- X 1 is Ala.
- X 2 is Ala.
- X 3 is Ala.
- X 4 is Ala.
- X 1 is Ala; X 2 is Ala; X 3 is Ala; and X 4 is Ala; where X 2 is any amino acid other than Asp; where X 3 is any amino acid other than Phe; where X 4 is any amino acid other than Tyr; and where X 5 is any amino acid other than Gin.
- X 1 is Ala.
- X 2 is Ala.
- X 3 is Ala.
- X 4 is Ala.
- X 5 is Ala.
- X 1 is Ala; X 2 is Ala; X 3 is Ala; X 4 is Ala; X 5 is Ala; and where X 2 is any amino acid other than Phe; and where X 3 is any amino acid other than Gin.
- X 1 is Ala.
- X 2 is Ala.
- X 3 is Ala.
- a TMMP of the present disclosure can comprise an Fc polypeptide, or can comprise another suitable scaffold polypeptide.
- Suitable scaffold polypeptides include antibody-based scaffold polypeptides and non- antibody-based scaffolds.
- Non-antibody-based scaffolds include, e.g., albumin, an XTEN (extended recombinant) polypeptide, transferrin, an Fc receptor polypeptide, an elastin-like polypeptide (see, e.g., Hassouneh et al. (2012) Methods Enzymol.
- a silk-like polypeptide see, e.g., Valluzzi et al. (2002) Philos Trans R Soc Lond B Biol Sci. 357:165
- SELP silk-elastin-like polypeptide
- Suitable XTEN polypeptides include, e.g., those disclosed in WO 2009/023270, WO 2010/091122, WO 2007/103515, US 2010/0189682, and US 2009/0092582; see also Schellenberger et al. (2009) Nat Biotechnol. 27:1186).
- Suitable albumin polypeptides include, e.g., human serum albumin.
- Suitable scaffold polypeptides will in some cases be a half-life extending polypeptides.
- a suitable scaffold polypeptide increases the in vivo half-life (e.g., the serum half- life) of the TMMP, compared to a control TMMP lacking the scaffold polypeptide.
- a scaffold polypeptide increases the in vivo half-life (e.g., the serum half-life) of the TMMP, compared to a control TMMP lacking the scaffold polypeptide, by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 50%, at least about 2-fold, at least about 2.5- fold, at least about 5-fold, at least about 10-fold, at least about 25-fold, at least about 50-fold, at least about 100-fold, or more than 100-fold.
- an Fc polypeptide increases the in vivo half-life (e.g., the serum half-life) of the TMMP, compared to a control TMMP lacking the Fc polypeptide, by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 50%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, at least about 25-fold, at least about 50-fold, at least about 100-fold, or more than 100-fold.
- the in vivo half-life e.g., the serum half-life
- the first and/or the second polypeptide chain of a TMMP of the present disclosure comprises an Fc polypeptide.
- the Fc polypeptide of a TMMP of the present disclosure can be a human IgGl Fc, a human IgG2 Fc, a human IgG3 Fc, a human IgG4 Fc, etc.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to an amino acid sequence of an Fc region depicted in FIG. 3A-3G.
- the Fc region comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgGl Fc polypeptide depicted in FIG. 3A. In some cases, the Fc region comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgGl Fc polypeptide depicted in FIG.
- the Fc polypeptide comprises an N77A substitution.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgG2 Fc polypeptide depicted in FIG.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 99-325 of the human IgG2 Fc polypeptide depicted in FIG. 3A.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgG3 Fc polypeptide depicted in FIG.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 19-246 of the human IgG3 Fc polypeptide depicted in FIG. 3A.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgM Fc polypeptide depicted in FIG.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 1-276 to the human IgM Fc polypeptide depicted in FIG. 3B.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgA Fc polypeptide depicted in FIG.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 1-234 to the human IgA Fc polypeptide depicted in FIG. 3C.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgG4 Fc polypeptide depicted in FIG. 3C.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 100 to 327 of the human IgG4 Fc polypeptide depicted in FIG. 3C.
- the IgG4 Fc polypeptide comprises the following amino acid sequence:
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG. 3A (human IgGl Fc). In some cases, the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG. 3A (human IgGl Fc), except for a substitution of N297 (N77 of the amino acid sequence depicted in FIG. 3A) with an amino acid other than asparagine.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG. 3C (human IgGl Fc comprising an N297A substitution, which is N77 of the amino acid sequence depicted in FIG. 3A).
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG. 3A (human IgGl Fc), except for a substitution of L234 (L14 of the amino acid sequence depicted in FIG. 3A) with an amino acid other than leucine.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG. 3A (human IgGl Fc), except for a substitution of L235 (LI 5 of the amino acid sequence depicted in FIG. 3 A) with an amino acid other than leucine.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG. 3E. In some cases, the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG. 3F. In some cases, the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG. 5G (human IgGl Fc comprising an L234A substitution and an L235A substitution, corresponding to positions 14 and 15 of the amino acid sequence depicted in FIG. 3G). In some cases, the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG. 3A (human IgGl Fc), except for substitutions at L234 and L235 (L14 and L15 of the amino acid sequence depicted in FIG. 3A) with amino acids other than leucine.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG. 3E (human IgGl Fc comprising L234F, L235E, and P331S substitutions (corresponding to amino acid positions 14, 15, and 111 of the amino acid sequence depicted in FIG. 3E).
- the Fc polypeptide present in a TMMP is an IgGl Fc polypeptide that comprises L234A and L235A substitutions (substitutions of L14 and L15 of the amino acid sequence depicted in FIG. 3A with Ala), as depicted in FIG. 3G.
- a TMMP of the present disclosure can include one or more linkers, where the one or more linkers are between one or more of: i) an MHC Class I polypeptide and an Ig Fc polypeptide, where such a linker is referred to herein as “LI”; ii) an immunomodulatory polypeptide and an MHC Class I polypeptide, where such a linker is referred to herein as “L2”; iii) a first immunomodulatory polypeptide and a second immunomodulatory polypeptide, where such a linker is referred to herein as “L3”; iv) a peptide antigen (“epitope”) and an MHC Class I polypeptide; v) an MHC Class I polypeptide and a dimerization polypeptide (e.g., a first or a second member of a dimerizing pair); and vi) a dimerization polypeptide (e.g., a first or a second member of a dimerizing pair); and vi
- Suitable linkers can be readily selected and can be of any of a number of suitable lengths, such as from 1 amino acid to 25 amino acids, from 3 amino acids to 20 amino acids, from 2 amino acids to 15 amino acids, from 3 amino acids to 12 amino acids, including 4 amino acids to 10 amino acids, 5 amino acids to 9 amino acids, 6 amino acids to 8 amino acids, or 7 amino acids to 8 amino acids.
- a suitable linker can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids in length.
- a linker has a length of from 25 amino acids to 50 amino acids, e.g., from 25 to 30, from 30 to 35, from 35 to 40, from 40 to 45, or from 45 to 50 amino acids in length.
- Exemplary linkers include glycine polymers (G) n , glycine-serine polymers (including, for example, (GS) n , (GSGGS) n (SEQ ID NO:363) and (GGGS) n (SEQ ID NO:364), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers can be used; both Gly and Ser are relatively unstructured, and therefore can serve as a neutral tether between components.
- Glycine polymers can be used; glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 11173-142 (1992)).
- Exemplary linkers can comprise amino acid sequences including, but not limited to, GGSG (SEQ ID NO:365), GGSGG (SEQ ID NO:366), GSGSG (SEQ ID NO:367), GSGGG (SEQ ID NO:368), GGGSG (SEQ ID NO:369), GSSSG (SEQ ID NO:370), and the like.
- Exemplary linkers can include, e.g., Gly(Ser4)n (SEQ ID NO:371), where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- a linker comprises the amino acid sequence (GSSSS)n (SEQ ID NO:371), where n is 4.
- a linker comprises the amino acid sequence (GSSSS)n (SEQ ID NO:371), where n is 5.
- a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 1.
- a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 2.
- a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 3. In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 4. In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 5. In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 6.
- a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 7, In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 8, In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 9, In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 10. In some cases, a linker comprises the amino acid sequence AAAGG (SEQ ID NO:372).
- a linker polypeptide, present in a first polypeptide of a TMMP of the present disclosure includes a cysteine residue that can form a disulfide bond with a cysteine residue present in a second polypeptide of a TMMP of the present disclosure.
- a suitable linker comprises the amino acid sequence GCGGSGGGGSGGGGS (SEQ ID NO:208).
- a suitable linker can comprise the amino acid sequence GCGGS(G4S)n (SEQ ID NO:206), where n is 1, 2, 3, 4, 5, 6, 7, 8, or 9.
- the linker comprises the amino acid sequence GCGGSGGGGSGGGGSGGGGS (SEQ ID NO:207).
- the linker comprises the amino acid sequence GCGGSGGGGSGGGGS (SEQ ID NO:208).
- the first polypeptide and the second polypeptide of a TMMP of the present disclosure are linked to one another by at least two disulfide bonds (i.e., two interchain disulfide bonds). Examples of such multiple disulfide-linked TMMP are depicted schematically in FIG. 2A and 2B.
- a TMMP of the present disclosure comprises an IgFc polypeptide
- a heterodimeric TMMP can be dimerized, such that disulfide bonds link the IgFc polypeptides in the two heterodimeric TMMPs.
- FIG. 2A and 2B Such an arrangement is depicted schematically in FIG. 2A and 2B, where disulfide bonds are represented by dashed lines.
- the at least two disulfide bonds described in the multiple disulfide-linked TMMPPs in this section are not referring to disulfide bonds linking IgFc polypeptides in dimerized TMMPs.
- TMMP of the present disclosure are linked to one another by at least two disulfide bonds (i.e., two interchain disulfide bonds).
- disulfide bonds i.e., two interchain disulfide bonds.
- the first polypeptide and the second polypeptide of a TMMP of the present disclosure are linked to one another by 2 interchain disulfide bonds.
- the first polypeptide and the second polypeptide of a TMMP of the present disclosure are linked to one another by 3 interchain disulfide bonds.
- the first polypeptide and the second polypeptide of a TMMP of the present disclosure are linked to one another by 4 interchain disulfide bonds.
- a peptide epitope in a first polypeptide of a TMMP of the present disclosure is linked to a ⁇ 2M polypeptide by a linker comprising a Cys
- at least one of the at least two disulfide bonds links a Cys in the linker to a Cys in an MHC Class I heavy chain in the second polypeptide.
- a peptide epitope in a first polypeptide of a TMMP of the present disclosure is linked to an MHC Class I heavy chain polypeptide by a linker
- at least one of the at least two disulfide bonds links a Cys in the linker to a Cys in a ⁇ 2M polypeptide present in the second polypeptide.
- a multiple disulfide-linked TMMP of the present disclosure can comprise, for example: a) a first polypeptide comprising: i) a peptide epitope (e.g., a peptide of from 4 amino acids to about 25 amino acids in length, that is bound by a TCR when the peptide is complexed with MHC polypeptides); and ii) a first MHC polypeptide, where the first polypeptide comprises a peptide linker between the KRAS peptide and the first MHC polypeptide, where the peptide linker comprises a Cys residue, and where the first MHC polypeptide is a ⁇ 2M polypeptide that comprises an amino acid substitution that introduces a Cys residue; b) and a second polypeptide comprising a second MHC polypeptide, where the second MHC polypeptide is a Class I heavy chain comprising a Y84C substitution
- the TMMP comprises a disulfide bond between the Cys residue in the peptide linker and the Cys residue at amino acid position 84 of the Class I heavy chain or corresponding position of another Class I heavy chain allele, and where the TMMP comprises a disulfide bond between the introduced Cys residue in the ⁇ 2M polypeptide and the Cys at amino acid position 236 of the Class I heavy chain or corresponding position of another Class I heavy chain allele; and c) at least one immunomodulatory polypeptide, where the first and/or the second polypeptide comprises the at least one immunomodulatory polypeptide.
- the peptide linker comprises the amino acid sequence GCGGS (SEQ ID
- the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is an integer from 1 to 10. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 1. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 2. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 3.
- the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 4. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 5. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 6. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 7. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 8.
- the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 9. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 10.
- the peptide linker comprises the amino acid sequence CGGGS (SEQ ID NO: 1]
- the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is an integer from 1 to 10. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 1. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 2. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 3.
- the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 4. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 5. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 6. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 7. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 8.
- the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 9. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 10.
- a TMMP can be dimerized.
- a dimeric TMMP can comprise two heterodimeric TMMPs.
- a dimeric TMMP can comprise: A) a first heterodimer comprising: a) a first polypeptide comprising: i) a peptide epitope; and ii) a first major histocompatibility complex (MHC) polypeptide; and b) a second polypeptide comprising: i) a second MHC polypeptide, wherein the first heterodimer comprises one or more immunomodulatory polypeptides; and B) a second heterodimer comprising: a) a first polypeptide comprising: i) a peptide epitope; and ii) a first MHC polypeptide; and b) a second polypeptide comprising: i) a second MHC polypeptide, wherein the second heterodimer comprises one or more immunomodulatory polypeptides, and wherein the first heterodimer
- the two TMMPs are identical to one another in amino acid sequence.
- the first heterodimer and the second heterodimer are covalently linked to one another via a C-terminal region of the second polypeptide of the first heterodimer and a C-terminal region of the second polypeptide of the second heterodimer.
- first heterodimer and the second heterodimer are covalently linked to one another via the C-terminal amino acid of the second polypeptide of the first heterodimer and the C-terminal region of the second polypeptide of the second heterodimer; for example, in some cases, the C-terminal amino acid of the second polypeptide of the first heterodimer and the C-terminal region of the second polypeptide of the second heterodimer are linked to one another, either directly or via a linker.
- the linker can be a peptide linker.
- the peptide linker can have a length of from 1 amino acid to 200 amino acids (e.g., from 1 amino acid (aa) to 5 aa, from 5 aa to 10 aa, from 10 aa to 25 aa, from 25 aa to 50 aa, from 50 aa to 100 aa, from 100 aa to 150 aa, or from 150 aa to 200 aa).
- the peptide epitope of the first heterodimer and the peptide epitope of the second heterodimer comprise the same amino acid sequence.
- the first MHC polypeptide of the first and the second heterodimer is an MHC Class I p2-microglobulin, and wherein the second MHC polypeptide of the first and the second heterodimer is an MHC Class I heavy chain.
- the immunomodulatory polypeptide of the first heterodimer and the immunomodulatory polypeptide of the second heterodimer comprise the same amino acid sequence.
- the immunomodulatory polypeptide of the first heterodimer and the immunomodulatory polypeptide of the second heterodimer are variant immunomodulatory polypeptides that comprise from 1 to 10 amino acid substitutions compared to a corresponding parental wild-type immunomodulatory polypeptide, and wherein the from 1 to 10 amino acid substitutions result in reduced affinity binding of the variant immunomodulatory polypeptide to a cognate co-immunomodulatory polypeptide.
- the immunomodulatory polypeptide of the first heterodimer and the immunomodulatory polypeptide of the second heterodimer are each independently selected from the group consisting of IL-2, 4-1BBL, PD-L1, CD80, CD86, ICOS-L, OX-40L, FasL, JAG1 (CD339), TGF ⁇ , CD70, and ICAM. Examples, of suitable MHC polypeptides, immunomodulatory polypeptides, and peptide epitopes are described below.
- the first and/or the second polypeptide comprises: i) an Ig Fc polypeptide or a non-Ig scaffold; and ii) a tumor- targeting polypeptide.
- Aspect 1 An in vitro composition comprising a quantity of modified cytotoxic T cells
- mCTLs T-cell receptor (TCR) specific for a preselected antigen present in a human; and b) one or more nucleic acids comprising nucleotide sequences encoding a chimeric antigen receptor (CAR), wherein the CAR comprises an antigen-binding domain specific for a cancer-associated antigen, and wherein the percentage of target mCTLs cells in the composition exceeds at least 1 % of the total number of T cells in the composition.
- TCR T-cell receptor
- CAR chimeric antigen receptor
- CMV cytomegalovirus
- EBV Epstein-Barr virus
- HPV human papilloma virus
- adenovirus adenovirus
- influenza virus adenovirus
- Clostridium tetani Clostridium tetani.
- a composition according to aspect 3, wherein the preselected antigen is a
- a composition according to aspect 6, wherein the cytoplasmic domain comprises one or more costimulatory polypeptides.
- Aspect 8 A composition according to aspect 7, wherein the costimulatory polypeptide is selected from CD28, 4- IBB, and OX-40.
- Aspect 10 A composition according to any one of aspects 1-9, wherein the antigen- binding domain is a single-chain Fv polypeptide or a nanobody.
- Aspect 11 A composition according to any one of aspects 1-10, wherein the CAR is a single polypeptide chain CAR.
- Aspect 12 A composition according to any one of aspects 1-10, wherein the CAR comprises at least two polypeptide chains.
- CLD18 CLL-1, cMet, EGFR, EGFRvIII, EpCAM, EphA2, GD-2, glypican-3, GPC3, HER-2, kappa immunoglobulin, LeY, LMP1, mesothelin, MG7, MUC1, NKG2D ligand, PD-L1, PSCA, PSMA, ROR1, ROR1R, TACI, and VEGFR2.
- Aspect 14 A composition according to any one of aspects 1-13, wherein the percentage of total number of T cells in the composition that are target mCTLs is selected from the group consisting of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, and 100%.
- Aspect 15 A composition according to any one of aspects 1-14, wherein the target mCTLs are CD8 + T cells.
- a pharmaceutical composition comprising a composition according to any one of aspects 1-15.
- a pharmaceutical composition according to aspect 16 comprising a pharmaceutically acceptable carrier.
- Aspect 20 A method of making an in vitro composition according to any one of aspects
- composition comprising a quantity of T cells, wherein the quantity comprises target T cells having a T-cell receptor (TCR) specific for the preselected antigen;
- TCR T-cell receptor
- modifying the at least partially separated target T cells by introducing into the at least partially separated target T cells one or more nucleic acids comprising nucleotide sequences encoding a chimeric antigen receptor (CAR) that comprises an antigen-binding domain specific for a cancer-associated antigen.
- CAR chimeric antigen receptor
- a method according to aspect 20, wherein step of at least partially separating target T cells comprises binding the target T cells to a polypeptide that binds to the TCR of the target T cells.
- Aspect 22 A method according to aspect 21, wherein said polypeptide that binds to the
- TCR of the target T cells is on a surface.
- Aspect 23 A method according to aspect 22, wherein the polypeptide that binds to the
- TCR of the target T cells is present on the surface of a bead.
- Aspect 24 A method according to aspect 23, wherein the polypeptide that binds to the
- TCR is a peptide-loaded MHC multimer.
- Aspect 25 A method according to any of aspects 20-24, wherein the preselected antigen present in a human is an antigen encoded by a virus or a bacterium.
- Aspect 26 A method according to any of aspects 20-24, wherein the preselected antigen is an antigen encoded by a virus or bacterium selected from the group consisting of cytomegalovirus (CMV), Epstein-Barr virus (EBV), human papilloma virus (HPV), adenovirus, influenza virus, and Clostridium tetani.
- CMV cytomegalovirus
- EBV Epstein-Barr virus
- HPV human papilloma virus
- adenovirus adenovirus
- influenza virus adenovirus
- Clostridium tetani Clostridium tetani.
- Aspect 27 A method according to aspect 26, wherein the preselected antigen is a CMV polypeptide.
- Aspect 28 A method according to aspect 27, wherein the CMV polypeptide is a CMV pp65 polypeptide.
- Aspect 29 A method according to any of aspects 20-28, wherein the CAR comprises: a) an extracellular domain comprising the antigen-binding domain; b) a transmembrane region; and c) a cytoplasmic domain comprising an intracellular signaling domain.
- Aspect 30 A method according to aspect 29, wherein the intracellular signaling domain comprises a signaling domain from the zeta chain of human CD3.
- Aspect 31 A method according to aspect 29 or 30, wherein the cytoplasmic domain comprises one or more costimulatory polypeptides.
- Aspect 32 A method according to aspect 31, wherein the costimulatory polypeptide is selected from CD28, 4- IBB, and OX-40.
- Aspect 33 A method according to any one of aspects 20-32, wherein the antigen- binding domain is a single-chain Fv polypeptide or a nanobody.
- Aspect 34 A method according to any one of aspects 20-33, wherein the CAR is a single polypeptide chain CAR.
- Aspect 35 A method according to any one of aspects 20-33, wherein the CAR comprises two polypeptide chains.
- Aspect 36 A method according to any one of aspects 20-35, wherein the cancer- associated antigen is selected from AFP, BCMA, CD10, CD117, CD123, CD133, CD128, CD171,
- CLD18 CLL-1, cMet, EGFR, EGFRvIII, EpCAM, EphA2, GD-2, glypican-3, GPC3, HER-2, kappa immunoglobulin, LeY, LMP1, mesothelin, MG7, MUC1, NKG2D ligand, PD-L1, PSCA, PSMA, ROR1, ROR1R, TACI, and VEGFR2.
- Aspect 37 A method according to any one of aspects 20-36, wherein the percentage of total number of T cells in the composition that are target CTLs is selected from the group consisting of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, and 100%.
- Aspect 38 A method according to any one of aspects 20-37, wherein prior to step (ii), the composition comprising a quantity of T cells is contacted in vitro or in vivo with a composition comprising a T-cell modulatory polypeptide that binds to and activates substantially only the T cells comprising a T-cell receptor (TCR) specific for the preselected antigen.
- TCR T-cell receptor
- T-cell modulatory polypeptide is a T cell multimeric polypeptide (TMMP) that comprises at least one heterodimer, said heterodimer comprising:
- a first polypeptide comprising a peptide epitope and a first major histocompatibility complex (MHC) polypeptide, wherein the peptide epitope is a peptide having a length of from 4 amino acids to about 25 amino acids, and wherein the peptide epitope is an epitope of the preselected antigen;
- MHC major histocompatibility complex
- TCR T-cell receptor
- first and/or the second polypeptide comprises the immunomodulatory polypeptide
- the multimeric polypeptide comprises an immunoglobulin (Ig) Fc polypeptide or a non-Ig scaffold.
- Aspect 40 A method according to aspect 39, wherein the TMMP comprises two heterodimers, wherein both heterodimers comprise an Ig Fc polypeptide, and wherein the heterodimers are covalently bound by one or more disulfide bonds between the Ig Fc polypeptides of the first and second heterodimers.
- Aspect 41 A method according to aspect 39, wherein the TMMP comprises:
- Aspect 42 A method according to any one of aspects 39-41, wherein the at least one immunomodulatory polypeptide is a naturally occurring polypeptide, a variant of a naturally occurring polypeptide, or a fragment of a naturally occurring or variant polypeptide, and wherein the polypeptide is selected from the group consisting of a 4-1BBL polypeptide, a B7-1 polypeptide; a B7-2 polypeptide, an ICOS-L polypeptide, an OX-40L polypeptide, a CD80 polypeptide, a CD86 polypeptide, a PD-L1 polypeptide, a FasL polypeptide, a cytokine, a PD-L2 polypeptide, and combinations thereof.
- the polypeptide is selected from the group consisting of a 4-1BBL polypeptide, a B7-1 polypeptide; a B7-2 polypeptide, an ICOS-L polypeptide, an OX-40L polypeptide, a CD80 polypeptide, a
- Aspect 43 A method according to aspect 42, wherein the at least one immunomodulatory polypeptide is a naturally occurring cytokine, a variant of a naturally occurring cytokine, or a fragment of a naturally occurring cytokine.
- Aspect 44 A method according to aspect 42, wherein the cytokine is IL-2.
- Aspect 45 A method of any of aspects 39-44, wherein the at least one immunomodulatory polypeptide is a naturally occurring polypeptide, a variant of a naturally occurring polypeptide, or a fragment of a naturally occurring or variant polypeptide, wherein the at least one immunomodulatory polypeptide is selected from a 4-1BBL polypeptide and a CD80 polypeptide.
- Aspect 46 A method according to any one of aspects 39-45, wherein the TMMP comprises 2 or more immunomodulatory polypeptides.
- Aspect 47 A method according to aspect 46, wherein the 2 or more immunomodulatory polypeptides are in tandem.
- Aspect 48 A method according to any one of aspects 45-47, wherein the multimeric polypeptide comprises:
- Aspect 49 A method according to any one of aspects 45-47, wherein the multimeric polypeptide comprises:
- Aspect 50 A method according to any one of aspects 45-47, wherein the multimeric polypeptide comprises:
- a first polypeptide comprising, in order from N-terminus to C-terminus:
- Aspect 51 A method according to any one of aspects 45-50, wherein the first polypeptide and the second polypeptide are linked to one another by a disulfide bond.
- Aspect 52 A method according to any of aspects 45-51, wherein the first MHC polypeptide is a ⁇ 2M polypeptide, and the second MHC polypeptide is a class I MHC heavy chain.
- Aspect 53 A method according to aspect 52, wherein the ⁇ 2M polypeptide and the
- MHC heavy chain polypeptide are joined by a disulfide bond that joins a Cys residue in the ⁇ 2M polypeptide and a Cys residue in the MHC heavy chain polypeptide.
- Aspect 54 A method according to aspect 53, wherein a Cys at amino acid residue 12 of the ⁇ 2M polypeptide is disulfide bonded to a Cys at amino acid residue 236 of the MHC heavy chain polypeptide.
- Aspect 55 A method according to any of aspects 51-54, wherein the first polypeptide chain comprises a linker between the peptide epitope and the ⁇ 2M polypeptide.
- Aspect 56 A method according to any of aspects 51-54, wherein the first polypeptide chain comprises a linker between the peptide epitope and the ⁇ 2M polypeptide, and wherein the disulfide bond links a Cys substituted for Gly2 in the linker with a Cys substituted for Tyr84 of the MHC heavy chain polypeptide.
- Aspect 57 A method according to any one of aspects 39-56, wherein the immunomodulatory polypeptide is an activating polypeptide.
- Aspect 58 A method according to any one of aspects 39-57, wherein at least 50% of the target T cells are CD8 + T cells.
- Aspect 59 A method according to any one of aspects 20-57, comprising, between steps
- Aspect 60 A method according to any one of aspects 20-57, comprising, between steps
- a method of treating a cancer in an individual comprising introducing into the individual: i) a composition comprising a quantity of modified cytotoxic T cells according to any one of aspects 1-15; ii) a pharmaceutical composition according to any one of aspects 16-19; or iii) a composition prepared according to the method of any one of aspects 20-60.
- a method of treating cancer according to aspect 61 further comprising administering to the individual a composition comprising a T-cell modulatory polypeptide, wherein the T-cell modulatory polypeptide largely binds to and activates only the T cells comprising a T-cell receptor (TCR) specific for the preselected antigen.
- TCR T-cell receptor
- a method according to aspect 61 or aspect 62, wherein said administering a composition comprising a quantity of genetically modified cytotoxic T cells comprises administering a quantity of genetically modified cytotoxic T cells that is equal to or less than a number selected from the group consisting of 10 cells/kg body weight, 10 2 cells/kg body weight, 10 3 cells/kg body weight, 10 4 cells/kg body weight, 10 5 cells/kg body weight, 10 6 cells/kg body weight, 10 7 cells/kg body weight, 10 8 cells/kg body weight and 10 9 cells/kg body weight.
- Aspect 64 A method according to any of aspects 61-63, wherein said administering a composition comprising a quantity of genetically modified cytotoxic T cells comprises administering a quantity of genetically modified cytotoxic T cells that is equal to or less than 10 7 cells/kg body weight.
- Aspect 65 A method according to any of aspects 61-64, wherein the individual does not undergo a lymphodepleting regimen prior to the introducing step.
- T-cell modulatory polypeptide is a T cell multimeric polypeptide (TMMP) that comprises at least one heterodimer, said heterodimer comprising:
- a first polypeptide comprising a peptide epitope and a first major histocompatibility complex (MHC) polypeptide, wherein the peptide epitope is a peptide having a length of from 4 amino acids to about 25 amino acids, wherein the peptide epitope is an epitope of the preselected antigen;
- MHC major histocompatibility complex
- first and/or the second polypeptide comprises the immunomodulatory polypeptide
- the multimeric polypeptide comprises an immunoglobulin (Ig) Fc polypeptide or a non-Ig scaffold.
- Aspect 67 A method according to aspect 66, wherein the TMMP comprises:
- Aspect 68 A method according to aspect 66 or aspect 67, wherein the at least one immunomodulatory polypeptide is a naturally occurring polypeptide, a variant of a naturally occurring polypeptide, or a fragment of a naturally occurring or variant polypeptide, and wherein the polypeptide is selected from the group consisting of a 4-1BBL polypeptide, a B7-1 polypeptide; a B7-2 polypeptide, an ICOS-L polypeptide, an OX-40L polypeptide, a CD80 polypeptide, a CD86 polypeptide, a PD-L1 polypeptide, a FasL polypeptide, a cytokine, a PD-L2 polypeptide, and combinations thereof.
- the polypeptide is selected from the group consisting of a 4-1BBL polypeptide, a B7-1 polypeptide; a B7-2 polypeptide, an ICOS-L polypeptide, an OX-40L polypeptide, a CD80 polypeptide,
- Aspect 69 A method according to aspect 68, wherein the at least one immunomodulatory polypeptide is a naturally occurring cytokine, a variant of a naturally occurring cytokine, or a fragment of a naturally occurring cytokine.
- Aspect 70 A method according to aspect 68, wherein the cytokine is IL-2.
- Aspect 71 A method of aspect 66 or aspect 67, wherein the at least one immunomodulatory polypeptide is a naturally occurring polypeptide, a variant of a naturally occurring polypeptide, or a fragment of a naturally occurring or variant polypeptide, optionally wherein the at least one immunomodulatory polypeptide is selected from a 4-1BBL polypeptide and a CD80 polypeptide.
- Aspect 72 A method according to any one of aspects 66-71, wherein the TMMP comprises 2 or more immunomodulatory polypeptides.
- Aspect 73 A method according to aspect 72, wherein the 2 or more immunomodulatory polypeptides are in tandem.
- Aspect 74 A method according to any one of aspects 66-73, wherein the multimeric polypeptide comprises:
- Aspect 75 A method according to any one of aspects 66-73, wherein the multimeric polypeptide comprises:
- Aspect 76 A method according to any one of aspects 66-73, wherein the multimeric polypeptide comprises:
- Aspect 77 A method according to any one of aspects 66-76, wherein the first polypeptide and the second polypeptide are linked to one another by a disulfide bond.
- Aspect 78 A method according to any of aspects 66-77, wherein the first MHC polypeptide is a ⁇ 2M polypeptide, and the second MHC polypeptide is a class I MHC heavy chain.
- Aspect 79 A method according to aspect 78, wherein the ⁇ 2M polypeptide and the
- MHC heavy chain polypeptide are joined by a disulfide bond that joins a Cys residue in the ⁇ 2M polypeptide and a Cys residue in the MHC heavy chain polypeptide.
- Aspect 80 A method according to aspect 79, wherein a Cys at amino acid residue 12 of the ⁇ 2M polypeptide is disulfide bonded to a Cys at amino acid residue 236 of the MHC heavy chain polypeptide.
- Aspect 81 A method according to any of aspects 66-80, wherein the first polypeptide chain comprises a linker between the peptide epitope and the ⁇ 2M polypeptide.
- Aspect 82 A method according to any of aspects 66-81, wherein the first polypeptide chain comprises a linker between the peptide epitope and the ⁇ 2M polypeptide, and wherein the disulfide bond links a Cys substituted for Gly2 in the linker with a Cys substituted for Tyr84 of the MHC heavy chain polypeptide.
- Aspect 83 A method according to any one of aspects 66-82, wherein the immunomodulatory polypeptide is an activating polypeptide.
- Aspect 84 A method according to any one of aspects 61-83, wherein said administering is intramuscular, intravenous, peritumoral, or intratumoral.
- Aspect 85 A method according to any one of aspects 61-84, further comprising administering one or more checkpoint inhibitors to the individual.
- Aspect 86 A method according to aspect 85, wherein the checkpoint inhibitor is an antibody that binds to a polypeptide selected from the group consisting of CD27, CD28, CD40, CD122, CD96, CD73, CD47, 0X40, GITR, CSF1R, JAK, PI3K delta, PI3K gamma, TAM, arginase, CD137, ICOS, A2AR, B7-H3, B7-H4, BTLA, CTLA-4, LAG3, TIM3, VISTA, CD96, TIGIT, CD122, PD-1, PD-L1, and PD-L2.
- a polypeptide selected from the group consisting of CD27, CD28, CD40, CD122, CD96, CD73, CD47, 0X40, GITR, CSF1R, JAK, PI3K delta, PI3K gamma, TAM, arginase, CD137, ICOS, A2AR, B7-H3, B
- Aspect 87 A method according to aspect 85, wherein the checkpoint inhibitor is an antibody specific for PD-1, PD-L1, or CTLA4.
- Aspect 89 A composition according to any of Aspects 1-19 or a method according to any of Aspects 20-88, wherein the T cell used to make the mCTL is an allogeneic T cell.
- Aspect 90 A composition or method according to Aspect 89, wherein the allogeneic T cell has been modified to present a TCR that is specific for a preselected antigen.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Hematology (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Developmental Biology & Embryology (AREA)
- Toxicology (AREA)
- Communicable Diseases (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3146903A CA3146903A1 (en) | 2019-10-23 | 2020-10-22 | Modified cytotoxic t cells and methods of use thereof |
| CN202080063294.6A CN114423497A (zh) | 2019-10-23 | 2020-10-22 | 修饰的细胞毒性t细胞及其使用方法 |
| EP20880162.1A EP4048402A4 (en) | 2019-10-23 | 2020-10-22 | MODIFIED CYTOTOXIC T CELLS AND METHOD OF USE THEREOF |
| AU2020369573A AU2020369573A1 (en) | 2019-10-23 | 2020-10-22 | Modified cytotoxic T cells and methods of use thereof |
| JP2022520658A JP2023500573A (ja) | 2019-10-23 | 2020-10-22 | 改変された細胞傷害性t細胞及びその使用方法 |
| IL290297A IL290297A (en) | 2019-10-23 | 2022-02-02 | Modified cytotoxic t cells and methods of use thereof |
| US17/678,735 US20230000914A1 (en) | 2019-10-23 | 2022-02-23 | Modified cytotoxic t cells and methods of use thereof |
| US19/314,609 US20260053855A1 (en) | 2019-10-23 | 2025-08-29 | Modified Cytotoxic T Cells and Methods of Use Thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962925111P | 2019-10-23 | 2019-10-23 | |
| US62/925,111 | 2019-10-23 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/678,735 Continuation US20230000914A1 (en) | 2019-10-23 | 2022-02-23 | Modified cytotoxic t cells and methods of use thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021081232A1 true WO2021081232A1 (en) | 2021-04-29 |
Family
ID=75620832
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/056901 Ceased WO2021081232A1 (en) | 2019-10-23 | 2020-10-22 | Modified cytotoxic t cells and methods of use thereof |
Country Status (8)
| Country | Link |
|---|---|
| US (2) | US20230000914A1 (https=) |
| EP (1) | EP4048402A4 (https=) |
| JP (1) | JP2023500573A (https=) |
| CN (1) | CN114423497A (https=) |
| AU (1) | AU2020369573A1 (https=) |
| CA (1) | CA3146903A1 (https=) |
| IL (1) | IL290297A (https=) |
| WO (1) | WO2021081232A1 (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023212551A1 (en) * | 2022-04-28 | 2023-11-02 | Cue Biopharma, Inc. | Modified cytotoxic t cells and methods of use thereof |
| US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11851467B2 (en) | 2016-12-22 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11878062B2 (en) | 2020-05-12 | 2024-01-23 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US11958893B2 (en) | 2017-03-15 | 2024-04-16 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US12006348B2 (en) | 2017-09-07 | 2024-06-11 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptide with conjugation sites and methods of use thereof |
| US12029782B2 (en) | 2020-09-09 | 2024-07-09 | Cue Biopharma, Inc. | MHC class II T-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (T1D) and methods of use thereof |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1994000150A1 (en) * | 1992-06-25 | 1994-01-06 | City Of Hope | Induction of cytolytic t-lymphocytes with cytomegalovirus polypeptides |
| US20170335281A1 (en) * | 2014-03-15 | 2017-11-23 | Novartis Ag | Treatment of cancer using chimeric antigen receptor |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015195531A2 (en) * | 2014-06-18 | 2015-12-23 | Albert Einstein College Of Medicine, Inc. | Syntac polypeptides and uses thereof |
| EP3988111A1 (en) * | 2016-04-01 | 2022-04-27 | Innovative Cellular Therapeutics Holdings, Ltd. | Use of chimeric antigen receptor modified cells to treat cancer |
| JP7002769B2 (ja) * | 2016-09-16 | 2022-02-04 | ベイラー カレッジ オブ メディスン | ウイルス特異的t細胞の活性化および拡大のためのプラットフォーム |
| DE102016225436A1 (de) * | 2016-12-19 | 2018-06-21 | Volkswagen Aktiengesellschaft | Sensor zum Erfassen von Messwerten, Verfahren, Vorrichtung und computerlesbares Speichermedium mit Instruktionen zur Verarbeitung von Messwerten eines Sensors |
| ES2973548T3 (es) * | 2016-12-22 | 2024-06-20 | Cue Biopharma Inc | Polipéptidos multiméricos moduladores de linfocitos T y métodos para su uso |
| CN110121336A (zh) * | 2017-01-05 | 2019-08-13 | 弗莱德哈钦森癌症研究中心 | 改善疫苗功效的系统和方法 |
| EP3755711A4 (en) * | 2018-02-20 | 2021-11-24 | Technion Research & Development Foundation Limited | IMMUNOTHERAPEUTIC COMPOSITION FOR THE TREATMENT OF CANCER |
| KR20220015382A (ko) * | 2019-05-29 | 2022-02-08 | 큐 바이오파마, 인크. | 다량체 t-세포 조절 폴리펩타이드 및 이의 사용 방법 |
-
2020
- 2020-10-22 WO PCT/US2020/056901 patent/WO2021081232A1/en not_active Ceased
- 2020-10-22 AU AU2020369573A patent/AU2020369573A1/en active Pending
- 2020-10-22 CN CN202080063294.6A patent/CN114423497A/zh active Pending
- 2020-10-22 EP EP20880162.1A patent/EP4048402A4/en active Pending
- 2020-10-22 CA CA3146903A patent/CA3146903A1/en active Pending
- 2020-10-22 JP JP2022520658A patent/JP2023500573A/ja active Pending
-
2022
- 2022-02-02 IL IL290297A patent/IL290297A/en unknown
- 2022-02-23 US US17/678,735 patent/US20230000914A1/en active Pending
-
2025
- 2025-08-29 US US19/314,609 patent/US20260053855A1/en active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1994000150A1 (en) * | 1992-06-25 | 1994-01-06 | City Of Hope | Induction of cytolytic t-lymphocytes with cytomegalovirus polypeptides |
| US20170335281A1 (en) * | 2014-03-15 | 2017-11-23 | Novartis Ag | Treatment of cancer using chimeric antigen receptor |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4048402A4 * |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12180258B2 (en) | 2016-12-22 | 2024-12-31 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12152061B2 (en) | 2016-12-22 | 2024-11-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11851467B2 (en) | 2016-12-22 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12421287B2 (en) | 2016-12-22 | 2025-09-23 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11905320B2 (en) | 2016-12-22 | 2024-02-20 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11987610B2 (en) | 2016-12-22 | 2024-05-21 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12145973B2 (en) | 2016-12-22 | 2024-11-19 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11958893B2 (en) | 2017-03-15 | 2024-04-16 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11993641B2 (en) | 2017-03-15 | 2024-05-28 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US12006348B2 (en) | 2017-09-07 | 2024-06-11 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptide with conjugation sites and methods of use thereof |
| US12257311B2 (en) | 2020-05-12 | 2025-03-25 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US11878062B2 (en) | 2020-05-12 | 2024-01-23 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12485184B2 (en) | 2020-05-12 | 2025-12-02 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12485183B2 (en) | 2020-05-12 | 2025-12-02 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12029782B2 (en) | 2020-09-09 | 2024-07-09 | Cue Biopharma, Inc. | MHC class II T-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (T1D) and methods of use thereof |
| WO2023212551A1 (en) * | 2022-04-28 | 2023-11-02 | Cue Biopharma, Inc. | Modified cytotoxic t cells and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| US20230000914A1 (en) | 2023-01-05 |
| CA3146903A1 (en) | 2021-04-29 |
| EP4048402A1 (en) | 2022-08-31 |
| JP2023500573A (ja) | 2023-01-10 |
| CN114423497A (zh) | 2022-04-29 |
| US20260053855A1 (en) | 2026-02-26 |
| IL290297A (en) | 2022-04-01 |
| EP4048402A4 (en) | 2023-11-22 |
| AU2020369573A1 (en) | 2022-03-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20260053855A1 (en) | Modified Cytotoxic T Cells and Methods of Use Thereof | |
| US11702461B2 (en) | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides | |
| JP7762068B2 (ja) | 多量体t細胞調節性ポリペプチド及びその使用方法 | |
| AU2018328280B2 (en) | Multimeric T-cell modulatory polypeptides and methods of use thereof | |
| US20260070959A1 (en) | T-Cell Modulatory Chimeric Molecules and Methods of Use Thereof | |
| US20250092113A1 (en) | Multimeric T-Cell Modulatory Polypeptides and Methods of Use Thereof | |
| US20240034770A1 (en) | T-cell modulatory multimeric polypeptides and methods of use thereof | |
| WO2020257191A1 (en) | Multimeric t-cell modulatory polypeptides and methods of use thereof | |
| US20210284712A1 (en) | Multimeric t-cell modulatory polypeptides and methods of use thereof | |
| CN117222421A (zh) | T细胞调节多肽和其使用方法 | |
| JP2025515575A (ja) | T細胞エンゲージングポリペプチドおよびその使用方法 | |
| EA049738B1 (ru) | Модулирующие т-клетки мультимерные полипептиды и способы их применения |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20880162 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3146903 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020369573 Country of ref document: AU Date of ref document: 20201022 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2022520658 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020880162 Country of ref document: EP Effective date: 20220523 |