Classifications

• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
  • C12N15/09—Recombinant DNA-technology
  • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
  • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
  • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
  • C12N15/86—Viral vectors
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
  • C07K14/72—Receptors; Cell surface antigens; Cell surface determinants for hormones
  • C07K14/721—Steroid/thyroid hormone superfamily, e.g. GR, EcR, androgen receptor, oestrogen receptor
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
  • A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
  • A61K48/0058—Nucleic acids adapted for tissue specific expression, e.g. having tissue specific promoters as part of a contruct
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P21/00—Drugs for disorders of the muscular or neuromuscular system
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P5/00—Drugs for disorders of the endocrine system
  • A61P5/24—Drugs for disorders of the endocrine system of the sex hormones
  • A61P5/26—Androgens
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
  • C07K14/01—DNA viruses
  • C07K14/075—Adenoviridae
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
  • C12N15/09—Recombinant DNA-technology
  • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
  • C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
  • C12N15/1138—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
  • C12N5/06—Animal cells or tissues; Human cells or tissues
  • C12N5/0602—Vertebrate cells
  • C12N5/0625—Epidermal cells, skin cells; Cells of the oral mucosa
  • C12N5/0631—Mammary cells
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
  • C12N5/06—Animal cells or tissues; Human cells or tissues
  • C12N5/0602—Vertebrate cells
  • C12N5/0652—Cells of skeletal and connective tissues; Mesenchyme
  • C12N5/0658—Skeletal muscle cells, e.g. myocytes, myotubes, myoblasts
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
  • C12N5/06—Animal cells or tissues; Human cells or tissues
  • C12N5/0602—Vertebrate cells
  • C12N5/0684—Cells of the urinary tract or kidneys
  • C12N5/0686—Kidney cells
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
  • C12N5/06—Animal cells or tissues; Human cells or tissues
  • C12N5/0602—Vertebrate cells
  • C12N5/0693—Tumour cells; Cancer cells
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N2310/00—Structure or type of the nucleic acid
  • C12N2310/10—Type of nucleic acid
  • C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N2310/00—Structure or type of the nucleic acid
  • C12N2310/30—Chemical structure
  • C12N2310/31—Chemical structure of the backbone
  • C12N2310/312—Phosphonates
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N2310/00—Structure or type of the nucleic acid
  • C12N2310/30—Chemical structure
  • C12N2310/31—Chemical structure of the backbone
  • C12N2310/315—Phosphorothioates
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N2310/00—Structure or type of the nucleic acid
  • C12N2310/30—Chemical structure
  • C12N2310/35—Nature of the modification
  • C12N2310/351—Conjugate
  • C12N2310/3515—Lipophilic moiety, e.g. cholesterol
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N2510/00—Genetically modified cells
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
  • C12N2750/00011—Details
  • C12N2750/14011—Parvoviridae
  • C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
  • C12N2750/14141—Use of virus, viral particle or viral elements as a vector
  • C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N2800/00—Nucleic acids vectors
  • C12N2800/10—Plasmid DNA
  • C12N2800/106—Plasmid DNA for vertebrates
  • C12N2800/107—Plasmid DNA for vertebrates for mammalian

Definitions

• the invention relates to androgen receptor splice variants and treatments of androgen receptor-related disorders. Background of the invention
• the androgen receptor is a member of the type I nuclear receptor superfamily, a class of transcription factors that are activated by steroid hormones.
• the AR located on the X chromosome, is expressed in a diverse range of tissues, especially the sexual organs in males as well as in motor neurons and muscle cells.
• the AR signaling pathway plays a key role in the proper development and function of male reproductive organs, such as the prostate and epididymis, as well as musculoskeletal, cardiovascular, immune, neural and haemopoietic systems.
• AR activity is also intimately linked to prostate cancer, which is the most prevalent non -skin cancer in the US, affecting one in every six men and is the second leading cause of cancer- related deaths in males.
• NTD N terminus domain
• SBMA Bulbar muscular atrophy
• the inventors discovered that a splice variant of AR, AR2, which occurs naturally in normal tissues, is capable of repressing the activity of AR.
• AR2 also identified that certain properties of AR2, including the ability to form a heterodimer with AR and being incapable of transactivation on its own, are particularly useful for repressing AR activity.
• SBMA mice express the human AR transgene with an expanded CAG stretch, encoding for 100 glutamines (AR100Q). When these mice were treated with AR2, they showed improved survival, and increased body weight and locomotor function.
• AR variants that are capable of forming a heterodimer with AR and incapable of transactivation on its own, such as AR2, are useful therapeutics for AR-related disorders.
• AR2 may act as a decoy by forming heterocomplexes with AR, thereby acting as a transcriptional repressor repressing the activity of AR, possibly at the level of the androgen response elements (ARE) of the target genes.
• AR2 may act to fine-tune AR activity thereby restoring the homeostatic state of AR activity in normal cells.
• AR2 may act to repress the activity of the disorder- associated AR mutants.
• an enhanced activity of AR2 e.g. by gene delivery techniques, may be beneficial.
• inhibiting the expression of endogenously expressed AR e.g. by gene silencing techniques, may be beneficial.
• the therapeutic strategies based on AR2 are superior to the current strategies for treating AR-related disorders because the current strategies often involve changing the AR protein level (e.g. antisense oligonucleotides targeted to AR) or hormone levels (e.g. chemical castration), or targeting post-translational modification machineries or co-factors, all of which are either disrupting the genomic and non-genomic activity of AR or are not specific to AR and therefore are typically associated with undesirable side-effects.
• these strategies are often hampered by the potential of exacerbation of signs and symptoms related to the loss of androgen function, especially since most of the affected patients are males, who only have one copy of the AR gene.
• an aspect of the invention provides an expression construct encoding an AR variant for use in a method for treatment of the human or animal body by therapy, the AR variant comprises a polypeptide sequence having >70% (i.e. 70% or more), >80%, >90%, >95% >99% or 100% identity with the androgen receptor splice variant 2 (AR2).
• the invention also provides a host cell comprising or producing an expression construct for use in a method for treatment of the human or animal body by therapy, wherein the expression construct encodes an AR variant, wherein the AR variant comprises a polypeptide sequence having >70%, >80%, >90%, >95% >99% or 100% identity with AR2.
• the invention also provides a pharmaceutical composition for use in a method for treatment of the human or animal body by therapy, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and: (a) an expression construct encoding an AR variant for use in a method for treatment of the human or animal body by therapy, wherein the AR variant comprises a polypeptide sequence having >70%, >80%, >90%, >95% >99% or 100% identity with AR2, or (b) a host cell comprising or producing the expression construct.
• the invention also provides a method of treating an AR-related disorder in a patient in need thereof, comprising administering a therapeutically effective amount of: (a) an expression construct encoding an AR variant for use in a method for treatment of the human or animal body by therapy, wherein the AR variant comprises a polypeptide sequence having >70%, >80%, >90%, >95% >99% or 100% identity with AR2, (b) a host cell comprising or producing the expression construct, and/or (c) a pharmaceutical composition comprising (a) or (b) and a pharmaceutically acceptable carrier.
• the invention provides an agent capable of modulating (e.g . inhibiting) the expression and/or activity of AR2.
• the invention also provides a pharmaceutical composition comprising the agent.
• the invention also provides the agent or the pharmaceutical composition for use in a method for treating an AR-related disorder.
• the invention also provides a method for treating an AR-related disorder in a patient in need thereof, comprising administering to the patient an effective amount of the agent or the pharmaceutical composition.
• the invention provides an AR variant comprising a polypeptide sequence having >70%, >80%, >90%, >95% >99% or 100% identity with SEQ ID NO: 1; wherein the AR variant is capable of forming a heterodimer with AR, the AR variant alone is incapable of transactivation, and the AR variant is not SEQ ID NO: 3.
• the invention also provides an expression construct encoding the AR variant, and a host cell comprising or producing the expression construct.
• the invention also provides a pharmaceutical composition comprising the expression construct or the host cell.
• the invention also provides the AR variant, expression construct, the host cell or the pharmaceutical composition for use in a method for treating an AR-related disorder.
• the invention also provides a method for treating an AR-related disorder in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of the AR variant, expression construct, the host cell or the pharmaceutical composition.
• the invention further provides the use of the AR variant, expression construct, the host cell or the pharmaceutical composition in the manufacture of a medicament in a method of treating an AR-related disorder.
• HEK293T cells were transfected with the indicated vectors together with both the luciferase pARE-Elb-Luc and the b-galactosidase pCMV reporter constructs. AR transactivation was measured in the presence and absence of DHT by luciferase assay.
• NTS non-targeting sequence
• RNA-seq read counts for ARE-containing transcripts were used to calculate sample-to-sample Euclidean distances (grey scale) for hierarchical clustering.
• OE over expression
• EV empty vector
• siRNA siRNA-treated
• NTC non-targeting control.
• h) Cross-linked chromatin from MCF7 cells transiently expressing AR2-FLAG, treated for 24h with EtOH or DHT, was immunoprecipitated with anti-FLAG antibody or IgG isotype control.
• GREB1 cross-linked chromatin from MCF7 cells transiently expressing AR2-FLAG, treated for 24h with EtOH or DHT, was immunoprecipitated with anti-FLAG antibody or IgG isotype control.
• Figure 3 shows that overexpression of AR2 improves the phenotypic outcomes and pathologic degeneration in a preclinical trial in SBMA mice
• Scale bars represent 20 pm for spinal cord sections and 10 pm for muscle sections i) Representative spinal cord and skeletal muscle cross sections from mock- and AR2 -treated AR100Q mice from 3 independent experiments. Sections were stained with 1C2 antibody. Scale bars represent 100 pm. j) mRNA expression levels normalised to Hprt housekeeping gene in spinal cord (MEGF10 and NQOl) and muscle (CACNG1, CHRNA1, MYBPC2, MYBPH, TNNT3, and UNC45B) lysates from mock- or AR2-treated AR100Q mice. Values are expressed as fold change to wild type animals, set as 1.
• mRNA levels of endogenous AR2 in quadriceps muscles from siRNA-treated versus mock-treated AR121Q mice normalised to Hprt housekeeping gene. Data are mean ⁇ s.e.m. Each dot represents one replicate (n 3). One-tail t-test.
• Figure 5 shows AAV9-AR2 treatment improves the phenotypic outcomes in SBMA mice a) Survival - Kaplan-Meier survival estimation of SBMA mice (log-rank test) b) Disease onset - Left: Kaplan-Meier estimation of disease onset. Disease onset is defined as time in day when the mice start to exhibit sustained body weight loss for two consecutive weeks. Right: Mean days to onset c) Body weight - Left: Percentage of body weight from 8 weeks of age to end stage, with mean body weight at week 8 set to 100%. Right: Mean body weight of SBMA mice from the two treatment groups at the age of 13 weeks d) Grip strength - Percentage of mean grip strength from 8 weeks of age to end stage, with mean grip strength at week 8 set to 100%. e) Mean rotarod activity. AAV9-AR2 is referred to as AAV9-AR45 in the figures.
• SEQ ID NO: 1 shows the polypeptide sequence of an AR variant.
• SEQ ID NO: 2 shows the polynucleotide sequence encoding the AR variant of SEQ ID NO: 1.
• SEQ ID NO: 3 shows the polypeptide sequence of human AR2.
• SEQ ID NO: 4 shows the cDNA sequence of human AR2.
• SEQ ID NO: 5 shows the polypeptide sequence of the NTD of human AR.
• SEQ ID NO: 6 shows the polypeptide sequence of human AR.
• SEQ ID NO: 7 shows the polypeptide sequence of an AR variant.
• SEQ ID NO: 8 shows the polypeptide sequence of an AR variant.
• SEQ ID NOs: 9-34 shows the siRNA sequences (sense and antisense) used in the examples.
• SEQ ID NO: 35 shows the polypeptide sequence at the N-terminus of AR2 resulting from the alternative exon lb.
• the invention relates to AR variants, in particular the splice variant 2 of AR (AR2).
• AR2 from any animals may be used with the invention, in particular, human AR2
• AR2 is one of nine naturally occurring splice variants in normal tissues. AR2 was originally identified via rapid amplification of cDNA ends (RACE) with RNA isolated from human placenta tissue (17). AR2 mRNA was found to arise from inclusion of an alternative exon 1 (exon lb) situated 22.1 kb downstream of exon 1 ( Figure Id).
• the encoded protein contains a unique N-terminal sequence in place of the canonical NTD and has a molecular mass of 45 kDa, hence AR2 is also known in the literature as AR45 ( Figure 11). However, to date very little is known about its function.
• the inventors have now identified AR2 as the most highly expressed splice variant in healthy human brain tissues, motor neurons and skeletal muscles. The inventors also showed beneficial effects of SBMA mice treated with AR2 overexpression, and worsening effects of SBMA mice treated with AR2 knock down.
• the invention also refers to sequence variants. These variants include polypeptides having >70% (i.e. 70% or more), >75%, >80%, >85%, >90%, >95% or 99% sequence identity to AR2, e.g. human AR2 (SEQ ID NO: 3).
• Further AR variants useful with the invention may comprise a polypeptide sequence having >70% (i.e. 70% or greater) identity with SEQ ID NO: 1.
• the AR variant may comprise or consist of a polypeptide sequence having >80%, >90%, >95% >99% or 100% identity with SEQ ID NO: 1.
• the AR variant is not AR2, e.g. the AR variant is not SEQ ID NO: 3.
• the cDNA corresponding to SEQ ID NO: 1 is provided in SEQ ID NO: 2.
• the AR variant may comprise or consist of a polynucleotide sequence having >80%, >90%, >95% or >99% identity with SEQ ID NO: 2.
• SEQ ID NO: 1 corresponds to amino acids 556-920 of SEQ ID NO: 6.
• SEQ ID NO: 6 is the polypeptide sequence of human androgen receptor (AR; ENST00000374690), also referred to as AR1 herein.
• Human AR is composed of three main domains: (i) exon 1 encodes the highly variable amino-terminal domain (NTD) (amino acids 1-555; provided as SEQ ID NO: 5), with potent transcriptional activator capability, (ii) exons 2 and 3 encode a central two zinc finger motifs DNA-binding domain (DBD) and the hinge region (amino acids 556-670), and (iii) exons 4-8 encode a well-conserved carboxy-terminal ligand-binding domain (LBD; amino acids 671-920) responsible for interacting with the transcriptional machinery.
• NTD highly variable amino-terminal domain
• DBD DNA-binding domain
• LBD carboxy-terminal ligand-binding domain
• an AR variant according to the invention is capable of forming a heterodimer with AR.
• the AR variants according to the invention may act as a decoy by forming heterocomplexes with the disease-associated AR mutants, thereby modulating the activity of the disease-associated AR mutants, possibly at the level of the androgen response elements (ARE) of the target genes.
• ARE androgen response elements
• dimerization is mediated mainly through N/C-terminal interactions via the FXXLF motif and DBD/DBD interactions via the dimerization box (D-box).
• an AR variant according to the invention may contain the DBD and LBD domains of AR, i.e. SEQ ID NO: 1, which corresponds to amino acids 556-920 of SEQ ID NO: 6.
• an AR variant according to the invention is incapable of transactivation alone, even in presence of the ligand.
• a region having transactivation function is the activating function 1 (AF-1) subdomain in the NTD of AR, which spans amino acids 51-211.
• AF-1 activating function 1
• an AR variant according to the invention may partially lack the NTD, such as lacking the AF-1 subdomain.
• an AR variant according to the invention may be SEQ ID NO: 7, which lacks amino acids 51-211 of SEQ ID NO: 6.
• An AR variant according to the invention may be SEQ ID NO: 8, which lacks amino acids 1-211 of SEQ ID NO: 6.
• the AR variant may lack the entire NTD, e.g. the AR variant does not comprise SEQ ID NO: 5.
• An AR variant may be encoded by a mRNA partially lacking the canonical exon 1.
• the AR variant may be encoded by a mRNA that lacks the entire canonical exon 1 of AR.
• the NTD contains the polyglutamine tract (5-36 residues) (amino acids 59-89 of SEQ ID NO: 6) and the size of this polyglutamine tract affects AR function, with longer tracts associated with lower AR activity. For example, expansion of this polyglutamine tract (e.g. 38-68 residues) causes SBMA.
• an AR variant according to the invention may lack the region corresponding to the polyglutamine tract.
• An AR variant according to the invention may contain modifications relative to any of SEQ ID NOs: 1, 3, 7 and 8, such as amino acid substitutions, additions or deletions.
• the AR variant may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid residues that are substituted, deleted or added, in any combination.
• the variants may have additions, deletions or substitutions of amino acid residues which do not substantially alter the biological activity of AR2.
• Those individual sites or regions of AR2, which can be altered without affecting biological activity can be determined by examination of the structure of the AR2 domains, for example.
• the regions which would tolerate amino acid substitutions may be determined by alanine scanning mutagenesis (2).
• selected amino acid residues are individually substituted with a neutral amino acid (e.g . alanine) in order to determine the effects on biological activity.
• An AR variant may contain conservative amino acid changes which are least likely to perturb the structure and/or function of a polypeptide.
• the variant may comprise one or more conservative amino acid changes within any of SEQ ID NOs: 1, 3, 7 and 8.
• Conservative amino acid changes generally involve substitution of one amino acid with another that is similar in structure and/or function (e.g. amino acids with side chains similar in size, charge and shape).
• Amino acid residues having similar side chains are known in the art. These include amino acids with basic side , chains (e.g. lysine, arginine, histidine), acidic side chains (e.g. aspartic acid, glutamic acid), uncharged polar side chains (e.g.
• glycine asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
• nonpolar side chains e.g. alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
• beta-branched side chains e.g. threonine, valine, isoleucine
• aromatic side chains e.g. tyrosine, phenylalanine, tryptophan, histidine.
• one or more amino acid residue within AR2 can be replaced with other amino acid residues having similar side chains and the altered protein can be tested for retained function using the functional assays described herein. Modifications can be introduced by standard techniques known in the art, such as site-specific mutagenesis (3) and PCR-mediated mutagenesis, provided that activity, e.g., the ability to form heterodimerisation with AR, is retained.
• An AR variant may be codon optimized to increase expression levels of the respective protein in host cells as compared to if the unaltered sequence.
• Methods for codon optimisation are known in the art, e.g. GeneScript OptimumGeneTM algorithm can be used.
• the invention refers to a polynucleotide encoding AR2, e.g. human AR2 (SEQ ID NO: 4).
• the invention also refers to polynucleotide encoding AR variants.
• the polynucleotide may differ from the polynucleotide sequence shown in SEQ ID NO: 4 due to degeneracy of the genetic code and thus encode the same protein as that encoded by the polynucleotide sequence shown in SEQ ID NO: 4.
• the polynucleotide may have >70% (i.e. 70% or more), >75%, >80%, >85%, >90%, >95% or 100% sequence identity to SEQ ID NO: 4.
• the polynucleotide may encode any AR variant protein described herein.
• the invention further provides expression constructs encoding AR variants according to the invention for use in therapy.
• Any expression constructs suitable to be expressed in humans and animals can be used with the invention.
• the expression construct may be a non-viral plasmid-based vector or a viral vector.
• the viral vector may be one derived from adenoviruses, adeno-associated viruses (AAV), or retroviruses, including lentiviruses such as the human immunodeficiency (HIV) virus.
• AAV adeno-associated viruses
• retroviruses including lentiviruses such as the human immunodeficiency (HIV) virus.
• the expression construct may be prepared by standard means known in the art for provision of expression constructs for gene therapy. Thus, well established public domain transfection and/or transduction, packaging and purification methods can be used to prepare a suitable vector preparations, and suitable viral particles.
• the expression construct may also comprise regulatory sequences allowing expression and, preferably, secretion of the encoded protein, such as e.g., a promoter, enhancer, polyadenylation signal, internal ribosome entry sites (IRES), sequences encoding protein transduction domains (PTD).
• regulatory sequences allowing expression and, preferably, secretion of the encoded protein, such as e.g., a promoter, enhancer, polyadenylation signal, internal ribosome entry sites (IRES), sequences encoding protein transduction domains (PTD).
• the expression construct may comprise a polynucleotide comprising a promoter region, operably linked to AR2, to cause or improve expression of the therapeutic protein in infected host cells.
• the promoter may be ubiquitous, tissue-specific, strong, weak, regulated or chimeric. The promoter is typically selected to allow efficient and suitable production of the protein in the infected tissue.
• the promoter may be of mammalian (e.g. human or murine) origin, or of other origin, including cellular, viral, fungal, plant or synthetic promoters.
• the promoter may be functional in nervous cells, e.g. motor cells, and muscle cells, particularly in human cells. Examples of a regulated promoter useful with the invention include Tet on/off element-containing promoters, rapamycin-inducible promoters and metallothionein promoters.
• the promoter may be tissue-specific, such as a muscle-specific promoter.
• a muscle-specific promoter useful with the invention may be the mammalian muscle creatine kinase (MCK) promoter, the mammalian desmin (DES), or an artificial promoter based on MCK (e.g. enh358MCK, see reference 4) or DES.
• tissue-specific promoter useful with the invention may be a motor neuron- specific promoter.
• promoters specific for the motor neurons include the promoter of the Choline Acetyl Transferase (ChAT).
• Other promoters functional in motor neurons include the promoters of the Calcitonin Gene-Related Peptide (CGRP) (a known motor neuron-derived factor), Neuron Specific Enolase (NSE), Synapsin, or ubiquitous promoters including Neuron Specific Silencer Elements (NRSE).
• CGRP Calcitonin Gene-Related Peptide
• NSE Neuron Specific Enolase
• NRSE Neuron Specific Silencer Elements
• the promoter may be a constitutively active promoter selected from the group consisting of the cytomegalovirus (CMV) promoter, the phosphoglycerate kinase (PGK) promoter, the simian virus 40 (SV40) promoter, the Ubiquitin C (UbC) promoter, the CAG promoter, the ubiquitous chromatin opening element (UCOE) promoter, the CD1 lb promoter, the Wiskott-Aldrich syndrome (WAS) promoter and the Glyceraldehyde 3 -phosphate dehydrogenase (GAPDH) promoter.
• CMV cytomegalovirus
• PGK phosphoglycerate kinase
• UbC Ubiquitin C
• CAG CAG promoter
• UCOE ubiquitous chromatin opening element
• CD1 lb promoter the CD1 lb promoter
• WAS Wiskott-Aldrich syndrome
• GPDH Glyceralde
• An expression construct useful with the invention comprises the enh358MCK promoter.
• the enh358MCK promoter is known in the art is constructed by ligating the ⁇ 200bp enhancer with the 358 bp proximal promoter of the murine MCK gene.
• the AR variant according to the invention is expressed from the enh358MCK promoter.
• An expression construct useful with the invention comprises the Choline Acetyl
• ChAT Transferase
• AR variants, polynucleotides and expression constructs described herein may be administered to treat AR2-related disorders by way of gene therapy, such that the expression construct produces its encoded protein for mediating a therapeutic effect in the host.
• the treatment according to the invention may include a step of delivering the expression construct directly into a patient or cell.
• the expression construct may be directly administered in vivo, where it is expressed to produce the encoded product. This can be accomplished by any of numerous methods known in the art, e.g., by infection using defective or attenuated retrovirals or other viral vectors, or by direct injection of naked DNA, or by use of microparticle bombardment (e.g.
• the expression construct can be targeted in vivo for cell specific uptake and expression, by targeting a specific receptor, e.g. see referenced.
• the expression construct may be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination, e.g. see references 15 and 16.
• the treatment according to the invention may include transforming host cells with the expression constructs in vitro, followed by transplantation of the host cells into the patient.
• Methods of introducing expression constructs to cells in tissue culture are well known in the art, including transfection, electroporation, micro injection, infection with a viral or bacteriophage vector containing the nucleic acid sequences, cell fusion, chromosome- mediated gene transfer, microcell-mediated gene transfer, spheropiast fusion.
• the technique typically provides for the stable transfer of the expression construct to the host cell, so that the expression construct is expressible by the host cell and can be heritable and expressible by its cell progeny.
• the method of introducing expression constructs may further include introducing a selectable marker to the host cells, and placing the host cells under selection, and isolating the host cells that have taken up and are expressing the transferred gene.
• the resulting recombinant cells can be delivered to a patient by various methods known in the art.
• the invention also provides host cells comprising or producing the expression constructs according to the invention.
• Host cells into which an expression construct can be introduced for purposes of gene therapy encompass any desired, available cell type.
• stem or progenitor cells can be used. Any stem and/or progenitor cells which can be isolated and maintained in vitro can potentially be used, e.g. such as those described in references 17,18,19,20.
• the host cells are blood cells
• the recombinant blood cells e.g. hematopoietic stem or progenitor cells
• the amount of host cells for use depends on various factors, such as the desired effect and the patient state, and can be routinely determined by one skilled in the art. Modulation of AR2 activity
• the invention involves using agents that are capable of modulating the activity of AR2.
• the agent may be an agent which downregulates the transcriptional level and/or protein level of AR2, an agent which modulate the interaction between AR2 with their co factors, such as coactivator proteins or DNA response elements, and agents which modulate posttranslational modification of AR2.
• the agent may be capable of specifically modulating AR2 activity, without affecting the activity of AR and the other endogenously expressed splice variants of AR.
• the agent may have >50% (i.e. 50% or more), >60%, >70%, >80%, >90% or 100% selectivity for AR2 compared to AR or any of the other endogenously expressed splice variants of AR, i.e. AR1,. AR3, AR4, AR5, AR6, AR7, AR8 or AR9.
• the agent may be an inhibitor of transcription of AR2, an inhibitor of translation of AR2, or an antagonist of AR2.
• the agent may inhibit expression of the AR2 mRNA.
• it may be antisense oligonucleotide, RNA interference oligonucleotide (RNAi), ribozyme, an agent that degrades transcription factors required for AR2 transcription, or an antibody that binds to AR2.
• RNAi RNA interference oligonucleotide
• the agent may reduce the level of mRNA expression of AR2 by >50% ⁇ i.e. 50% or more), >60%, >70%, >80% >90% or 100% compared to when the agent is not administered.
• the agent may inhibit the function of AR2.
• the activity of AR2 may be reduced by >50% ⁇ i.e. 50% or more), >60%, >70%, >80% >90% or 100% compared to when the agent is not administered.
• RNAi techniques may be used to knock down AR2 in cells.
• the agent may be in the form of dsRNA (double stranded RNA) or shRNA (short hairpin RNA) molecules which are digested in vivo to 21-23 nt fragment small interfering RNAs (siRNAs) that mediate the RNAi effect.
• the siRNA may be encoded by nucleotide sequences within polynucleotide sequences of AR2 ⁇ e.g. SEQ ID NO:4).
• the siRNA may be about 20-50 nucleotides in length, e.g. about 21-23 nucleotides in length.
• the siRNA may have >70% ⁇ i.e.
• the siRNA may comprises the sequences listed in any of SEQ ID NOs: 9-32.
• the siRNA may comprise the sequences listed SEQ ID NOs: 31 and 32.
• the siRNA may be composed of conventional nucleotides A, G, T, C, or U, or unusual or modified nucleotides such as inosinic acid, 1 -methyl inosinic acid, 1 -methyl guanylic acid, NN-dimethyl guanylic acid, pseudouridylic acid, ribothymidylic acid, 5- hydroxymethylcytosine, and 5-hydroxymethyluridine.
• siRNAs or vectors encoding the same may be delivered to cells by techniques known in the art, such as in vivo or ex vivo gene therapy approaches as described above.
• the siRNAs may be prepared by any methods that are known in the art, including, but not limited to, oligonucleotide synthesis, in vitro transcription, ribonuclease digestion, or generation of siRNAs in vivo.
• Antisense techniques may also be used according to the invention.
• An antisense oligonucleotide useful according to the invention may be RNA or DNA that is complementary to AR2 (e.g . SEQ ID NO: 4) and is capable of hybridising to and inhibiting the expression of AR2.
• the antisense oligonucleotide may have >70% ( /. e. 70% or more), >80%, >90%, >95%, >99% or 100% complementarity to AR2.
• the antisense oligonucleotide may be 15 to 30 bp in length. Other criteria that are known in the art may be used to select the antisense oligonucleotides, varying the length or the annealing position in the targeted sequence.
• the antisense oligonucleotide may include derivatives such as S-oligonucleotides (phosphorothioate derivatives or S-oligos).
• the antisense oligonucleotide is coadministered with an agent which enhances the uptake of the antisense molecule by the cells, e.g. a lipophilic cationic compound which may be in the form of liposomes.
• the antisense oligonucleotide may be combined with a lipophilic carrier such as sterols, e.g. cholesterol, cholate and deoxycholic acid.
• the antisense oligonucleotide may be conjugated to a peptide that is ingested by cells, e.g. peptide hormones, antigens or antibodies or peptide toxins.
• Ribozymes may also be useful in the invention.
• antisense RNA/ribozyme fusions which comprise antisense RNA targeted to AR2 and a ribozyme which cleaves RNA can be used.
• the ribozyme molecule may be based upon the chloramphenicol acetyltransferase ribozyme or hairpin ribozymes.
• the invention further relates to the AR variants, expression constructs, host cells, AR2 modulation agents, or pharmaceutical compositions described herein for use in a method for treatment of the human or animal body by therapy.
• the invention further relates to the use of the AR variants, expression constructs, host cells, AR2 modulation agents, or pharmaceutical compositions described herein in a method for treatment of the human or animal body by therapy.
• the invention further relates to the use of the AR variants, expression constructs, host cells, AR2 modulation agents, or pharmaceutical compositions described herein in the manufacture of a medicament for a method for treatment of the human or animal body by therapy.
• the invention also relates to methods of treatments using the AR variants, expression constructs, host cells, AR2 modulation agents, or pharmaceutical compositions described herein.
• the invention relates to methods of treating AR-related disorders.
• the methods and uses of the invention may comprise inhibiting the disease state, e.g. arresting its development; and/or relieving the disease state, e.g. causing regression of the disease-state until a desired endpoint is reached.
• the methods and uses of the invention may comprise the amelioration of a symptom of the AR-related disorder (e.g. lessen the pain or discomfort), and such amelioration may or may not be directly affecting the disease.
• the methods and uses of the invention may comprise preventing the AR- disorder from occurring in a mammal (e.g. humans), in particular, when such mammal is predisposed to the AR-disorder but has not yet been diagnosed as having it.
• the methods and uses of the invention may comprise restoring AR activity and/or AR signalling in patients to normal levels for a healthy subject.
• An AR disorder is a disorder that is associated with aberrant activity of AR.
• the disorder may be caused in part or exacerbated by increased AR activity, e.g. as a result of a toxic-gain-of-function AR mutant (e.g. in SMBA).
• the AR activity in these disorders may be increased by >50% (i.e. 50% or more), >60%, >70%, >80%, >90%,
• AR activity in healthy subjects >100% or >200% compared to the AR activity in healthy subjects.
• repressing AR activity by AR variants described herein may be beneficial.
• the disorder may be caused in part or exacerbated by decreased AR activity, e.g. as a result of a loss-of-function AR mutant (e.g. in androgen-insensitivity syndrome).
• the AR activity in these disorders may be decreased by >50% (i.e. 50% or more), >60%, >70%, >80%, >90% or >100% compared to the AR activity in healthy subjects.
• increasing AR activity by alleviating its repression e.g. by inhibiting AR2 expression using the AR2 modulating agents described herein, may be beneficial.
• the methods and uses of the invention may include a step of determining the expression and/or activity levels of AR and disorder-associated AR mutants in a sample from the patient.
• Methods of determining the expression and/or activity levels of AR and disorder-associated AR mutants are known in the art and exemplified in the Examples described herein (e.g. see Figures 2a and 2b).
• the level of AR expression may be assayed by detecting and measuring AR transcription.
• AR transactivation activity can be measured by reporter assays, such as luciferase assays, which involves transfecting into the cells a reporter vector with an insertion of an androgen responsive element (ARE) upstream of the reporter gene, followed by measuring the expression level or the reporter gene.
• reporter assays such as luciferase assays, which involves transfecting into the cells a reporter vector with an insertion of an androgen responsive element (ARE) upstream of the reporter gene, followed by measuring the expression level or the reporter gene.
• ARE androg
• RNA from a sample may be isolated and tested by hybridisation or PCR techniques as known in the art.
• AR2 expression assays can be performed in situ, i.e. directly upon tissue sections (fixed and/or frozen) of patient tissue obtained from biopsies or resections, such that no nuclei acid purification is necessary. Immunoassays may also be used.
• the methods and uses of the invention may include a step of identifying patients that have an AR-related disorder.
• Methods for identifying patients that have an AR-related disorder are known in the art. For example, clinical testing of repeat numbers (e.g . CAG polyglutamine and/or GGN polyglycine repeats) or mutations in the AR gene can be carried out. It has been shown that a short CAG repeat causes increase AR transactivation (e.g. in benign prostatic hyperplasia), whereas a longer CAG stretch results in reduced activity (e.g. in SBMA). Furthermore, their effects in altering AR transcriptional activity has been considered to cumulatively contribute to cancer risk and age of diagnosis, e.g. in prostate cancer.
• the patient may be male or female.
• the patient is typically male.
• the patient may be suffering from the AR-related disorder or may be at risk of an AR-related disorder.
• the patient may be identified as being at risk of, or having, an AR- related disorder.
• the patient may be asymptomatic.
• the patient may have a predisposition to the AR-related disorder.
• the method or use may comprise a step of identifying whether or not a patient is at risk of developing, or has an AR-related disorder.
• AR-related disorders examples include SBMA, androgen-insensitivity syndrome, bone and/or metabolic conditions, prostate cancer, androgen deficiency, hypogonadism, benign prostatic hyperplasia (BPH).
• AR-related disorders are known in the art, e.g. reviewed in Davey and Grossmann (21) and Shukla et al (22).
• the invention relates to treating spinal and bulbar muscular atrophy (SBMA).
• Spinal and bulbar muscular atrophy also known as Kennedy’s disease
• Kennedy is an X- linked disease caused by CAG repeat expansions in the AR gene, characterized by motor neuron degeneration and primary muscle atrophy.
• the degenerating motor neurons are located primarily at the anterior horns of the spinal cord and in the bulbar region.
• the polymorphic CAG repeat usually consists of 9-36 repeats; expansion beyond 40 repeats causes neurotoxicity.
• SBMA only affects males, its prevalence is 1/50:000.
• SBMA neuromuscular symptoms generally first appear as muscle spasms and weakness in the extremities, mouth, and throat, which progress to muscle wasting due to loss of motor neurons.
• Treatment is symptomatic, usually entailing physical therapy and rehabilitation.
• Patients with SBMA frequently become confined to a wheelchair later in life and require assistance with common daily tasks, such as eating.
• AR silencing has long been sought after as an attractive therapeutic strategy, although it is hampered by the direct and indirect effects associated with AR loss of function.
• Methods and uses of the invention may include alleviating one or more symptoms associated with SBMA, including preventing, delaying or reducing: loss of muscle mass, loss of mobility, and loss of physical strength.
• the invention may also relate to reversing the signs of androgen insensitivity in the subject.
• repressing AR activity by AR variants described herein may be beneficial.
• the invention provides AR variants, expression constructs, host cells and pharmaceutical compositions described herein for use in a method for treatment of SBMA.
• the invention further provides the use of AR variants, expression constructs, host cells and pharmaceutical compositions described herein in a method for treatment of SBMA.
• the invention further provides the use of AR variants, expression constructs, host cells and pharmaceutical compositions described herein in the manufacture of a medicament for a method for treatment of SBMA.
• the invention also provides a method for treatment of SBMA using the AR variants, expression constructs, host cells and pharmaceutical compositions described herein. Androgen Insensitivity Syndrome
• the invention relates to treating androgen-insensitivity syndrome, such as complete (CAIS) or partial (PAIS) androgen insensitivity.
• CAIS complete
• PAIS partial
• Missense and nonsense mutations in the AR gene resulting in loss-of-function AR mutants cause a wide spectrum of abnormalities in male development. Such abnormalities range from mild virilisation defects to complete male-to-female phenotypic sex reversal; these mutations lead to either complete (CAIS) or partial (PAIS) androgen insensitivity.
• CAIS complete male-to-female phenotypic sex reversal
• the invention provides AR2 modulating agents and pharmaceutical compositions comprising AR2 modulating agents, as described herein, for use in a method for treatment of AIS.
• the invention further provides the use of AR2 modulating agents and pharmaceutical compositions comprising AR2 modulating agents, as described herein, in a method for treatment of AIS.
• the invention further provides the use of AR2 modulating agents and pharmaceutical compositions comprising AR2 modulating agents, as described herein, in the manufacture of a medicament for a method for treatment of AIS.
• the invention also provides a method for treatment of AIS using AR2 modulating agents and pharmaceutical compositions comprising AR2 modulating agents, as described herein.
• the invention relates to treating bone or metabolic conditions and typically these conditions are caused in part or exacerbated by decreased AR activity, e.g. caused by loss- of-function AR mutants.
• Bone or metabolic conditions useful with the invention include osteoporosis (such as age-related osteoporosis), osteopenia, glucocorticoid- induced osteoporosis, periodontal disease, HIN-wasting, cancer cachexia, bone fracture, bone damage following bone reconstructive surgery, muscular dystrophies, sarcopenia, frailty (e.g. decreased bone mass, reduced muscle mass, and lower strength.), aging skin, male hypogonadism, post menopausal symptoms in women, female sexual dysfunction, premature ovarian failure, autoimmune disease, atherosclerosis, hypercholesterolemia, hyperlipidemia, aplastic anaemia and other hematopoietic disorders, arthritis and joint repair.
• osteoporosis such as age-related osteoporosis
• osteopenia such as age-related osteoporosis
• glucocorticoid- induced osteoporosis glucocorticoid- induced osteoporosis
• periodontal disease such as
• the invention provides AR2 modulating agents and pharmaceutical compositions comprising AR2 modulating agents, as described herein, for use in a method for treatment of a bone or metabolic condition.
• the invention further provides the use of AR2 modulating agents and pharmaceutical compositions comprising AR2 modulating agents, as described herein, in a method for treatment of a bone or metabolic condition.
• the invention further provides the use of AR2 modulating agents and pharmaceutical compositions comprising AR2 modulating agents, as described herein, in the manufacture of a medicament for a method for treatment of a bone or metabolic condition.
• the invention also provides a method for treatment of a bone or metabolic condition using AR2 modulating agents and pharmaceutical compositions comprising AR2 modulating agents, as described herein.
• the invention relates to treating prostate cancer.
• Prostate development and prostate cancer are critically dependent on androgen signalling.
• androgen deprivation therapy remains the most widely used treatment for patients with advanced prostate cancer.
• androgen deprivation initially results in prostate tumour regression, the tumours eventually re-emerge, and the resulting hormone-refractory (androgen independent) state is invariably fatal.
• prostate tumours rely on AR signalling.
• PSA prostate specific antigen
• the invention may include a step of determining PSA levels in the patients to evaluate the regression of prostate cancer in a patient.
• the invention provides AR variants, expression constructs, host cells, AR2 modulating agents and pharmaceutical compositions described herein for use in a method for treatment of prostate cancer.
• the invention further provides the use of AR variants, expression constructs, host cells, AR2 modulating agents and pharmaceutical compositions described herein in a method for treatment of prostate cancer.
• the invention further provides the use of AR variants, expression constructs, host cells AR2 modulating agents and pharmaceutical compositions described herein in the manufacture of a medicament for a method for treatment of prostate cancer.
• the invention also provides a method for treatment of prostate cancer using the AR variants, expression constructs, host cells AR2 modulating agents and pharmaceutical compositions described herein.
• the invention also provides a pharmaceutical composition
• a pharmaceutical composition comprising a AR variant, a polynucleotide, an expression construct, a host cell or a AR2 modulation agent described herein.
• a pharmaceutical composition of the invention may comprise a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other materials well known to those skilled in the art. Such materials are typically non- toxic and does not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material may be determined by the skilled person according to the route of administration.
• the pharmaceutical composition is typically in liquid form. Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil.
• Physiological saline solution magnesium chloride, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
• a surfactant such as pluronic acid (PF68) 0.001% may be used.
• the active ingredient will be in the form of an aqueous solution which is pyrogen- free and has suitable pH, isotonicity and stability.
• isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection, Hartmann's solution.
• Preservatives, stabilisers, buffers, antioxidants and/or other additives may be included, as required.
• a vector may be included in a pharmaceutical composition which is formulated for slow release, such as in microcapsules formed from biocompatible polymers or in liposomal carrier systems according to methods known in the art.
• Dosages and dosage regimes can be determined within the normal skill of the medical practitioner responsible for administration of the composition.
• a therapeutically effective amount of the expression construct, host cell, AR2 modulation agent or pharmaceutical composition according to the invention would be administered to such a subject.
• a therapeutically effective amount is an amount which is effective to ameliorate one or more symptoms of the disorder.
• the dosage may be determined according to various parameters, especially according to the age, weight and condition of the patient to be treated; the route of administration; and the required regimen. A physician will be able to determine the required route of administration and dosage for any particular patient.
• the dose may be provided as a single dose, but may be repeated or in cases where vector may not have targeted the correct region and/or tissue (such as surgical complication).
• the treatment is preferably a single permanent treatment, but repeat injections, for example in future years.
• Administration may take place once the symptoms of the AR-related disorder have appeared in a subject, for example to treat existing symptoms of the disease.
• AR variants, polynucleotides, expression constructs, host cells, AR2 modulation agents and/or pharmaceutical compositions according to the invention can be used in combination, and/or in combination with any other therapy for the treatment of AR-related disorders.
• an expression construct includes “expression constructs”, i.e. including two or more expression constructs.
• the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e. the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5 -fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term "about” meaning within an acceptable error range for the particular value should be assumed.
• AR variant is a collective term referring to any polypeptide that differs from human AR (ENSP00000363822) (SEQ ID NO: 6), also referred to as AR1 herein, and has retained at least some of the biological activities of AR (e.g . capable of dimerization, capable of binding to an androgen, capable of binding to androgen responsive elements (AREs) and/or capable of transactivation).
• AR variant encompasses AR2 and variants thereof as described herein.
• Sequence identity may be calculated using any suitable algorithm.
• PILEUP and BLAST algorithms can be used to calculate identity or line up sequences (such as identifying equivalent or corresponding sequences (typically on their default settings), for example as described in Altschul (23;24).
• Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/).
• This algorithm involves first identifying high scoring sequence pair (HSPs) by identifying short words of length W in the query sequence that either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighbourhood word score threshold (Altschul et al , supra).
• These initial neighbourhood word hits act as seeds for initiating searches to find HSPs containing them.
• the word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Extensions for the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative scoring residue alignments; or the end of either sequence is reached.
• the BLAST algorithm parameters W, T and X determine the sensitivity and speed of the alignment.
• the BLAST algorithm performs a statistical analysis of the similarity between two sequences; see e.g. reference 26.
• One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two polynucleotide or amino acid sequences would occur by chance.
• P(N) the smallest sum probability
• a sequence is considered similar to another sequence if the smallest sum probability in comparison of the first sequence to the second sequence is less than about 1, preferably less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
• the UWGCG Package provides the BESTFIT program which can be used to calculate identity (for example used on its default settings) (27).
• AAV vector plasmids To express AR2 in mice, dual promoter AAV vector plasmids were used (provided by SignaGen Laboratories (Rockville, MD)). These plasmids contain an expression cassette consisting of a human elongation factor- la (EIFla) promoter followed by AR2 cDNA or mock sequence and human cytomegalovirus (CMV) promoter followed by cDNA encoding GFP. A viral load of 10 11 vector genomes (vg) was injected into the tail veins of SBMA AR100Q mice.
• EIFla human elongation factor- la
• CMV human cytomegalovirus
• BAC AR121Q mice were injected subcutaneously with 20 mg/kg siRNA suspended in PBS (100 m ⁇ ). Body weight, rotarod, and grip strength using hanging wire and strength meter (Bioseb) were recorded weekly.
• HEK293T cells ATCC
• MCF7 cells ATCC
• immortalised human myoblast cells MRC CNMD Biobank London L954/1284M-I
• Induced pluripotent stem cells were cultured and differentiated into motor neuron like cells, according to published protocol (Grunseich C, 2014).
• AR induction was performed by addition of dihydrotestosterone, DHT, (Sigma- Aldrich) to a final concentration of 10 nM in the respective cell culture medium. Equal volume of ethanol was added for the uninduced controls.
• CGND HRA 00400 CGND HRA 00402, CGND HRA 00411 , CGND HRA 00412,
• AR FL (12Q), AR FL (55Q) and AR2 were amplified and cloned separately into a mammalian expression vector under cytomegalovirus promoter, with or without N- terminal FLAG epitope tag.
• the PCR amplicons were cloned separately into pFN21A HaloTag CMV Flexi, pFC14K HaloTag CMV Flexi, pFN31K Niue CMV-neo Flexi and pFC32K Niue CMV-neo Flexi vectors (Promega).
• the mutant constructs with mutations at the FxxLF motif (F23,27A/L26A) or (G21E), at the D-box (A596T/S597T), or at the DNA binding domain (A574D) of AR were generated by site- directed mutagenesis.
• HEK293T cells were transiently transfected with 0.5 pg of pARE-Elb-luc (luciferase report vector with an insertion of an androgen responsive element (ARE) upstream of the luc2 gene), 0.5 pg of pRL-TK (Renilla Luciferae control) (Promega), and 0.5 pg AR FL and/or AR2 vector plasmids. Following 24 h of transfection, cells were washed and treated with DHT or equal volume ethanol as negative control.
• pARE-Elb-luc luciferase report vector with an insertion of an androgen responsive element (ARE) upstream of the luc2 gene
• pRL-TK Renilla Luciferae control
• AR FL and/or AR2 vector plasmids 0.5 pg AR FL and/or AR2 vector plasmids.
• NanoBRET assay was performed (Promega NanoBRETTM Protein: Protein Interaction System). Briefly, HEK293T cells were co-transfected with a Nanoluc luciferase (Niue) fusion plasmid and a HaloTag fusion plasmid with Lipofectamine 2000 reagent. Nluc-MDM2 and p53-HaloTag pair was included as the positive control, and Nluc-MDM2 and HaloTag-SMAD4 pair as negative control. At 24 h after transfection, cells were treated with or without 10 nM DHT. HaloTag NanoBRET 618 ligand or DMSO (no-ligand control) was added.
• NanoBRET Nano-Glo substrate was added and NanoBRET readings at 460 nm and 618 nm were obtained.
• Chromatin immunoprecipitation (ChIP)
• AR2 ChIP was conducted on MCF7 cells transiently transfected with FLAG-AR2 plasmids. Untransfected MCF7 cells were included as the negative controls. Cells were treated with 10 nM DHT 24 h post transfection. At 48 h, cells were crosslinked with 1% formaldehyde and harvested and lysed. The experiments were conducted as described (28) using 300 pg of chromatin and 14 pg of anti-FLAG antibody (Sigma Aldrich FI 804) or anti rabbit IgG antibody (Cell Signaling Technology, 2729). RNA Pol II ChIP was performed as described (29) on DHT-treated human myoblasts cells using Pol II antibody (Santa Cruz Biotechnology, sc-9001). Purified DNA samples were used for semi-quantitative real-time PCR.
• RNA and cDNA preparation and real time-quantitative PCR (RT-qPCR)
• RNA was isolated. 1 pg of RNA was used for cDNA synthesis with the high-capacity cDNA reverse transcription kit (Applied Biosystems). RT-qPCR reactions were set up with fast SYBR green master mix or TaqMan gene expression master mix (Applied Biosystems) using 20 - 50 ng of DNA templates.
• human myoblasts were transiently transfected with 1 pg of FLAG-AR2 or empty vector and treated with or without DHT 24 h post transfection.
• siRNAs were synthesised using modified (T- F, 2’-OMe) phosphoramidite with standard protecting group and cholesterol conjugates as described in reference 30.
• RNA-seq libraries were prepared from 500 ng of total RNA using the Illumina TruSeq Stranded Total RNA kit. Sequencing was paired-end (2xl50bp) for target depth of 40M read pairs per sample, using the Illumina HiSeq 4000 platform. For the iPSC-derived motor neurons, RNA-seq libraries were prepared from 500 ng of total RNA using the RNA-Seq Stranded RiboZero Gold. Sequencing was paired-end (2x75bp) for target depth of 100M read pairs per sample, using the Illumina HiSeq 4000 platform. For the human myoblasts where AR2 was overexpressed or knocked-down, mRNA libraries were generated using 1.5 pg of total RNA and the NEBNext® UltraTM II Directional RNA Library Prep Kit for Illumina.
• LOWESS fits were then over-plotted and inspected to identify the common low-end expression value where the relationship between mean expression (i.e. “signal”) and Coefficient of Variation (i.e. “noise”) grossly deviated from linearity. Expression values were then floored to equal this value if less, while expression for genes not observed greater than this value for at least one sample were discarded as noise-biased. For genes not discarded, expression differences across sample classes were tested for using the one- factor Analysis of Variance (ANOVA) test under Benjamini-Hochberg (BH) False Discovery Rate (FDR) Multiple Comparison Correction (MCC) condition using sample class as the factor.
• ANOVA Analysis of Variance
• BH Benjamini-Hochberg
• FDR False Discovery Rate
• MCC Multiple Comparison Correction
• proteins were separated on NuPAGE 10% Bis-Tris gel (Invitrogen) and transferred onto PVDF membranes using Invitrogen Novex XCell SureLock mini-cell and XCell II blot module.
• Membranes were incubated overnight with primary antibody in 1 : 1000 dilution, anti-AR antibody (Santa Cruz, H-280 or Abeam, ab52615), anti- tubulin (Abeam, ab6160) or anti-vinculin (Sigma-Aldrich, hVIN-1) and for 1 h with secondary antibody in 1:10000 dilution, anti-mouse-HRP conjugated antibody (Invitrogen, 62-6520) or anti-rabbit-HRP conjugated antibody (Invitrogen, 31460).
• images from at least four contiguous sections were taken using the CaseViewer software and analysed by a blinded investigator to the treatment, using Fiji software40.
• siRNAs targeting all possible regions specific for AR2 transcript and one non-targeting control siRNA (NTT) were designed and synthesised as described (35). These siRNAs are provided in Table 1. The sense and antisense strands of each of these siRNAs correspond to the sequences in SEQ ID NOs: 9-30, respectively. 1 mM of siRNA- AR2 or siRNA-NTT was added to MCF7 cells. Total RNA was extracted from cells. cDNA was prepared and RT-qPCR was performed as described in the previous section using FAM-labelled TaqMan array Hs04272731_sl specific for AR1, Hs04275959_ml specific for AR2 and Hs99999905_ml for GAPDH for normalisation.
• AR splice variant 2 was the most highly expressed AR variant, also compared to the canonical splice variant 1 (ENST00000374690; AR1) (Fig. la). No difference was observed in motor neurons from SBMA patients compared to controls. Interestingly, AR2 was found to be particularly abundant in androgen responsive tissues, such as prostate and muscle, suggesting a role in AR regulation (Fig. lb).
• AR2 is a naturally occurring variant, originally identified via rapid amplification of cDNA ends (RACE) from human placenta tissue (17).
• RACE rapid amplification of cDNA ends
• AR2 mRNA was found to arise from inclusion of an alternative exon 1 (exon lb) situated 22.1kb downstream of exon 1 (Fig. Id).
• This chromatin locus is functionally accessible and actively transcribed, as indicated by the DNase I hypersensitivity and ChIP-seq tracks and the quantification of Pol II occupancy on exon lb by chromatin immunoprecipitation assay (Fig. le).
• AR2 led to a dose-dependent suppression of full length AR transcriptional activity in response to DHT and this effect was abolished by introducing in the transgene the DBD inactivating substitution A574D (Fig. 2a; Fig. 2b).
• AR2 alone was not able to activate transcription (Fig. 2a).
• Activation of transcription requires AR dimerization, which is mediated mainly through N/C-terminal interactions via the FxxLF motif, and DBD/DBD interactions via the dimerization box (D-box) (19).
• AR can also form heterodimers with AR2.
• BRET bioluminescence resonance energy transfer
• All combinations of N- and C-terminal fusion constructs were transfected into the AR-null cells and one of the combination exhibiting the highest BRET signal was chosen for further analysis.
• BRET saturation curve indicated specific protein-protein interaction. Mutation in the FxxLF motif (F23, 27A/L26A; F-mut) or N-terminal of this motif (G21E) and not the D-box motif (A596T/S597T; D-mut) inhibited the AR/AR2 dimerization (Fig. 2c). Interestingly, the inventors also found that AR2 forms homodimers. The AR/AR2 interaction was further demonstrated by co- immunoprecipitation assay.
• AR protein levels were not affected by the presence of AR2 in a cycloheximide chase experiment, suggesting that AR2 does not alter AR protein steady state.
• the inventors next profiled gene expression in human myoblasts where AR2 was either overexpressed (OE) or knocked-down (KD).
• OE overexpressed
• KD knocked-down
• siRNA small interfering RNAs
• Fig. 2d AR2 overexpression and knock-down using the best performing siRNA were confirmed by qRT-PCR.
• Principal component analysis (PCA) on the expression data showed clustering of samples according to treatment.
• PCA Principal component analysis
• AR2 overexpression ameliorates the disease phenotype in SBMA mice
• mice Male transgenic mice were peripherally injected with AAV9 encoding AR2 cDNA, green fluorescent protein (GFP), or saline at 5 weeks of age (Fig. 3a). This model expresses a polyQ AR transgene (AR100Q) and exhibits a disease-relevant phenotype (26). Beginning at approximately 7 weeks of age, these mice demonstrate rapid androgen- dependent declines in survival, body weight, and rotarod activity compared with non- transgenic littermates (26). The treatment resulted in widespread transduction, particularly in muscle, a primary site of pathology in this disease (27, 28), as indicated by high AR2 expression 6 weeks after injection.
• the inventors treated a cohort of male transgenic mice harbouring the entire AR gene (27) and therefore endogenously expressing this splice variant, with lipid-conjugated siRNA targeting AR2.
• Table 2 shows the sense and antisense AR2-tageting and mock sequences for this study.
• the sequence of the sense strand (S) of the siRNA targeting AR2 is also provided in SEQ ID NO: 31.
• the sequence of the antisense strand (AS) of the siRNA targeting AR2 is also provided in SEQ ID NO: 32.
• the sequence of the sense strand (S) of the mock siRNA is also provided in SEQ ID NO: 32.
• the sequence of the antisense strand (AS) of the mock siRNA is also provided in SEQ ID NO: 34.
• the phosphocholine docosanoic acid (PC-DCA) conjugate was covalently attached to the 3 ’-end of the siRNA sense strand.
• the inventors demonstrate that AR splice variant 2, by heterodimerizing with full length AR and binding to its specific genomic targets, acts as a transcription factor decoy, regulating AR activity. Furthermore, the inventors establish therapeutic modulation of this variant as a new paradigm for treatment of SBMA and other AR-related disorders with high translational potential.
• AR2 also known as AR45
• the SBMA mice were injected with AAV9 encoding AR2 cDNA or green fluorescent protein (GFP), or saline, as described in Example 1.
• the survival, body weight, grip strength and rotarod activity of these mice were observed, as described in Example 1.
• AAV9-AR2 (referred to as AAV9-AR45 in the figures) treatment of SBMA mice significantly prolonged fife span (Fig. 5a), delayed disease onset (Fig. 5b), improved weight loss (Fig. 5c), grip strength (Fig. 5d) and rotarod activity (Fig. 5e).
• SEQ ID NO: 6 the polypeptide sequence of human AR (ENSP00000363822)
• SEQ ID NO: 7 the polypeptide sequence of an AR variant MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPREASG APTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAP LLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGC SGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPH ARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTL FTAEEGQLY GPCGGGGGGGGGGGGGGGGGE AGA VAP Y GYTRPPQGLA GQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETAR DHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKV
• SEQ ID NOs: 9-34 - see Examples for the siRNA sequences (sense and antisense) SEQ ID NO: 35 - polypeptide sequence at the N-terminus of AR2 resulting from the alternative exon lb

Landscapes

• Health & Medical Sciences (AREA)
• Life Sciences & Earth Sciences (AREA)
• Engineering & Computer Science (AREA)
• Chemical & Material Sciences (AREA)
• Organic Chemistry (AREA)
• Genetics & Genomics (AREA)
• Biomedical Technology (AREA)
• Bioinformatics & Cheminformatics (AREA)
• Zoology (AREA)
• General Health & Medical Sciences (AREA)
• Biotechnology (AREA)
• Wood Science & Technology (AREA)
• Biochemistry (AREA)
• General Engineering & Computer Science (AREA)
• Molecular Biology (AREA)
• Medicinal Chemistry (AREA)
• Biophysics (AREA)
• Microbiology (AREA)
• Cell Biology (AREA)
• Veterinary Medicine (AREA)
• Pharmacology & Pharmacy (AREA)
• Public Health (AREA)
• Animal Behavior & Ethology (AREA)
• Endocrinology (AREA)
• Chemical Kinetics & Catalysis (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• General Chemical & Material Sciences (AREA)
• Virology (AREA)
• Proteomics, Peptides & Aminoacids (AREA)
• Gastroenterology & Hepatology (AREA)
• Plant Pathology (AREA)
• Physics & Mathematics (AREA)
• Neurology (AREA)
• Physical Education & Sports Medicine (AREA)
• Orthopedic Medicine & Surgery (AREA)
• Immunology (AREA)
• Toxicology (AREA)
• Rheumatology (AREA)
• Urology & Nephrology (AREA)
• Diabetes (AREA)

Priority Applications (6)

Applications Claiming Priority (2)

Publications (1)

Family

ID=68541342

Family Applications (1)

Country Status (8)

Cited By (1)

Families Citing this family (1)

Citations (4)

Family Cites Families (10)

• 2019
  • 2019-10-03 GB GB201914296A patent/GB201914296D0/en not_active Ceased
• 2020
  • 2020-10-02 CA CA3156469A patent/CA3156469A1/en active Pending
  • 2020-10-02 CN CN202080069587.5A patent/CN114585742B/zh active Active
  • 2020-10-02 JP JP2022520403A patent/JP7664233B2/ja active Active
  • 2020-10-02 US US17/765,116 patent/US12331101B2/en active Active
  • 2020-10-02 EP EP20788863.7A patent/EP4038098A1/en active Pending
  • 2020-10-02 WO PCT/GB2020/052435 patent/WO2021064421A1/en not_active Ceased
  • 2020-10-02 AU AU2020361079A patent/AU2020361079A1/en active Pending

Patent Citations (4)

Non-Patent Citations (36)

Also Published As

Similar Documents

Legal Events