WO2021046243A2 - Methods and compositions for genomic integration - Google Patents
Methods and compositions for genomic integration Download PDFInfo
- Publication number
- WO2021046243A2 WO2021046243A2 PCT/US2020/049240 US2020049240W WO2021046243A2 WO 2021046243 A2 WO2021046243 A2 WO 2021046243A2 US 2020049240 W US2020049240 W US 2020049240W WO 2021046243 A2 WO2021046243 A2 WO 2021046243A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sequence
- mrna
- cell
- encoding
- utr
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 282
- 239000000203 mixture Substances 0.000 title claims abstract description 97
- 230000010354 integration Effects 0.000 title claims abstract description 68
- 108700019146 Transgenes Proteins 0.000 claims abstract description 98
- 102100031780 Endonuclease Human genes 0.000 claims description 374
- 108090000623 proteins and genes Proteins 0.000 claims description 369
- 210000004027 cell Anatomy 0.000 claims description 367
- 108020004999 messenger RNA Proteins 0.000 claims description 355
- 150000007523 nucleic acids Chemical group 0.000 claims description 297
- 102000039446 nucleic acids Human genes 0.000 claims description 232
- 108020004707 nucleic acids Proteins 0.000 claims description 232
- 102000004169 proteins and genes Human genes 0.000 claims description 220
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 claims description 170
- 108010042407 Endonucleases Proteins 0.000 claims description 147
- 102000053602 DNA Human genes 0.000 claims description 110
- 108020004414 DNA Proteins 0.000 claims description 110
- 230000027455 binding Effects 0.000 claims description 93
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 90
- 239000013598 vector Substances 0.000 claims description 85
- 230000014509 gene expression Effects 0.000 claims description 84
- 108020005345 3' Untranslated Regions Proteins 0.000 claims description 82
- 108020003589 5' Untranslated Regions Proteins 0.000 claims description 77
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 70
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 70
- 229920001184 polypeptide Polymers 0.000 claims description 64
- 125000003729 nucleotide group Chemical group 0.000 claims description 63
- 230000035772 mutation Effects 0.000 claims description 60
- 239000002773 nucleotide Substances 0.000 claims description 56
- 230000001105 regulatory effect Effects 0.000 claims description 56
- 101710158030 Endonuclease Proteins 0.000 claims description 55
- 210000000066 myeloid cell Anatomy 0.000 claims description 53
- 230000000295 complement effect Effects 0.000 claims description 49
- 230000002441 reversible effect Effects 0.000 claims description 46
- 102000005962 receptors Human genes 0.000 claims description 41
- 108020003175 receptors Proteins 0.000 claims description 41
- 230000000694 effects Effects 0.000 claims description 37
- 210000002865 immune cell Anatomy 0.000 claims description 36
- 230000015556 catabolic process Effects 0.000 claims description 35
- 238000006731 degradation reaction Methods 0.000 claims description 35
- 101710163270 Nuclease Proteins 0.000 claims description 34
- 239000013612 plasmid Substances 0.000 claims description 32
- 239000003795 chemical substances by application Substances 0.000 claims description 30
- 108091023043 Alu Element Proteins 0.000 claims description 25
- 108091036066 Three prime untranslated region Proteins 0.000 claims description 24
- 108700009124 Transcription Initiation Site Proteins 0.000 claims description 24
- 210000002540 macrophage Anatomy 0.000 claims description 24
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims description 23
- 108020004705 Codon Proteins 0.000 claims description 23
- 201000010099 disease Diseases 0.000 claims description 23
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 23
- 102000004190 Enzymes Human genes 0.000 claims description 22
- 108090000790 Enzymes Proteins 0.000 claims description 22
- 230000003993 interaction Effects 0.000 claims description 22
- 239000002243 precursor Substances 0.000 claims description 22
- 210000005260 human cell Anatomy 0.000 claims description 21
- 230000008488 polyadenylation Effects 0.000 claims description 19
- 230000003612 virological effect Effects 0.000 claims description 19
- 238000001415 gene therapy Methods 0.000 claims description 17
- 108091029499 Group II intron Proteins 0.000 claims description 16
- 108091092195 Intron Proteins 0.000 claims description 16
- 230000030279 gene silencing Effects 0.000 claims description 16
- 238000010839 reverse transcription Methods 0.000 claims description 16
- 238000011144 upstream manufacturing Methods 0.000 claims description 16
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 15
- 239000008194 pharmaceutical composition Substances 0.000 claims description 15
- 238000003776 cleavage reaction Methods 0.000 claims description 14
- 238000000338 in vitro Methods 0.000 claims description 14
- 238000010459 TALEN Methods 0.000 claims description 13
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 claims description 13
- 210000001616 monocyte Anatomy 0.000 claims description 13
- 101000940871 Homo sapiens Endonuclease Proteins 0.000 claims description 12
- 230000001939 inductive effect Effects 0.000 claims description 12
- 239000013603 viral vector Substances 0.000 claims description 12
- 108060002716 Exonuclease Proteins 0.000 claims description 11
- 102000013165 exonuclease Human genes 0.000 claims description 11
- 102000028499 poly(A) binding Human genes 0.000 claims description 11
- 108091023021 poly(A) binding Proteins 0.000 claims description 11
- 230000007017 scission Effects 0.000 claims description 11
- 108091033409 CRISPR Proteins 0.000 claims description 10
- 101710125418 Major capsid protein Proteins 0.000 claims description 10
- 102000004389 Ribonucleoproteins Human genes 0.000 claims description 10
- 108010081734 Ribonucleoproteins Proteins 0.000 claims description 10
- 210000004443 dendritic cell Anatomy 0.000 claims description 10
- 238000004519 manufacturing process Methods 0.000 claims description 10
- 101710132601 Capsid protein Proteins 0.000 claims description 9
- 101710094648 Coat protein Proteins 0.000 claims description 9
- 230000004568 DNA-binding Effects 0.000 claims description 9
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 claims description 9
- 101710141454 Nucleoprotein Proteins 0.000 claims description 9
- 101710083689 Probable capsid protein Proteins 0.000 claims description 9
- 101710172711 Structural protein Proteins 0.000 claims description 9
- 210000003705 ribosome Anatomy 0.000 claims description 9
- 108020003564 Retroelements Proteins 0.000 claims description 8
- 239000003623 enhancer Substances 0.000 claims description 8
- 230000028993 immune response Effects 0.000 claims description 8
- 230000014759 maintenance of location Effects 0.000 claims description 8
- 101000595876 Homo sapiens Protein TASOR Proteins 0.000 claims description 7
- 102100035191 Protein TASOR Human genes 0.000 claims description 7
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 7
- 230000002950 deficient Effects 0.000 claims description 7
- 230000002163 immunogen Effects 0.000 claims description 7
- 230000002222 downregulating effect Effects 0.000 claims description 6
- 239000003814 drug Substances 0.000 claims description 6
- 102000014914 Carrier Proteins Human genes 0.000 claims description 5
- 108091081406 G-quadruplex Proteins 0.000 claims description 5
- 108091023040 Transcription factor Proteins 0.000 claims description 5
- 102000040945 Transcription factor Human genes 0.000 claims description 5
- 230000002411 adverse Effects 0.000 claims description 5
- 230000036541 health Effects 0.000 claims description 5
- 239000003550 marker Substances 0.000 claims description 5
- 241000283254 Balaenoptera acutorostrata Species 0.000 claims description 4
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 claims description 4
- 150000003838 adenosines Chemical class 0.000 claims description 4
- 239000003446 ligand Substances 0.000 claims description 4
- 239000011701 zinc Substances 0.000 claims description 4
- 229910052725 zinc Inorganic materials 0.000 claims description 4
- 101100524324 Adeno-associated virus 2 (isolate Srivastava/1982) Rep78 gene Proteins 0.000 claims description 3
- 108091023037 Aptamer Proteins 0.000 claims description 3
- 108010078791 Carrier Proteins Proteins 0.000 claims description 3
- 108010068426 Contractile Proteins Proteins 0.000 claims description 3
- 102000002585 Contractile Proteins Human genes 0.000 claims description 3
- 241000709675 Coxsackievirus B3 Species 0.000 claims description 3
- 108010002700 Exoribonucleases Proteins 0.000 claims description 3
- 102000004678 Exoribonucleases Human genes 0.000 claims description 3
- 102100021519 Hemoglobin subunit beta Human genes 0.000 claims description 3
- 108091005904 Hemoglobin subunit beta Proteins 0.000 claims description 3
- 101001115417 Homo sapiens M-phase phosphoprotein 8 Proteins 0.000 claims description 3
- 102100023268 M-phase phosphoprotein 8 Human genes 0.000 claims description 3
- 101150068419 ORF 1 gene Proteins 0.000 claims description 3
- 108091027981 Response element Proteins 0.000 claims description 3
- 102100022012 Transcription intermediary factor 1-beta Human genes 0.000 claims description 3
- 101710177718 Transcription intermediary factor 1-beta Proteins 0.000 claims description 3
- 108091093126 WHP Posttrascriptional Response Element Proteins 0.000 claims description 3
- 208000007502 anemia Diseases 0.000 claims description 3
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 3
- 239000005556 hormone Substances 0.000 claims description 3
- 229940088597 hormone Drugs 0.000 claims description 3
- 230000031787 nutrient reservoir activity Effects 0.000 claims description 3
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 3
- 230000003252 repetitive effect Effects 0.000 claims description 3
- 230000003584 silencer Effects 0.000 claims description 3
- 101710159752 Poly(3-hydroxyalkanoate) polymerase subunit PhaE Proteins 0.000 claims 4
- 101710130262 Probable Vpr-like protein Proteins 0.000 claims 4
- 101000833492 Homo sapiens Jouberin Proteins 0.000 claims 2
- 101000651236 Homo sapiens NCK-interacting protein with SH3 domain Proteins 0.000 claims 2
- 102100024407 Jouberin Human genes 0.000 claims 2
- 101150009852 ORF2 gene Proteins 0.000 claims 1
- 235000018102 proteins Nutrition 0.000 description 186
- 101710167800 Capsid assembly scaffolding protein Proteins 0.000 description 134
- 101710113540 ORF2 protein Proteins 0.000 description 134
- 101710090523 Putative movement protein Proteins 0.000 description 134
- 229920002477 rna polymer Polymers 0.000 description 95
- 230000018412 transposition, RNA-mediated Effects 0.000 description 69
- 101000940870 Mus musculus Endonuclease Proteins 0.000 description 58
- 102000040430 polynucleotide Human genes 0.000 description 48
- 108091033319 polynucleotide Proteins 0.000 description 48
- 239000002157 polynucleotide Substances 0.000 description 47
- 108091026890 Coding region Proteins 0.000 description 39
- 230000004048 modification Effects 0.000 description 39
- 238000012986 modification Methods 0.000 description 39
- 150000001413 amino acids Chemical group 0.000 description 34
- 239000012634 fragment Substances 0.000 description 33
- 102000037865 fusion proteins Human genes 0.000 description 31
- 108020001507 fusion proteins Proteins 0.000 description 31
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 30
- 108700026244 Open Reading Frames Proteins 0.000 description 28
- 230000003834 intracellular effect Effects 0.000 description 26
- 235000001014 amino acid Nutrition 0.000 description 25
- 229940024606 amino acid Drugs 0.000 description 25
- 238000010348 incorporation Methods 0.000 description 25
- 241001465754 Metazoa Species 0.000 description 23
- 238000001727 in vivo Methods 0.000 description 22
- 230000001965 increasing effect Effects 0.000 description 21
- 238000012546 transfer Methods 0.000 description 21
- -1 Cascade Blue Chemical compound 0.000 description 20
- 238000013461 design Methods 0.000 description 20
- 238000013518 transcription Methods 0.000 description 19
- 230000014616 translation Effects 0.000 description 19
- 230000035897 transcription Effects 0.000 description 18
- 230000002068 genetic effect Effects 0.000 description 17
- 230000008569 process Effects 0.000 description 17
- 206010053138 Congenital aplastic anaemia Diseases 0.000 description 16
- 201000004939 Fanconi anemia Diseases 0.000 description 16
- 238000013519 translation Methods 0.000 description 16
- 230000017105 transposition Effects 0.000 description 16
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 15
- 229960005305 adenosine Drugs 0.000 description 15
- 230000002708 enhancing effect Effects 0.000 description 15
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 14
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 14
- 239000000427 antigen Substances 0.000 description 14
- 108091007433 antigens Proteins 0.000 description 14
- 102000036639 antigens Human genes 0.000 description 14
- 238000006243 chemical reaction Methods 0.000 description 14
- 230000006870 function Effects 0.000 description 14
- 238000003780 insertion Methods 0.000 description 14
- 230000037431 insertion Effects 0.000 description 14
- 230000004068 intracellular signaling Effects 0.000 description 14
- 230000007246 mechanism Effects 0.000 description 14
- 230000000242 pagocytic effect Effects 0.000 description 14
- 230000004927 fusion Effects 0.000 description 12
- 238000012239 gene modification Methods 0.000 description 12
- 102100024364 Disintegrin and metalloproteinase domain-containing protein 8 Human genes 0.000 description 11
- 206010057249 Phagocytosis Diseases 0.000 description 11
- 230000015572 biosynthetic process Effects 0.000 description 11
- 230000022131 cell cycle Effects 0.000 description 11
- 230000008782 phagocytosis Effects 0.000 description 11
- 102000008579 Transposases Human genes 0.000 description 10
- 108010020764 Transposases Proteins 0.000 description 10
- 210000001539 phagocyte Anatomy 0.000 description 10
- 230000006916 protein interaction Effects 0.000 description 10
- 238000001890 transfection Methods 0.000 description 10
- 229950010342 uridine triphosphate Drugs 0.000 description 10
- 108091028075 Circular RNA Proteins 0.000 description 9
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 9
- 108020004566 Transfer RNA Proteins 0.000 description 9
- 238000012217 deletion Methods 0.000 description 9
- 230000037430 deletion Effects 0.000 description 9
- 238000004520 electroporation Methods 0.000 description 9
- 230000001404 mediated effect Effects 0.000 description 9
- 230000037361 pathway Effects 0.000 description 9
- 230000037452 priming Effects 0.000 description 9
- 230000011664 signaling Effects 0.000 description 9
- 230000010473 stable expression Effects 0.000 description 9
- 210000001519 tissue Anatomy 0.000 description 9
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 8
- 108010045374 CD36 Antigens Proteins 0.000 description 8
- 102000053028 CD36 Antigens Human genes 0.000 description 8
- 206010028980 Neoplasm Diseases 0.000 description 8
- 239000004098 Tetracycline Substances 0.000 description 8
- 230000001580 bacterial effect Effects 0.000 description 8
- 201000011510 cancer Diseases 0.000 description 8
- 210000003527 eukaryotic cell Anatomy 0.000 description 8
- 229960002180 tetracycline Drugs 0.000 description 8
- 229930101283 tetracycline Natural products 0.000 description 8
- 235000019364 tetracycline Nutrition 0.000 description 8
- 150000003522 tetracyclines Chemical class 0.000 description 8
- 230000001225 therapeutic effect Effects 0.000 description 8
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 7
- 101001018258 Homo sapiens Macrophage receptor MARCO Proteins 0.000 description 7
- 230000001419 dependent effect Effects 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 238000009396 hybridization Methods 0.000 description 7
- 239000001226 triphosphate Substances 0.000 description 7
- 235000011178 triphosphate Nutrition 0.000 description 7
- 230000033616 DNA repair Effects 0.000 description 6
- 241000710831 Flavivirus Species 0.000 description 6
- 241000282412 Homo Species 0.000 description 6
- 108091034117 Oligonucleotide Proteins 0.000 description 6
- 230000008901 benefit Effects 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 6
- 230000002401 inhibitory effect Effects 0.000 description 6
- 239000002679 microRNA Substances 0.000 description 6
- 238000005457 optimization Methods 0.000 description 6
- 241000894007 species Species 0.000 description 6
- SGKRLCUYIXIAHR-AKNGSSGZSA-N (4s,4ar,5s,5ar,6r,12ar)-4-(dimethylamino)-1,5,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1=CC=C2[C@H](C)[C@@H]([C@H](O)[C@@H]3[C@](C(O)=C(C(N)=O)C(=O)[C@H]3N(C)C)(O)C3=O)C3=C(O)C2=C1O SGKRLCUYIXIAHR-AKNGSSGZSA-N 0.000 description 5
- 102100024330 Collectin-12 Human genes 0.000 description 5
- 108020005004 Guide RNA Proteins 0.000 description 5
- 101710189078 Helicase Proteins 0.000 description 5
- 101000693970 Homo sapiens Scavenger receptor class A member 3 Proteins 0.000 description 5
- 102100033272 Macrophage receptor MARCO Human genes 0.000 description 5
- 241000124008 Mammalia Species 0.000 description 5
- 108700011259 MicroRNAs Proteins 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 102100025386 Oxidized low-density lipoprotein receptor 1 Human genes 0.000 description 5
- 101710118046 RNA-directed RNA polymerase Proteins 0.000 description 5
- 108020004511 Recombinant DNA Proteins 0.000 description 5
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 5
- 101710185494 Zinc finger protein Proteins 0.000 description 5
- 102100023597 Zinc finger protein 816 Human genes 0.000 description 5
- 239000003153 chemical reaction reagent Substances 0.000 description 5
- 108700010039 chimeric receptor Proteins 0.000 description 5
- 238000005520 cutting process Methods 0.000 description 5
- 229960003722 doxycycline Drugs 0.000 description 5
- VYXSBFYARXAAKO-UHFFFAOYSA-N ethyl 2-[3-(ethylamino)-6-ethylimino-2,7-dimethylxanthen-9-yl]benzoate;hydron;chloride Chemical compound [Cl-].C1=2C=C(C)C(NCC)=CC=2OC2=CC(=[NH+]CC)C(C)=CC2=C1C1=CC=CC=C1C(=O)OCC VYXSBFYARXAAKO-UHFFFAOYSA-N 0.000 description 5
- 239000000833 heterodimer Substances 0.000 description 5
- 238000009169 immunotherapy Methods 0.000 description 5
- 230000000670 limiting effect Effects 0.000 description 5
- 230000008741 proinflammatory signaling process Effects 0.000 description 5
- 108020001580 protein domains Proteins 0.000 description 5
- 108020004418 ribosomal RNA Proteins 0.000 description 5
- 102000014452 scavenger receptors Human genes 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- OAKPWEUQDVLTCN-NKWVEPMBSA-N 2',3'-Dideoxyadenosine-5-triphosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1CC[C@@H](CO[P@@](O)(=O)O[P@](O)(=O)OP(O)(O)=O)O1 OAKPWEUQDVLTCN-NKWVEPMBSA-N 0.000 description 4
- 108090000994 Catalytic RNA Proteins 0.000 description 4
- 102000053642 Catalytic RNA Human genes 0.000 description 4
- 108700010070 Codon Usage Proteins 0.000 description 4
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 4
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 4
- 241000214054 Equine rhinitis A virus Species 0.000 description 4
- 108700024394 Exon Proteins 0.000 description 4
- XKMLYUALXHKNFT-UUOKFMHZSA-N Guanosine-5'-triphosphate Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O XKMLYUALXHKNFT-UUOKFMHZSA-N 0.000 description 4
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 4
- 102100034343 Integrase Human genes 0.000 description 4
- 102100025136 Macrosialin Human genes 0.000 description 4
- 108090000430 Phosphatidylinositol 3-kinases Proteins 0.000 description 4
- 102000003993 Phosphatidylinositol 3-kinases Human genes 0.000 description 4
- 108020005067 RNA Splice Sites Proteins 0.000 description 4
- 102100032855 Sialoadhesin Human genes 0.000 description 4
- 108091027967 Small hairpin RNA Proteins 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 4
- ARLKCWCREKRROD-POYBYMJQSA-N [[(2s,5r)-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)CC1 ARLKCWCREKRROD-POYBYMJQSA-N 0.000 description 4
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 4
- RGWHQCVHVJXOKC-SHYZEUOFSA-J dCTP(4-) Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)C1 RGWHQCVHVJXOKC-SHYZEUOFSA-J 0.000 description 4
- 239000000539 dimer Substances 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 229940029575 guanosine Drugs 0.000 description 4
- 102000005218 human steroid receptor RNA activator Human genes 0.000 description 4
- 108010081130 human steroid receptor RNA activator Proteins 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 230000007115 recruitment Effects 0.000 description 4
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 4
- 230000001177 retroviral effect Effects 0.000 description 4
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 4
- 108091092562 ribozyme Proteins 0.000 description 4
- 108010078070 scavenger receptors Proteins 0.000 description 4
- 239000004055 small Interfering RNA Substances 0.000 description 4
- 150000003384 small molecules Chemical class 0.000 description 4
- 125000006850 spacer group Chemical group 0.000 description 4
- 210000000130 stem cell Anatomy 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- 238000010361 transduction Methods 0.000 description 4
- 238000011282 treatment Methods 0.000 description 4
- 125000002264 triphosphate group Chemical class [H]OP(=O)(O[H])OP(=O)(O[H])OP(=O)(O[H])O* 0.000 description 4
- KXDAEFPNCMNJSK-UHFFFAOYSA-N Benzamide Chemical compound NC(=O)C1=CC=CC=C1 KXDAEFPNCMNJSK-UHFFFAOYSA-N 0.000 description 3
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 3
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 3
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 3
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 3
- AHCYMLUZIRLXAA-SHYZEUOFSA-N Deoxyuridine 5'-triphosphate Chemical compound O1[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)C[C@@H]1N1C(=O)NC(=O)C=C1 AHCYMLUZIRLXAA-SHYZEUOFSA-N 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 102000004533 Endonucleases Human genes 0.000 description 3
- 230000010190 G1 phase Effects 0.000 description 3
- 101000909528 Homo sapiens Collectin-12 Proteins 0.000 description 3
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 3
- 101000868472 Homo sapiens Sialoadhesin Proteins 0.000 description 3
- 108010061833 Integrases Proteins 0.000 description 3
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 3
- 240000007019 Oxalis corniculata Species 0.000 description 3
- 102000009572 RNA Polymerase II Human genes 0.000 description 3
- 108010009460 RNA Polymerase II Proteins 0.000 description 3
- 230000004570 RNA-binding Effects 0.000 description 3
- 102100027192 Scavenger receptor class A member 3 Human genes 0.000 description 3
- 108091081024 Start codon Proteins 0.000 description 3
- 101710188297 Trehalose synthase/amylase TreS Proteins 0.000 description 3
- 108020000999 Viral RNA Proteins 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- HDRRAMINWIWTNU-NTSWFWBYSA-N [[(2s,5r)-5-(2-amino-6-oxo-3h-purin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@H]1CC[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 HDRRAMINWIWTNU-NTSWFWBYSA-N 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 108010006025 bovine growth hormone Proteins 0.000 description 3
- 230000003197 catalytic effect Effects 0.000 description 3
- 238000002659 cell therapy Methods 0.000 description 3
- 210000000349 chromosome Anatomy 0.000 description 3
- URGJWIFLBWJRMF-JGVFFNPUSA-N ddTTP Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)CC1 URGJWIFLBWJRMF-JGVFFNPUSA-N 0.000 description 3
- 230000034431 double-strand break repair via homologous recombination Effects 0.000 description 3
- 241001493065 dsRNA viruses Species 0.000 description 3
- 238000001476 gene delivery Methods 0.000 description 3
- 238000010362 genome editing Methods 0.000 description 3
- 210000004602 germ cell Anatomy 0.000 description 3
- 230000003394 haemopoietic effect Effects 0.000 description 3
- 102000046836 human MARCO Human genes 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 239000000543 intermediate Substances 0.000 description 3
- 239000000178 monomer Substances 0.000 description 3
- 230000030648 nucleus localization Effects 0.000 description 3
- FDLYAMZZIXQODN-UHFFFAOYSA-N olaparib Chemical compound FC1=CC=C(CC=2C3=CC=CC=C3C(=O)NN=2)C=C1C(=O)N(CC1)CCN1C(=O)C1CC1 FDLYAMZZIXQODN-UHFFFAOYSA-N 0.000 description 3
- 239000013600 plasmid vector Substances 0.000 description 3
- 230000002035 prolonged effect Effects 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 108091005418 scavenger receptor class E Proteins 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- ABZLKHKQJHEPAX-UHFFFAOYSA-N tetramethylrhodamine Chemical compound C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=CC=C1C([O-])=O ABZLKHKQJHEPAX-UHFFFAOYSA-N 0.000 description 3
- 230000026683 transduction Effects 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 102000027257 transmembrane receptors Human genes 0.000 description 3
- 108091008578 transmembrane receptors Proteins 0.000 description 3
- UNXRWKVEANCORM-UHFFFAOYSA-N triphosphoric acid Chemical compound OP(O)(=O)OP(O)(=O)OP(O)(O)=O UNXRWKVEANCORM-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- SVXDHPADAXBMFB-JXMROGBWSA-N (5e)-5-[(4-ethylphenyl)methylidene]-2-sulfanylidene-1,3-thiazolidin-4-one Chemical compound C1=CC(CC)=CC=C1\C=C\1C(=O)NC(=S)S/1 SVXDHPADAXBMFB-JXMROGBWSA-N 0.000 description 2
- JMPJNNOSVCHYOU-UHFFFAOYSA-N 1-(3,4-dichlorophenyl)-3-(4-methoxyphenyl)-4-morpholin-4-ylpyrrole-2,5-dione Chemical compound C1=CC(OC)=CC=C1C(C(N(C1=O)C=2C=C(Cl)C(Cl)=CC=2)=O)=C1N1CCOCC1 JMPJNNOSVCHYOU-UHFFFAOYSA-N 0.000 description 2
- VGIRNWJSIRVFRT-UHFFFAOYSA-N 2',7'-difluorofluorescein Chemical compound OC(=O)C1=CC=CC=C1C1=C2C=C(F)C(=O)C=C2OC2=CC(O)=C(F)C=C21 VGIRNWJSIRVFRT-UHFFFAOYSA-N 0.000 description 2
- PCOXPBOKDABARQ-UHFFFAOYSA-N 3,4-dichloro-1-[3-(3,4-dichloro-2,5-dioxopyrrol-1-yl)-2,2-dimethylpropyl]pyrrole-2,5-dione Chemical compound O=C1C(Cl)=C(Cl)C(=O)N1CC(C)(C)CN1C(=O)C(Cl)=C(Cl)C1=O PCOXPBOKDABARQ-UHFFFAOYSA-N 0.000 description 2
- GEKDQXSPTHHANP-OUKQBFOZSA-N 3-benzyl-2-[(e)-2-pyridin-3-ylethenyl]quinazolin-4-one Chemical compound C=1C=CN=CC=1/C=C/C1=NC2=CC=CC=C2C(=O)N1CC1=CC=CC=C1 GEKDQXSPTHHANP-OUKQBFOZSA-N 0.000 description 2
- MWSUIZKGNWELRF-UHFFFAOYSA-N 3-chloro-1-(3,4-dichlorophenyl)-4-morpholin-4-ylpyrrole-2,5-dione Chemical compound O=C1N(C=2C=C(Cl)C(Cl)=CC=2)C(=O)C(Cl)=C1N1CCOCC1 MWSUIZKGNWELRF-UHFFFAOYSA-N 0.000 description 2
- WCKQPPQRFNHPRJ-UHFFFAOYSA-N 4-[[4-(dimethylamino)phenyl]diazenyl]benzoic acid Chemical compound C1=CC(N(C)C)=CC=C1N=NC1=CC=C(C(O)=O)C=C1 WCKQPPQRFNHPRJ-UHFFFAOYSA-N 0.000 description 2
- SJQRQOKXQKVJGJ-UHFFFAOYSA-N 5-(2-aminoethylamino)naphthalene-1-sulfonic acid Chemical compound C1=CC=C2C(NCCN)=CC=CC2=C1S(O)(=O)=O SJQRQOKXQKVJGJ-UHFFFAOYSA-N 0.000 description 2
- OGHAROSJZRTIOK-KQYNXXCUSA-O 7-methylguanosine Chemical compound C1=2N=C(N)NC(=O)C=2[N+](C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OGHAROSJZRTIOK-KQYNXXCUSA-O 0.000 description 2
- ZKHQWZAMYRWXGA-KQYNXXCUSA-J ATP(4-) Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)[C@H]1O ZKHQWZAMYRWXGA-KQYNXXCUSA-J 0.000 description 2
- 241000251468 Actinopterygii Species 0.000 description 2
- ZKHQWZAMYRWXGA-UHFFFAOYSA-N Adenosine triphosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)C(O)C1O ZKHQWZAMYRWXGA-UHFFFAOYSA-N 0.000 description 2
- 241000180579 Arca Species 0.000 description 2
- 102100031504 Beta-1,4 N-acetylgalactosaminyltransferase 2 Human genes 0.000 description 2
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 2
- 102100040840 C-type lectin domain family 7 member A Human genes 0.000 description 2
- 108010009992 CD163 antigen Proteins 0.000 description 2
- 101150013553 CD40 gene Proteins 0.000 description 2
- 241000520666 Carmotetraviridae Species 0.000 description 2
- 108010077544 Chromatin Proteins 0.000 description 2
- 101710194650 Collectin-12 Proteins 0.000 description 2
- 241000218631 Coniferophyta Species 0.000 description 2
- 108050006400 Cyclin Proteins 0.000 description 2
- 102000012410 DNA Ligases Human genes 0.000 description 2
- 108010061982 DNA Ligases Proteins 0.000 description 2
- 230000005971 DNA damage repair Effects 0.000 description 2
- 241000283715 Damaliscus lunatus Species 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 241000615461 Dicistroviridae Species 0.000 description 2
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 2
- 101100481875 Drosophila melanogaster topi gene Proteins 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- 241000710781 Flaviviridae Species 0.000 description 2
- 102000016621 Focal Adhesion Protein-Tyrosine Kinases Human genes 0.000 description 2
- 108010067715 Focal Adhesion Protein-Tyrosine Kinases Proteins 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000016285 Guanine Nucleotide Exchange Factors Human genes 0.000 description 2
- 108010067218 Guanine Nucleotide Exchange Factors Proteins 0.000 description 2
- 101800001704 Guanine-N7 methyltransferase Proteins 0.000 description 2
- 101100111156 Homo sapiens B4GALNT2 gene Proteins 0.000 description 2
- 101000856513 Homo sapiens Inactive N-acetyllactosaminide alpha-1,3-galactosyltransferase Proteins 0.000 description 2
- 101000902205 Homo sapiens Inactive cytidine monophosphate-N-acetylneuraminic acid hydroxylase Proteins 0.000 description 2
- 101001134216 Homo sapiens Macrophage scavenger receptor types I and II Proteins 0.000 description 2
- 101001000998 Homo sapiens Protein phosphatase 1 regulatory subunit 12C Proteins 0.000 description 2
- 101000694338 Homo sapiens RuvB-like 2 Proteins 0.000 description 2
- 101000684887 Homo sapiens Scavenger receptor class A member 5 Proteins 0.000 description 2
- 101000663381 Homo sapiens Scavenger receptor cysteine-rich domain-containing group B protein Proteins 0.000 description 2
- 101000704168 Homo sapiens Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D Proteins 0.000 description 2
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 2
- 241000192019 Human endogenous retrovirus K Species 0.000 description 2
- 102100025509 Inactive N-acetyllactosaminide alpha-1,3-galactosyltransferase Human genes 0.000 description 2
- 102100022247 Inactive cytidine monophosphate-N-acetylneuraminic acid hydroxylase Human genes 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- 102000004856 Lectins Human genes 0.000 description 2
- 108090001090 Lectins Proteins 0.000 description 2
- 102100020983 Lysosome membrane protein 2 Human genes 0.000 description 2
- 102100034184 Macrophage scavenger receptor types I and II Human genes 0.000 description 2
- 108010031099 Mannose Receptor Proteins 0.000 description 2
- 101000669895 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) Replication factor A Proteins 0.000 description 2
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 2
- 101710143462 ORF2p protein Proteins 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 108010064218 Poly (ADP-Ribose) Polymerase-1 Proteins 0.000 description 2
- 102100023712 Poly [ADP-ribose] polymerase 1 Human genes 0.000 description 2
- 102100036691 Proliferating cell nuclear antigen Human genes 0.000 description 2
- 101800001862 Proofreading exoribonuclease Proteins 0.000 description 2
- 101800002929 Proofreading exoribonuclease nsp14 Proteins 0.000 description 2
- 102100035620 Protein phosphatase 1 regulatory subunit 12C Human genes 0.000 description 2
- 229930185560 Pseudouridine Natural products 0.000 description 2
- PTJWIQPHWPFNBW-UHFFFAOYSA-N Pseudouridine C Natural products OC1C(O)C(CO)OC1C1=CNC(=O)NC1=O PTJWIQPHWPFNBW-UHFFFAOYSA-N 0.000 description 2
- 102000014450 RNA Polymerase III Human genes 0.000 description 2
- 108010078067 RNA Polymerase III Proteins 0.000 description 2
- 101710086015 RNA ligase Proteins 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 241000702247 Reoviridae Species 0.000 description 2
- 108091028664 Ribonucleotide Proteins 0.000 description 2
- 102100027092 RuvB-like 2 Human genes 0.000 description 2
- 102000004940 SCARA5 Human genes 0.000 description 2
- 108091005488 SCARB2 Proteins 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 101000857460 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) RuvB-like protein 2 Proteins 0.000 description 2
- 102100038959 Scavenger receptor cysteine-rich domain-containing group B protein Human genes 0.000 description 2
- 102100025831 Scavenger receptor cysteine-rich type 1 protein M130 Human genes 0.000 description 2
- 108091061750 Signal recognition particle RNA Proteins 0.000 description 2
- 241000700584 Simplexvirus Species 0.000 description 2
- 102100031878 Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D Human genes 0.000 description 2
- 108091027544 Subgenomic mRNA Proteins 0.000 description 2
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 2
- 241000710915 Totiviridae Species 0.000 description 2
- 108030003004 Triphosphatases Proteins 0.000 description 2
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 241000907316 Zika virus Species 0.000 description 2
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 238000003491 array Methods 0.000 description 2
- 238000005844 autocatalytic reaction Methods 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- WGDUUQDYDIIBKT-UHFFFAOYSA-N beta-Pseudouridine Natural products OC1OC(CN2C=CC(=O)NC2=O)C(O)C1O WGDUUQDYDIIBKT-UHFFFAOYSA-N 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 238000006555 catalytic reaction Methods 0.000 description 2
- 108091092259 cell-free RNA Proteins 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- 210000003483 chromatin Anatomy 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- VFLDPWHFBUODDF-FCXRPNKRSA-N curcumin Chemical class C1=C(O)C(OC)=CC(\C=C\C(=O)CC(=O)\C=C\C=2C=C(OC)C(O)=CC=2)=C1 VFLDPWHFBUODDF-FCXRPNKRSA-N 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 229940104302 cytosine Drugs 0.000 description 2
- SUYVUBYJARFZHO-RRKCRQDMSA-N dATP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-RRKCRQDMSA-N 0.000 description 2
- SUYVUBYJARFZHO-UHFFFAOYSA-N dATP Natural products C1=NC=2C(N)=NC=NC=2N1C1CC(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-UHFFFAOYSA-N 0.000 description 2
- 108010025838 dectin 1 Proteins 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 230000001687 destabilization Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 239000001177 diphosphate Substances 0.000 description 2
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 2
- 235000011180 diphosphates Nutrition 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 2
- 230000037433 frameshift Effects 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 108010064833 guanylyltransferase Proteins 0.000 description 2
- 210000002064 heart cell Anatomy 0.000 description 2
- 102000047147 human SCARA3 Human genes 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000009191 jumping Effects 0.000 description 2
- 239000002523 lectin Substances 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 210000000663 muscle cell Anatomy 0.000 description 2
- 210000004897 n-terminal region Anatomy 0.000 description 2
- 230000009437 off-target effect Effects 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 238000001243 protein synthesis Methods 0.000 description 2
- PTJWIQPHWPFNBW-GBNDHIKLSA-N pseudouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1C1=CNC(=O)NC1=O PTJWIQPHWPFNBW-GBNDHIKLSA-N 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 238000005316 response function Methods 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 125000002652 ribonucleotide group Chemical group 0.000 description 2
- 229950004707 rucaparib Drugs 0.000 description 2
- 238000001338 self-assembly Methods 0.000 description 2
- 238000000654 solvent vapour annealing Methods 0.000 description 2
- 210000001082 somatic cell Anatomy 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 101150024821 tetO gene Proteins 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 230000010474 transient expression Effects 0.000 description 2
- 230000014621 translational initiation Effects 0.000 description 2
- 241001515965 unidentified phage Species 0.000 description 2
- JNAHVYVRKWKWKQ-CYBMUJFWSA-N veliparib Chemical compound N=1C2=CC=CC(C(N)=O)=C2NC=1[C@@]1(C)CCCN1 JNAHVYVRKWKWKQ-CYBMUJFWSA-N 0.000 description 2
- 230000008299 viral mechanism Effects 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- QGKMIGUHVLGJBR-UHFFFAOYSA-M (4z)-1-(3-methylbutyl)-4-[[1-(3-methylbutyl)quinolin-1-ium-4-yl]methylidene]quinoline;iodide Chemical compound [I-].C12=CC=CC=C2N(CCC(C)C)C=CC1=CC1=CC=[N+](CCC(C)C)C2=CC=CC=C12 QGKMIGUHVLGJBR-UHFFFAOYSA-M 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- VHVPQPYKVGDNFY-DFMJLFEVSA-N 2-[(2r)-butan-2-yl]-4-[4-[4-[4-[[(2r,4s)-2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]piperazin-1-yl]phenyl]-1,2,4-triazol-3-one Chemical compound O=C1N([C@H](C)CC)N=CN1C1=CC=C(N2CCN(CC2)C=2C=CC(OC[C@@H]3O[C@](CN4N=CN=C4)(OC3)C=3C(=CC(Cl)=CC=3)Cl)=CC=2)C=C1 VHVPQPYKVGDNFY-DFMJLFEVSA-N 0.000 description 1
- GJTBSTBJLVYKAU-XVFCMESISA-N 2-thiouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=S)NC(=O)C=C1 GJTBSTBJLVYKAU-XVFCMESISA-N 0.000 description 1
- 108020005065 3' Flanking Region Proteins 0.000 description 1
- YSCNMFDFYJUPEF-OWOJBTEDSA-N 4,4'-diisothiocyano-trans-stilbene-2,2'-disulfonic acid Chemical compound OS(=O)(=O)C1=CC(N=C=S)=CC=C1\C=C\C1=CC=C(N=C=S)C=C1S(O)(=O)=O YSCNMFDFYJUPEF-OWOJBTEDSA-N 0.000 description 1
- WJRRGYBTGDJBFX-UHFFFAOYSA-N 4-(2-methyl-3-propan-2-yl-4-imidazolyl)-N-(4-methylsulfonylphenyl)-2-pyrimidinamine Chemical compound CC(C)N1C(C)=NC=C1C1=CC=NC(NC=2C=CC(=CC=2)S(C)(=O)=O)=N1 WJRRGYBTGDJBFX-UHFFFAOYSA-N 0.000 description 1
- ZLOIGESWDJYCTF-XVFCMESISA-N 4-thiouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=S)C=C1 ZLOIGESWDJYCTF-XVFCMESISA-N 0.000 description 1
- 108020005029 5' Flanking Region Proteins 0.000 description 1
- 102100036962 5'-3' exoribonuclease 1 Human genes 0.000 description 1
- 108050004143 5'-3' exoribonucleases Proteins 0.000 description 1
- 102000015896 5'-3' exoribonucleases Human genes 0.000 description 1
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 1
- NEEVCWPRIZJJRJ-LWRDCAMISA-N 5-(benzylideneamino)-6-[(e)-benzylideneamino]-2-sulfanylidene-1h-pyrimidin-4-one Chemical compound C=1C=CC=CC=1C=NC=1C(=O)NC(=S)NC=1\N=C\C1=CC=CC=C1 NEEVCWPRIZJJRJ-LWRDCAMISA-N 0.000 description 1
- ZAYHVCMSTBRABG-UHFFFAOYSA-N 5-Methylcytidine Natural products O=C1N=C(N)C(C)=CN1C1C(O)C(O)C(CO)O1 ZAYHVCMSTBRABG-UHFFFAOYSA-N 0.000 description 1
- LQLQRFGHAALLLE-UHFFFAOYSA-N 5-bromouracil Chemical compound BrC1=CNC(=O)NC1=O LQLQRFGHAALLLE-UHFFFAOYSA-N 0.000 description 1
- NJYVEMPWNAYQQN-UHFFFAOYSA-N 5-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C21OC(=O)C1=CC(C(=O)O)=CC=C21 NJYVEMPWNAYQQN-UHFFFAOYSA-N 0.000 description 1
- ZAYHVCMSTBRABG-JXOAFFINSA-N 5-methylcytidine Chemical compound O=C1N=C(N)C(C)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 ZAYHVCMSTBRABG-JXOAFFINSA-N 0.000 description 1
- LRSASMSXMSNRBT-UHFFFAOYSA-N 5-methylcytosine Chemical compound CC1=CNC(=O)N=C1N LRSASMSXMSNRBT-UHFFFAOYSA-N 0.000 description 1
- WQZIDRAQTRIQDX-UHFFFAOYSA-N 6-carboxy-x-rhodamine Chemical compound OC(=O)C1=CC=C(C([O-])=O)C=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 WQZIDRAQTRIQDX-UHFFFAOYSA-N 0.000 description 1
- 102100026137 7SK snRNA methylphosphate capping enzyme Human genes 0.000 description 1
- 101710159080 Aconitate hydratase A Proteins 0.000 description 1
- 101710159078 Aconitate hydratase B Proteins 0.000 description 1
- 102100036664 Adenosine deaminase Human genes 0.000 description 1
- 235000001674 Agaricus brunnescens Nutrition 0.000 description 1
- 235000016626 Agrimonia eupatoria Nutrition 0.000 description 1
- 241000024188 Andala Species 0.000 description 1
- 241000238421 Arthropoda Species 0.000 description 1
- 241000201269 Artichoke Italian latent virus Species 0.000 description 1
- 239000000592 Artificial Cell Substances 0.000 description 1
- 241000512259 Ascophyllum nodosum Species 0.000 description 1
- 235000000832 Ayote Nutrition 0.000 description 1
- 108020000946 Bacterial DNA Proteins 0.000 description 1
- 108700003860 Bacterial Genes Proteins 0.000 description 1
- 241000218495 Bactrocera correcta Species 0.000 description 1
- 241001474374 Blennius Species 0.000 description 1
- 241000255789 Bombyx mori Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241001536303 Botryococcus braunii Species 0.000 description 1
- 241000195940 Bryophyta Species 0.000 description 1
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 description 1
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 description 1
- 102100039396 C-X-C motif chemokine 16 Human genes 0.000 description 1
- 102100028681 C-type lectin domain family 4 member K Human genes 0.000 description 1
- 102100021992 CD209 antigen Human genes 0.000 description 1
- 108090000835 CX3C Chemokine Receptor 1 Proteins 0.000 description 1
- 102100039196 CX3C chemokine receptor 1 Human genes 0.000 description 1
- 101100310928 Caenorhabditis elegans sra-6 gene Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 229940123587 Cell cycle inhibitor Drugs 0.000 description 1
- 241000195597 Chlamydomonas reinhardtii Species 0.000 description 1
- 244000249214 Chlorella pyrenoidosa Species 0.000 description 1
- 235000007091 Chlorella pyrenoidosa Nutrition 0.000 description 1
- 241000243321 Cnidaria Species 0.000 description 1
- 108020004394 Complementary RNA Proteins 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- KQLDDLUWUFBQHP-UHFFFAOYSA-N Cordycepin Natural products C1=NC=2C(N)=NC=NC=2N1C1OCC(CO)C1O KQLDDLUWUFBQHP-UHFFFAOYSA-N 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 108091029523 CpG island Proteins 0.000 description 1
- 240000004244 Cucurbita moschata Species 0.000 description 1
- 235000009854 Cucurbita moschata Nutrition 0.000 description 1
- 235000009804 Cucurbita pepo subsp pepo Nutrition 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 229930105110 Cyclosporin A Natural products 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- 102000000311 Cytosine Deaminase Human genes 0.000 description 1
- 108010080611 Cytosine Deaminase Proteins 0.000 description 1
- 108010076804 DNA Restriction Enzymes Proteins 0.000 description 1
- 102100039606 DNA replication licensing factor MCM3 Human genes 0.000 description 1
- 102100034001 DNA replication licensing factor MCM5 Human genes 0.000 description 1
- 102100033720 DNA replication licensing factor MCM6 Human genes 0.000 description 1
- 230000007018 DNA scission Effects 0.000 description 1
- 101100481408 Danio rerio tie2 gene Proteins 0.000 description 1
- 102100029791 Double-stranded RNA-specific adenosine deaminase Human genes 0.000 description 1
- 101100420769 Drosophila melanogaster scaf gene Proteins 0.000 description 1
- 241000258955 Echinodermata Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- XZWYTXMRWQJBGX-VXBMVYAYSA-N FLAG peptide Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 XZWYTXMRWQJBGX-VXBMVYAYSA-N 0.000 description 1
- 241000710198 Foot-and-mouth disease virus Species 0.000 description 1
- 230000035519 G0 Phase Effects 0.000 description 1
- RQFCJASXJCIDSX-UUOKFMHZSA-N GMP group Chemical group P(=O)(O)(O)OC[C@@H]1[C@H]([C@H]([C@@H](O1)N1C=NC=2C(=O)NC(N)=NC12)O)O RQFCJASXJCIDSX-UUOKFMHZSA-N 0.000 description 1
- 208000031448 Genomic Instability Diseases 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 241000219146 Gossypium Species 0.000 description 1
- 102100037174 Helicase MOV-10 Human genes 0.000 description 1
- 108010068250 Herpes Simplex Virus Protein Vmw65 Proteins 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 101000804879 Homo sapiens 5'-3' exoribonuclease 1 Proteins 0.000 description 1
- 101000889133 Homo sapiens C-X-C motif chemokine 16 Proteins 0.000 description 1
- 101000963174 Homo sapiens DNA replication licensing factor MCM3 Proteins 0.000 description 1
- 101001017545 Homo sapiens DNA replication licensing factor MCM5 Proteins 0.000 description 1
- 101001018484 Homo sapiens DNA replication licensing factor MCM6 Proteins 0.000 description 1
- 101000865408 Homo sapiens Double-stranded RNA-specific adenosine deaminase Proteins 0.000 description 1
- 101000888841 Homo sapiens Glutamine synthetase Proteins 0.000 description 1
- 101001028696 Homo sapiens Helicase MOV-10 Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101100345091 Homo sapiens MEPCE gene Proteins 0.000 description 1
- 101000916644 Homo sapiens Macrophage colony-stimulating factor 1 receptor Proteins 0.000 description 1
- 101000722029 Homo sapiens Oxidized low-density lipoprotein receptor 1 Proteins 0.000 description 1
- 101000741544 Homo sapiens Properdin Proteins 0.000 description 1
- 101000579423 Homo sapiens Regulator of nonsense transcripts 1 Proteins 0.000 description 1
- 101000663183 Homo sapiens Scavenger receptor class F member 1 Proteins 0.000 description 1
- 101000663187 Homo sapiens Scavenger receptor class F member 2 Proteins 0.000 description 1
- 101001137337 Homo sapiens Transcriptional activator protein Pur-alpha Proteins 0.000 description 1
- 101000723841 Homo sapiens Zinc finger CCHC domain-containing protein 3 Proteins 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 101710203526 Integrase Proteins 0.000 description 1
- 108091029795 Intergenic region Proteins 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 1
- RRHGJUQNOFWUDK-UHFFFAOYSA-N Isoprene Chemical compound CC(=C)C=C RRHGJUQNOFWUDK-UHFFFAOYSA-N 0.000 description 1
- 101150106914 LOX1 gene Proteins 0.000 description 1
- 101150014436 LOX1.1 gene Proteins 0.000 description 1
- 241000270322 Lepidosauria Species 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 235000007688 Lycopersicon esculentum Nutrition 0.000 description 1
- 241000195947 Lycopodium Species 0.000 description 1
- 102100033486 Lymphocyte antigen 75 Human genes 0.000 description 1
- 210000004322 M2 macrophage Anatomy 0.000 description 1
- 101150101439 MCM gene Proteins 0.000 description 1
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 1
- 101710089357 Macrophage receptor MARCO Proteins 0.000 description 1
- 241000218922 Magnoliophyta Species 0.000 description 1
- 240000003183 Manihot esculenta Species 0.000 description 1
- 235000016735 Manihot esculenta subsp esculenta Nutrition 0.000 description 1
- 241000196323 Marchantiophyta Species 0.000 description 1
- 108091027974 Mature messenger RNA Proteins 0.000 description 1
- 101150082854 Mertk gene Proteins 0.000 description 1
- 108010051862 Methylmalonyl-CoA mutase Proteins 0.000 description 1
- 102100030979 Methylmalonyl-CoA mutase, mitochondrial Human genes 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 102000016397 Methyltransferase Human genes 0.000 description 1
- 241001024304 Mino Species 0.000 description 1
- 102000004232 Mitogen-Activated Protein Kinase Kinases Human genes 0.000 description 1
- 108090000744 Mitogen-Activated Protein Kinase Kinases Proteins 0.000 description 1
- 241000710908 Murray Valley encephalitis virus Species 0.000 description 1
- 101100274957 Mus musculus Col1a1 gene Proteins 0.000 description 1
- 101100481410 Mus musculus Tek gene Proteins 0.000 description 1
- 241001250129 Nannochloropsis gaditana Species 0.000 description 1
- 241000244206 Nematoda Species 0.000 description 1
- 241000221960 Neurospora Species 0.000 description 1
- 244000061176 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- KYRVNWMVYQXFEU-UHFFFAOYSA-N Nocodazole Chemical compound C1=C2NC(NC(=O)OC)=NC2=CC=C1C(=O)C1=CC=CS1 KYRVNWMVYQXFEU-UHFFFAOYSA-N 0.000 description 1
- 108020003217 Nuclear RNA Proteins 0.000 description 1
- 102000043141 Nuclear RNA Human genes 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 102100022389 Nucleosome assembly protein 1-like 1 Human genes 0.000 description 1
- 101150086211 OLR1 gene Proteins 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000005877 Peptide Initiation Factors Human genes 0.000 description 1
- 108010044843 Peptide Initiation Factors Proteins 0.000 description 1
- 108091093037 Peptide nucleic acid Proteins 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 208000037581 Persistent Infection Diseases 0.000 description 1
- 101100455173 Phaseolus vulgaris LOXA gene Proteins 0.000 description 1
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 description 1
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 description 1
- 108091007412 Piwi-interacting RNA Proteins 0.000 description 1
- 241000985694 Polypodiopsida Species 0.000 description 1
- 241001672814 Porcine teschovirus 1 Species 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102100026126 Proline-tRNA ligase Human genes 0.000 description 1
- 102100038567 Properdin Human genes 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 102000002727 Protein Tyrosine Phosphatase Human genes 0.000 description 1
- 108010012974 RNA triphosphatase Proteins 0.000 description 1
- 102000044126 RNA-Binding Proteins Human genes 0.000 description 1
- 101710105008 RNA-binding protein Proteins 0.000 description 1
- 102100028287 Regulator of nonsense transcripts 1 Human genes 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 235000011449 Rosa Nutrition 0.000 description 1
- 102100027160 RuvB-like 1 Human genes 0.000 description 1
- 101710169742 RuvB-like protein 1 Proteins 0.000 description 1
- 230000018199 S phase Effects 0.000 description 1
- 108091005487 SCARB1 Proteins 0.000 description 1
- 240000000111 Saccharum officinarum Species 0.000 description 1
- 235000007201 Saccharum officinarum Nutrition 0.000 description 1
- 241000593524 Sargassum patens Species 0.000 description 1
- 102100037118 Scavenger receptor class B member 1 Human genes 0.000 description 1
- 102100037081 Scavenger receptor class F member 1 Human genes 0.000 description 1
- 102100037076 Scavenger receptor class F member 2 Human genes 0.000 description 1
- 108010029176 Sialic Acid Binding Ig-like Lectin 1 Proteins 0.000 description 1
- 102100022055 Signal recognition particle 9 kDa protein Human genes 0.000 description 1
- 101710131307 Signal recognition particle 9 kDa protein Proteins 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- 240000003768 Solanum lycopersicum Species 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 101100182222 Solanum tuberosum LOX1.2 gene Proteins 0.000 description 1
- 102100024470 Stabilin-2 Human genes 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 108091046869 Telomeric non-coding RNA Proteins 0.000 description 1
- 241001648840 Thosea asigna virus Species 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 108010012306 Tn5 transposase Proteins 0.000 description 1
- 102100035715 Transcriptional activator protein Pur-alpha Human genes 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 244000098338 Triticum aestivum Species 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- JCZSFCLRSONYLH-UHFFFAOYSA-N Wyosine Natural products N=1C(C)=CN(C(C=2N=C3)=O)C=1N(C)C=2N3C1OC(CO)C(O)C1O JCZSFCLRSONYLH-UHFFFAOYSA-N 0.000 description 1
- 102000002258 X-ray Repair Cross Complementing Protein 1 Human genes 0.000 description 1
- 108010000443 X-ray Repair Cross Complementing Protein 1 Proteins 0.000 description 1
- 102100036976 X-ray repair cross-complementing protein 6 Human genes 0.000 description 1
- 101710124907 X-ray repair cross-complementing protein 6 Proteins 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- 102100028498 Zinc finger CCHC domain-containing protein 3 Human genes 0.000 description 1
- NOXMCJDDSWCSIE-DAGMQNCNSA-N [[(2R,3S,4R,5R)-5-(2-amino-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate Chemical compound C1=2NC(N)=NC(=O)C=2C=CN1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O NOXMCJDDSWCSIE-DAGMQNCNSA-N 0.000 description 1
- AZJLCKAEZFNJDI-DJLDLDEBSA-N [[(2r,3s,5r)-5-(4-aminopyrrolo[2,3-d]pyrimidin-7-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate Chemical compound C1=CC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 AZJLCKAEZFNJDI-DJLDLDEBSA-N 0.000 description 1
- AZRNEVJSOSKAOC-VPHBQDTQSA-N [[(2r,3s,5r)-5-[5-[(e)-3-[6-[5-[(3as,4s,6ar)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]hexanoylamino]prop-1-enyl]-2,4-dioxopyrimidin-1-yl]-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate Chemical compound O1[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)C[C@@H]1N1C(=O)NC(=O)C(\C=C\CNC(=O)CCCCCNC(=O)CCCC[C@H]2[C@H]3NC(=O)N[C@H]3CS2)=C1 AZRNEVJSOSKAOC-VPHBQDTQSA-N 0.000 description 1
- PGAVKCOVUIYSFO-UHFFFAOYSA-N [[5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate Chemical compound OC1C(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)OC1N1C(=O)NC(=O)C=C1 PGAVKCOVUIYSFO-UHFFFAOYSA-N 0.000 description 1
- ZXZIQGYRHQJWSY-NKWVEPMBSA-N [hydroxy-[[(2s,5r)-5-(6-oxo-3h-purin-9-yl)oxolan-2-yl]methoxy]phosphoryl] phosphono hydrogen phosphate Chemical compound O1[C@H](COP(O)(=O)OP(O)(=O)OP(O)(=O)O)CC[C@@H]1N1C(NC=NC2=O)=C2N=C1 ZXZIQGYRHQJWSY-NKWVEPMBSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000003095 anti-phagocytic effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 230000002622 anti-tumorigenesis Effects 0.000 description 1
- 210000004436 artificial bacterial chromosome Anatomy 0.000 description 1
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 1
- 230000003416 augmentation Effects 0.000 description 1
- XMQFTWRPUQYINF-UHFFFAOYSA-N bensulfuron-methyl Chemical compound COC(=O)C1=CC=CC=C1CS(=O)(=O)NC(=O)NC1=NC(OC)=CC(OC)=N1 XMQFTWRPUQYINF-UHFFFAOYSA-N 0.000 description 1
- 230000002457 bidirectional effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000008512 biological response Effects 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 210000002449 bone cell Anatomy 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 210000000234 capsid Anatomy 0.000 description 1
- 210000003321 cartilage cell Anatomy 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 230000025084 cell cycle arrest Effects 0.000 description 1
- 230000006369 cell cycle progression Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- KFEPVFJQVOMODD-SCDVKCJHSA-N chembl467192 Chemical compound C1=C(Br)C(C)=C(Br)C=C1NCC(=O)N\N=C/C1=CC([N+]([O-])=O)=CC=C1O KFEPVFJQVOMODD-SCDVKCJHSA-N 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 230000008094 contradictory effect Effects 0.000 description 1
- OFEZSBMBBKLLBJ-BAJZRUMYSA-N cordycepin Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)C[C@H]1O OFEZSBMBBKLLBJ-BAJZRUMYSA-N 0.000 description 1
- OFEZSBMBBKLLBJ-UHFFFAOYSA-N cordycepine Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(CO)CC1O OFEZSBMBBKLLBJ-UHFFFAOYSA-N 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 210000000172 cytosol Anatomy 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- HAAZLUGHYHWQIW-KVQBGUIXSA-N dGTP Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 HAAZLUGHYHWQIW-KVQBGUIXSA-N 0.000 description 1
- UFJPAQSLHAGEBL-RRKCRQDMSA-N dITP Chemical compound O1[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)C[C@@H]1N1C(N=CNC2=O)=C2N=C1 UFJPAQSLHAGEBL-RRKCRQDMSA-N 0.000 description 1
- GDPJWJXLKPPEKK-SJAYXVESSA-N dT4 Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)CO)[C@@H](O)C1 GDPJWJXLKPPEKK-SJAYXVESSA-N 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000008260 defense mechanism Effects 0.000 description 1
- 239000005549 deoxyribonucleoside Substances 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 239000005546 dideoxynucleotide Substances 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- ZPTBLXKRQACLCR-XVFCMESISA-N dihydrouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)CC1 ZPTBLXKRQACLCR-XVFCMESISA-N 0.000 description 1
- 230000011559 double-strand break repair via nonhomologous end joining Effects 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 230000009144 enzymatic modification Effects 0.000 description 1
- 210000001339 epidermal cell Anatomy 0.000 description 1
- LYCAIKOWRPUZTN-UHFFFAOYSA-N ethylene glycol Natural products OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 1
- 238000013401 experimental design Methods 0.000 description 1
- 210000000887 face Anatomy 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 238000007667 floating Methods 0.000 description 1
- 231100000221 frame shift mutation induction Toxicity 0.000 description 1
- 238000012226 gene silencing method Methods 0.000 description 1
- 231100000118 genetic alteration Toxicity 0.000 description 1
- 230000004077 genetic alteration Effects 0.000 description 1
- 208000016361 genetic disease Diseases 0.000 description 1
- 231100000025 genetic toxicology Toxicity 0.000 description 1
- 230000001738 genotoxic effect Effects 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 108700031336 human ORF2 Proteins 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 230000005934 immune activation Effects 0.000 description 1
- 230000007124 immune defense Effects 0.000 description 1
- 102000027596 immune receptors Human genes 0.000 description 1
- 108091008915 immune receptors Proteins 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000006054 immunological memory Effects 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 230000005865 ionizing radiation Effects 0.000 description 1
- GURKHSYORGJETM-WAQYZQTGSA-N irinotecan hydrochloride (anhydrous) Chemical compound Cl.C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 GURKHSYORGJETM-WAQYZQTGSA-N 0.000 description 1
- 229960004130 itraconazole Drugs 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 229940100352 lynparza Drugs 0.000 description 1
- 108010026228 mRNA guanylyltransferase Proteins 0.000 description 1
- 235000009973 maize Nutrition 0.000 description 1
- 240000004308 marijuana Species 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 125000004170 methylsulfonyl group Chemical group [H]C([H])([H])S(*)(=O)=O 0.000 description 1
- 108091070501 miRNA Proteins 0.000 description 1
- 238000001000 micrograph Methods 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 1
- 210000003550 mucous cell Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229950006344 nocodazole Drugs 0.000 description 1
- 230000006780 non-homologous end joining Effects 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 230000030147 nuclear export Effects 0.000 description 1
- 230000012223 nuclear import Effects 0.000 description 1
- 102000044158 nucleic acid binding protein Human genes 0.000 description 1
- 108700020942 nucleic acid binding protein Proteins 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 229960000572 olaparib Drugs 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 108010071584 oxidized low density lipoprotein Proteins 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 210000000680 phagosome Anatomy 0.000 description 1
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 230000023603 positive regulation of transcription initiation, DNA-dependent Effects 0.000 description 1
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 1
- 235000012015 potatoes Nutrition 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 108020000494 protein-tyrosine phosphatase Proteins 0.000 description 1
- 235000015136 pumpkin Nutrition 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 239000002096 quantum dot Substances 0.000 description 1
- QQXQGKSPIMGUIZ-AEZJAUAXSA-N queuosine Chemical compound C1=2C(=O)NC(N)=NC=2N([C@H]2[C@@H]([C@H](O)[C@@H](CO)O2)O)C=C1CN[C@H]1C=C[C@H](O)[C@@H]1O QQXQGKSPIMGUIZ-AEZJAUAXSA-N 0.000 description 1
- 108700022487 rRNA Genes Proteins 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000007634 remodeling Methods 0.000 description 1
- 238000009256 replacement therapy Methods 0.000 description 1
- 239000002342 ribonucleoside Substances 0.000 description 1
- 125000000548 ribosyl group Chemical group C1([C@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- HMABYWSNWIZPAG-UHFFFAOYSA-N rucaparib Chemical compound C1=CC(CNC)=CC=C1C(N1)=C2CCNC(=O)C3=C2C1=CC(F)=C3 HMABYWSNWIZPAG-UHFFFAOYSA-N 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 108091005484 scavenger receptor class B Proteins 0.000 description 1
- 102000023888 sequence-specific DNA binding proteins Human genes 0.000 description 1
- 108091008420 sequence-specific DNA binding proteins Proteins 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 108010068698 spleen exonuclease Proteins 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 230000000946 synaptic effect Effects 0.000 description 1
- 230000001360 synchronised effect Effects 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 108700020534 tetracycline resistance-encoding transposon repressor Proteins 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- IBVCSSOEYUMRLC-GABYNLOESA-N texas red-5-dutp Chemical compound O1[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)C[C@@H]1N1C(=O)NC(=O)C(C#CCNS(=O)(=O)C=2C=C(C(C=3C4=CC=5CCCN6CCCC(C=56)=C4OC4=C5C6=[N+](CCC5)CCCC6=CC4=3)=CC=2)S([O-])(=O)=O)=C1 IBVCSSOEYUMRLC-GABYNLOESA-N 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108091006106 transcriptional activators Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 230000013819 transposition, DNA-mediated Effects 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 101150035767 trp gene Proteins 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 229950011257 veliparib Drugs 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- JCZSFCLRSONYLH-QYVSTXNMSA-N wyosin Chemical compound N=1C(C)=CN(C(C=2N=C3)=O)C=1N(C)C=2N3[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O JCZSFCLRSONYLH-QYVSTXNMSA-N 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/711—Natural deoxyribonucleic acids, i.e. containing only 2'-deoxyriboses attached to adenine, guanine, cytosine or thymine and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/713—Double-stranded nucleic acids or oligonucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/45—Transferases (2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/465—Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
- A61K48/0058—Nucleic acids adapted for tissue specific expression, e.g. having tissue specific promoters as part of a contruct
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1241—Nucleotidyltransferases (2.7.7)
- C12N9/1276—RNA-directed DNA polymerase (2.7.7.49), i.e. reverse transcriptase or telomerase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/07—Nucleotidyltransferases (2.7.7)
- C12Y207/07049—RNA-directed DNA polymerase (2.7.7.49), i.e. telomerase or reverse-transcriptase
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/09—Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/8509—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic
- C12N2015/8518—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic expressing industrially exogenous proteins, e.g. for pharmaceutical use, human insulin, blood factors, immunoglobulins, pseudoparticles
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
- C12N2320/31—Combination therapy
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/80—Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/90—Vectors containing a transposable element
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/50—Vector systems having a special element relevant for transcription regulating RNA stability, not being an intron, e.g. poly A signal
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2840/00—Vectors comprising a special translation-regulating system
- C12N2840/20—Vectors comprising a special translation-regulating system translation of more than one cistron
- C12N2840/203—Vectors comprising a special translation-regulating system translation of more than one cistron having an IRES
Definitions
- Cell therapy is a rapidly developing field for addressing difficult to treat diseases, such as cancer, persistent infections and certain diseases that are refractory to other forms of treatment.
- Cell therapy often utilizes cells that are engineered ex vivo and administered to an organism to correct deficiencies within the body.
- An effective and reliable system for manipulation of a cell’s genome is crucial, in the sense that when the engineered cell is administered into an organism, it functions optimally and with prolonged efficacy.
- reliable mechanisms of genetic manipulation form the cornerstone in the success of gene therapy.
- severe deficiencies exist in methods for delivering nucleic acid cargo (e.g., large cargo) in a therapeutically safe and effective manner.
- Viral delivery mechanisms are frequently used to deliver large nucleic acid cargo in a cell but are tied to safety issues and cannot be used to express the cargo in some cell types. Additionally, subjecting a cell to repeated gene manipulation can affect cell health, induce alterations of cell cycle and render the cell unsuitable for therapeutic use. Advancements are continually sought in the area for efficacious delivery and stabilization of an exogenously introduced genetic material for therapeutic purposes.
- compositions and methods for stable, non-viral transfer and integration of genetic material into a cell are provided herein.
- the genetic material is a self-integrating polynucleotide.
- the genetic material can be stably integrated in the genome of the cell.
- the cell may be a human cell.
- the method is designed for a safe and reliable integration of a genetic material into the genome of a cell.
- compositions and methods that allow integration of genetic material into the genome of a cell, wherein the genetic material that can be integrated is not specifically restricted by size.
- the method described herein provides a one-step, single polynucleotide- mediated delivery and integration of genetic "cargo" in the genome of a cell.
- the genetic material may comprise a coding sequence, e.g., a sequence encoding a transgene, a peptide, a recombinant protein, or an antibody or fragments thereof, wherein the method and compositions ensure stable expression of the transcribed product encoded by the coding sequence.
- the genetic material may comprise a non-coding sequence, for example, a regulatory RNA sequences, e.g., a regulatory small inhibitory RNA (siRNA), microRNA (miRNA), long non-coding RNA (IncRNA), or one or more transcription regulators such as a promoter and/or an enhancer, and may also include, but not limited to structural biomolecules such as ribosomal RNA (rRNA), transfer RNA (tRNA) or a fragment thereof or a combination thereof.
- a regulatory RNA sequences e.g., a regulatory small inhibitory RNA (siRNA), microRNA (miRNA), long non-coding RNA (IncRNA), or one or more transcription regulators such as a promoter and/or an enhancer
- rRNA ribosomal RNA
- tRNA transfer RNA
- a therapeutic comprising a polynucleotide comprising a genetic material and a machinery that allows transfer into a cell and stable integration into the genome of the cell into which the polynucleotide or an mRNA encoding the polynucleotide is transferred.
- the therapeutic may be a cell that comprises a polynucleotide that has been stably integrated into the genome of the cell using the methods and compositions described herein.
- the present disclosure provides compositions and methods for stable gene transfer into a cell.
- the compositions and methods are for stable gene transfer into an immune cell.
- the immune cell is a myeloid cell.
- the methods described herein relate to development of myeloid cells for immunotherapy.
- Immunotherapy using phagocytic cells involves making and using engineered myeloid cells, such as macrophages or other phagocytic cells that attack and kill diseased cells, such as cancer cells, or infected cells.
- Engineered myeloid cells, such as macrophages and other phagocytic cells are prepared by incorporating in them via recombinant nucleic acid technology, a synthetic, recombinant nucleic acid encoding an engineered protein, such as a chimeric antigen receptor, that comprises a targeted antigen binding extracellular domain that is designed to bind to specific antigens on the surface of a target, such as a target cell, such as a cancer cell.
- Binding of the engineered chimeric receptor to an antigen on a target initiates phagocytosis of the target.
- a target such as cancer antigen (or likewise, a disease target)
- phagocytosis initiates phagocytosis of the target.
- two, antigens from the target are digested in the phagolysosome of the myeloid cell, are presented on the surface of the myeloid cell, which then leads to activation of T cells and further activation of the immune response and development of immunological memory.
- Chimeric receptors are engineered for enhanced phagocytosis and immune activation of the myeloid cell in which it is incorporated and expressed.
- Chimeric antigen receptors of the disclosure are variously termed herein as a chimeric fusion protein, CFP, phagocytic receptor (PR) fusion protein (PFP), or chimeric antigen receptor for phagocytosis (CAR-P), while each term is directed to the concept of a recombinant chimeric and/or fusion receptor protein.
- genes encoding non-receptor proteins are also co-expressed in the myeloid cells, typically for an augmentation of the chimeric antigen receptor function.
- contemplated herein are various engineered receptor and non-receptor recombinant proteins that are designed to augment phagocytosis and or immune response of a myeloid cell against a disease target, and methods and compositions for creating and incorporating recombinant nucleic acids that encode the engineered receptors or non-receptor recombinant protein, such that the methods and compositions are suitable for creating an engineered myeloid cell for immunotherapy.
- the present disclosure provides compositions and methods for stable gene transfer into a cell, where the cell can be any somatic cell.
- the compositions and methods are designed for cell-specific or tissue-specific delivery.
- the methods described herein relate to supplying a functional protein or a fragment thereof to compensate for an absent or defective (mutated) protein in vivo, e.g., for a protein replacement therapy.
- incorporation of a recombinant nucleic acid in a cell can be accomplished by one or more gene transfer techniques that are available in the state of the art.
- incorporation of exogenous genetic (e.g., nucleic acid) elements into the genome for therapeutic purposes still faces several challenges. Achieving stable integration in a safe and dependable manner, and efficient and prolonged expression are a few among them.
- Most of the successful gene transfer systems aimed at genomic integration of the cargo nucleic acid sequence rely on viral delivery mechanisms, which have some inherent safety and efficacy issues. Delivery and integration of long nucleic acid sequences cannot be achieved by current gene editing systems.
- Integration of a transgene into the genome of a cell to be used for an immunotherapy can be advantageous in the sense that it is stable and a lower number of cells is required for delivery during the therapy.
- integrating a transgene in a non-dividing cell can be challenging in both affecting the health and function of the cell as well as the ultimate lifespan of the cell in vivo, and therefore affects its overall utility as the therapeutic.
- the methods described herein for generating a myeloid cell for immunotherapy can be a cumulative product of a number of steps and compositions involving but not limited to, for example, selecting a myeloid cell for modifying; method and compositions for incorporating a recombinant nucleic acid in a myeloid cell; methods and compositions for enhancing expression of the recombinant nucleic acid; methods and compositions for selecting and modifying vectors; methods of preparing a recombinant nucleic acid suitable for in vivo administration for uptake and incorporation of the recombinant nucleic acid by a myeloid cell in vivo and therefore generating a myeloid cell for therapy.
- one or more embodiments of the various inventions described herein are transferable among each other, and one of skill in the art is expected to use them in alternatives, combinations or interchangeably without the necessity of undue experimentation. All such variations of the disclosed elements are contemplated and fully encompassed herein.
- transposons, or transposable elements are considered herein, for means of incorporating a heterologous, synthetic or recombinant nucleic acid encoding a transgene of interest in a myeloid cell.
- Transposon, or transposable elements are genetic elements that have the capability to transpose fragments of genetic material into the genome by use of an enzyme known as transposase.
- Mammalian genomes contain a high number of transposable element (TE)-derived sequences, and up to 70% of our genome represents TE-derived sequences (de Koning et al. 2011; Richardson et al. 2015). These elements could be exploited to introduce genetic material into the genome of a cell.
- the TE elements are capable of mobilization, often termed as "jumping" genetic material within the genome.
- TEs generally exist in eukaryotic genomes in a reversibly inactive, epigenetically silenced form.
- methods and compositions for efficient and stable integration of transgenes into macrophages and other phagocytic cells are based on use of a transposase and transposable elements mRNA-encoded transposase.
- Long Interspersed Element- 1 (LI) RNAs are used for stable integration and/or retrotransposition of the transgene into a cell (e.g., a macrophage or phagocytic cell.
- Contemplated herein are methods for retrotransposon mediated stable integration of an exogenous nucleic acid sequence into the genome of a cell.
- the method may take advantage of the random genomic integration machinery of the retrotransposon into the cell without creating an adverse effect.
- Methods described herein can be used for robust and versatile incorporation of an exogenous nucleic acid sequence into a cell, such that the exogenous nucleic acid is incorporated at a safe locus within the genome and is expressed without being silenced by the cell’s inherent defense mechanism.
- the method described herein can be used to incorporate an exogenous nucleic acid that is about 1 kb, about 2 kb, about 3 kb, about 4 kb, about 5 kb, about 6 kb, about 7kb about 8 kb, about 9 kb, about 10 kb, or more in size.
- the exogenous nucleic acid is not incorporated within a ribosomal locus.
- the exogenous nucleic acid is not incorporated within a ROSA26 locus, or another safe harbor locus.
- the methods and compositions described herein can incorporate an exogenous nucleic acid sequence anywhere within the genome of the cell.
- contemplated herein is a retrotransposition system that is developed to incorporate an exogenous nucleic acid sequence into a specific predetermined site within the genome of a cell, without creating an adverse effect.
- the disclosed methods and compositions incorporate several mechanisms of engineering the retrotransposons for highly specific incorporation of the exogenous nucleic acid into a cell with high fidelity.
- Retrotransposons chosen for this purpose may be a human retrotransposon.
- Methods and compositions described herein represent a salient breakthrough in the molecular systems and mechanisms for manipulating the genome of a cell. Shown here for the first time is a method that exploits a human retrotransposon system into non-virally delivering and stably integrating a large fragment of exogenous nucleic acid sequence (at least greater than 100 nucleobases, at least greater than 1 kb, at least greater than 2 kb, at least greater than 3 kb, etc.) into a non-conserved region of the genome that is not an rDNA or a ribosomal locus or a designated safe-harbor locus such as the ROSA 26 locus.
- a human retrotransposon system into non-virally delivering and stably integrating a large fragment of exogenous nucleic acid sequence (at least greater than 100 nucleobases, at least greater than 1 kb, at least greater than 2 kb, at least greater than 3 kb, etc.) into a non-
- a retrotransposable system is used to stably incorporate into the genome and express a non- endogenous nucleic acid, where the non-endogenous nucleic acid comprises retrotransposable elements within the nucleic acid sequence.
- a cell s endogenous retrotransposable system (e.g., proteins and enzymes) is used to stably express a non-endogenous nucleic acid in the cell.
- a cell in some embodiments, a cell’s endogenous retrotransposable system (e.g., proteins and enzymes, such as a LINE-1 retrotransposition system) is used, but may further express one or more components of the retrotransposable system to stably express a non-endogenous nucleic acid in the cell.
- a synthetic nucleic acid is provided herein, the synthetic nucleic acid encoding a transgene, and encoding one or more components for genomic integration and/or retrotransposition.
- a method of integrating a nucleic acid sequence into a genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA into the cell, wherein the mRNA comprises: an insert sequence, wherein the insert sequence comprises an exogenous sequence, or a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence; wherein the 5’ UTR sequence or the 3 ’ UTR sequence comprises a binding site for a human ORF protein, and wherein the insert sequence is integrated into the genome of the cell.
- the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for human ORF2p.
- a method for integrating a nucleic acid sequence into the genome of an immune cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence, wherein the 5’ UTR sequence or the 3 ’ UTR sequence comprises an endonuclease binding site and/or a reverse transcriptase binding site, and wherein the transgene sequence is integrated into the genome of the immune cell.
- a method for integrating a nucleic acid sequence into the genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence, a sequence of a human retrotransposon downstream of the 5’ UTR sequence, and a 3’ UTR sequence downstream of the sequence of a human retrotransposon; wherein the 5 ’ UTR sequence or the 3 ’ UTR sequence comprises an endonuclease binding site and/or a reverse transcriptase binding site, and wherein the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs, and wherein the insert sequence is integrated into the genome of the cell.
- the 5 ’ UTR sequence or the 3 ’ UTR sequence comprises an ORF2p binding site.
- the ORF2p binding site is a poly A sequence in the 3' UTR sequence.
- the mRNA comprises a sequence of a human retrotransposon.
- the sequence of a human retrotransposon is downstream of the 5’ UTR sequence.
- the sequence of a human retrotransposon is upstream of the 3’ UTR sequence.
- the polynucleotide sequence that is desired to be transferred and incorporated into the genome of a cell e.g., the insert
- the polynucleotide sequence that is desired to be transferred and incorporated into the genome of a cell is inserted at a site 3’ to the sequence encoding ORF2 in a recombinant nucleic acid construct. In some embodiments the sequence that is desired to be transferred and incorporated into the genome of a cell is inserted within the 3 ’-UTR of ORF1 or ORF2, or both. In some embodiments, the polynucleotide sequence that is sequence that is desired to be transferred and incorporated into the genome of a cell is inserted upstream of the poly A tail of ORF2 in a recombinant nucleic acid construct.
- the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs.
- the two ORFs are non overlapping ORFs.
- the two ORFs are ORF1 and ORF2.
- the ORF1 encodes ORFlp and ORF2 encodes ORF2p.
- the sequence of a human retrotransposon comprises a sequence of a non- LTR retrotransposon. In some embodiments, the sequence of a human retrotransposon comprises a LINE- 1 retrotransposon. In some embodiments, the LINE-1 retrotransposon is a human LINE-1 retrotransposon. In some embodiments, the sequence of a human retrotransposon comprises a sequence encoding an endonuclease and/or a reverse transcriptase. In some embodiments, the endonuclease and/or a reverse transcriptase is ORF2p. In some embodiments, the reverse transcriptase is a group II intron reverse transcriptase domain.
- the endonuclease and/or a reverse transcriptase is a minke whale endonuclease and/or a reverse transcriptase.
- the sequence of a human retrotransposon comprises a sequence encoding ORF2p.
- the insert sequence is integrated into the genome at a poly T site using specificity of an endonuclease domain of the ORF2p.
- the poly T site comprises the sequence TTTTTA.
- a polynucleotide construct comprising an mRNA wherein the mRNA comprises a sequence encoding a human retrotransposon, wherein, (i) the sequence of a human retrotransposon comprises a sequence encoding ORFlp, (ii) the mRNA does not comprise a sequence encoding ORFlp, or (iii) the mRNA comprises a replacement of the sequence encoding ORFlp with a 5' UTR sequence from the complement gene.
- the mRNA comprises a first mRNA molecule encoding ORFlp, and a second mRNA molecule encoding an endonuclease and/or a reverse transcriptase.
- the mRNA is an mRNA molecule comprising a first sequence encoding ORFlp, and a second sequence encoding an endonuclease and/or a reverse transcriptase.
- the first sequence encoding ORFlp and the second sequence encoding an endonuclease and/or a reverse transcriptase are separated by a linker sequence.
- the linker sequence comprises an internal ribosome entry sequence (IRES).
- IRES is an IRES from CVB3 or EV71.
- the linker sequence encodes a self-cleaving peptide sequence.
- the linker sequence encodes a T2A, a E2A or a P2A sequence
- the sequence of a human retrotransposon comprises a sequence that encodes ORFlp fused to an additional protein sequence and/or a sequence that encodes ORF2p fused to an additional protein sequence.
- the ORFlp and/or the ORF2p is fused to a nuclear retention sequence.
- the nuclear retention sequence is an Alu sequence.
- the ORFlp and/or the ORF2p is fused to an MS2 coat protein.
- the 5’ UTR sequence or the 3’ UTR sequence comprises at least one, two, three or more MS2 hairpin sequences.
- the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that promotes or enhances interaction of a poly A tail of the mRNA with the endonuclease and/or a reverse transcriptase. In some embodiments, the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that promotes or enhances interaction of a poly-A-binding proteins (e.g., PABP) with the endonuclease and/or a reverse transcriptase. In some embodiments, the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that increases specificity of the endonuclease and/or a reverse transcriptase to the mRNA relative to another mRNA expressed by the cell. In some embodiments, the 5’ UTR sequence or the 3’ UTR sequence comprises an Alu element sequence.
- the first sequence encoding ORFlp and the second sequence encoding an endonuclease and/or a reverse transcriptase have the same promoter.
- the insert sequence has a promoter that is different from the promoter of the first sequence encoding ORFlp.
- the insert sequence has a promoter that is different from the promoter of the second sequence encoding an endonuclease and/or a reverse transcriptase.
- the first sequence encoding ORFlp and/or the second sequence encoding an endonuclease and/or a reverse transcriptase have a promoter or transcription initiation site selected from the group consisting of an inducible promoter, a CMV promoter or transcription initiation site, a T7 promoter or transcription initiation site, an EF1 a promoter or transcription initiation site and combinations thereof.
- the insert sequence has a promoter or transcription initiation site selected from the group consisting of an inducible promoter, a CMV promoter or transcription initiation site, a T7 promoter or transcription initiation site, an EF1 a promoter or transcription initiation site and combinations thereof.
- the first sequence encoding ORFlp and the second sequence encoding an endonuclease and/or a reverse transcriptase are codon optimized for expression in a human cell.
- the mRNA comprises a WPRE element. In some embodiments, the mRNA comprises a selection marker. In some embodiments, the mRNA comprises a sequence encoding an affinity tag. In some embodiments, the affinity tag is linked to the sequence encoding an endonuclease and/or a reverse transcriptase.
- the 3' UTR comprises a poly A sequence or wherein a poly A sequence is added to the mRNA in vitro.
- the poly A sequence is downstream of a sequence encoding an endonuclease and/or a reverse transcriptase.
- the insert sequence is upstream of the poly A sequence.
- the 3' UTR sequence comprises the insert sequence.
- the insert sequence comprises a sequence that is a reverse complement of the sequence encoding the exogenous polypeptide.
- the insert sequence comprises a polyadenylation site.
- the insert sequence comprises an SV40 polyadenylation site.
- the insert sequence comprises a polyadenylation site upstream of the sequence that is a reverse complement of the sequence encoding the exogenous polypeptide.
- the insert sequence is integrated into the genome at a locus that is not a ribosomal locus. In some embodiments, the insert sequence is integrated into the genome at a locus that is not a rDNA locus.
- the insert sequence integrates into a gene or regulatory region of a gene, thereby disrupting the gene or downregulating expression of the gene. In some embodiments, the insert sequence integrates into a gene or regulatory region of a gene, thereby upregulating expression of the gene. In some embodiments, the insert sequence integrates into the genome and replaces a gene. In some embodiments, the insert sequence is stably integrated into the genome. In some embodiments, the insert sequence is retrotransposed into the genome. In some embodiments, the insert sequence is integrated into the genome by cleavage of a DNA strand of a target site by an endonuclease encoded by the mRNA. In some embodiments, the insert sequence is integrated into the genome via target-primed reverse transcription (TPRT).
- TPRT target-primed reverse transcription
- the insert sequence is integrated into the genome via reverse splicing of the mRNA into a DNA target site of the genome.
- the cell is an immune cell.
- the immune cell is a T cell or aB cell.
- the immune cell is a myeloid cell.
- the immune cell is selected from a group consisting of a monocyte, a macrophage, a dendritic cell, a dendritic precursor cell, and a macrophage precursor cell.
- the mRNA is a self-integrating mRNA.
- the method comprises introducing into the cell the mRNA.
- the method comprises introducing into the cell the vector encoding the mRNA.
- the method comprises introducing the mRNA or the vector encoding the mRNA into a cell ex vivo.
- the method further comprises administering the cell to a human subject.
- the method comprises administering the mRNA or the vector encoding the mRNA to a human subject.
- an immune response is not elicited in the human subject.
- the mRNA or the vector is substantially non-immunogenic.
- the vector is a plasmid or a viral vector.
- the vector comprises a non-LTR retrotransposon.
- the vector comprises a human LI element.
- the vector comprises a LI retrotransposon ORF1 gene.
- the vector comprises a LI retrotransposon ORL2 gene.
- the vector comprises a LI retrotransposon.
- the mRNA is at least about 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, or 3 kilobases. In some embodiments, the mRNA is a most about
- the mRNA comprises a sequence that inhibits or prevents degradation of the mRNA.
- the sequence that inhibits or prevents degradation of the mRNA inhibits or prevents degradation of the mRNA by an exonuclease or an RNAse.
- the sequence that inhibits or prevents degradation of the mRNA is a G quadruplex, pseudoknot or triplex sequence.
- the sequence the sequence that inhibits or prevents degradation of the mRNA is an exoribonuclease-resistant RNA structure from a flaviviral RNA or an ENE element from KSV.
- the sequence that inhibits or prevents degradation of the mRNA inhibits or prevents degradation of the mRNA by a deadenylase. In some embodiments, the sequence that inhibits or prevents degradation of the mRNA comprises non-adenosine nucleotides within or at a terminus of a poly A tail of the mRNA. In some embodiments, the sequence that inhibits or prevents degradation of the mRNA increases stability of the mRNA.
- the exogenous sequence comprises a sequence encoding an exogenous polypeptide. In some embodiments, the sequence encoding an exogenous polypeptide is not in frame with a sequence encoding an endonuclease and/or a reverse transcriptase.
- the sequence encoding an exogenous polypeptide is not in frame with a sequence encoding an endonuclease and/or a reverse transcriptase. In some embodiments, the exogenous sequence does not comprise introns. In some embodiments, the exogenous sequence comprises a sequence encoding an exogenous polypeptide selected from the group consisting of an enzyme, a receptor, a transport protein, a structural protein, a hormone, an antibody, a contractile protein and a storage protein. In some embodiments, the exogenous sequence comprises a sequence encoding an exogenous polypeptide selected from the group consisting of a chimeric antigen receptor (CAR), a ligand, an antibody, a receptor, and an enzyme.
- CAR chimeric antigen receptor
- the exogenous sequence comprises a regulatory sequence.
- the regulatory sequence comprises a cis-acting regulatory sequence.
- the regulatory sequence comprises a cis-acting regulatory sequence selected from the group consisting of an enhancer, a silencer, a promoter or a response element.
- the regulatory sequence comprises a trans-acting regulatory sequence.
- the regulatory sequence comprises a trans-acting regulatory sequence that encodes a transcription factor.
- integration of the insert sequence does not adversely affect cell health.
- the endonuclease, the reverse transcriptase or both are capable of site-specific integration of the insert sequence.
- the mRNA comprises a sequence encoding an additional nuclease domain or a nuclease domain that is not derived from ORF2.
- the mRNA comprises a sequence encoding a megaTAL nuclease domain, a TALEN domain, a Cas9 domain, a zinc finger binding domain from an R2 retroelement, or a DNA binding domain that binds to repetitive sequences such as a Rep78 from AAV.
- the endonuclease comprises a mutation that reduces activity of the endonuclease compared to the endonuclease without the mutation.
- the endonuclease is an ORF2p endonuclease and the mutation is S228P.
- the mRNA comprises a sequence encoding a domain that increases fidelity and/or processivity of the reverse transcriptase.
- the reverse transcriptase is a reverse transcriptase from a retroelement other than ORF2 or reverse transcriptase that has higher fidelity and/or processivity compared to a reverse transcriptase of ORF2p.
- the reverse transcriptase is a group II intron reverse transcriptase.
- the group II intron reverse transcriptase is a group IIA intron reverse transcriptase, a group PB intron reverse transcriptase, or a group IIC intron reverse transcriptase. In some embodiments, the group II intron reverse transcriptase is TGIRT-II or TGIRT-III.
- the mRNA comprises a sequence comprising an Alu element and/or a ribosome binding aptamer. In some embodiments, the mRNA comprises a sequence encoding a polypeptide comprising a DNA binding domain. In some embodiments, the 3' UTR sequence is derived from a viral 3' UTR or a beta-globin 3' UTR.
- composition comprising a recombinant mRNA or vector encoding an mRNA, wherein the mRNA comprises a human LINE-1 transposon sequence comprising a human LINE-1 transposon 5’ UTR sequence, a sequence encoding ORFlp downstream of the human LINE-1 transposon 5’ UTR sequence, an inter-ORF linker sequence downstream of the sequence encoding ORFlp, a sequence encoding ORF2p downstream of the inter-ORF linker sequence, and a 3 ’ UTR sequence derived from a human LINE-1 transposon downstream of the sequence encoding ORF2p; wherein the 3’ UTR sequence comprises an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide or a reverse complement of a sequence encoding an exogenous regulatory element.
- the insert sequence integrates into the genome of a cell when introduced into the cell. In some embodiments, the insert sequence integrates into a gene associated a condition or disease, thereby disrupting the gene or downregulating expression of the gene. In some embodiments, the insert sequence integrates into a gene, thereby upregulating expression of the gene. In some embodiments, the recombinant mRNA or vector encoding the mRNA is isolated or purified.
- composition comprising a nucleic acid comprising a nucleotide sequence encoding (a) a long interspersed nuclear element (LINE) polypeptide, wherein the LINE polypeptide includes human ORFlp and human ORF2p; and (b) an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide or a reverse complement of a sequence encoding an exogenous regulatory element, wherein the composition is substantially non-immunogenic.
- LINE long interspersed nuclear element
- the composition comprises human ORFlp and human ORF2p proteins.
- the composition comprises a ribonucleoprotein (RNP) comprising human ORFlp and human ORF2p complexed to the nucleic acid.
- RNP ribonucleoprotein
- the nucleic acid is mRNA.
- a composition comprising a cell comprising a composition described herein.
- the cell is an immune cell.
- the immune cell is a T cell or a B cell.
- the immune cell is a myeloid cell.
- the immune cell is selected from a group consisting of a monocyte, a macrophage, a dendritic cell, a dendritic precursor cell, and a macrophage precursor cell.
- the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide and the exogenous polypeptide is a chimeric antigen receptor (CAR).
- a pharmaceutical composition comprising a composition described herein, and a pharmaceutically acceptable excipient.
- the pharmaceutical composition is for use in gene therapy.
- the pharmaceutical composition is for use in the manufacture of a medicament for treating a disease or condition.
- the pharmaceutical composition is for use in treating a disease or condition.
- a method of treating a disease in a subject comprising administering a pharmaceutical composition described herein to a subject with a disease or condition.
- the method increases an amount or activity of a protein or functional RNA in the subject.
- the subject has a deficient amount or activity of a protein or functional RNA.
- the deficient amount or activity of a protein or functional RNA is associated with or causes the disease or condition.
- the method further comprising administering an agent that inhibits human silencing hub (HUSH) complex, an agent that inhibits FAM208A, or an agent that inhibits TRIM28.
- the agent that inhibits human silencing hub (HUSH) complex is an agent that inhibits Periphilin, TASOR and/or MPP8.
- the agent that inhibits human silencing hub (HUSH) complex inhibits assembly of the HUSH complex.
- the agent inhibits the fanconia anemia complex.
- the agent inhibits FANCD2-FANC1 heterodimer monoubiquitination.
- the agent inhibits FANCD2-FANC1 heterodimer formation.
- the agent inhibits the Fanconi Anemia (FA) core complex.
- FA core complex is a component of the fanconi anemia DNA damage repair pathway, e.g., in chemotherapy induced DNA inter strand crosslinks.
- the FA core complex comprises two central dimers of the FANCB and FA-associated protein of 100 kDa (FAAP100) subunits, flanked by two copies of the RING finger subunit, FANCL. These two heterotrimers act as a scaffold to assemble the remaining five subunits, resulting in an extended asymmetric structure. Destabilization of the scaffold would disrupt the entire complex, resulting in a non functional FA pathway.
- agents that can inhibit the FA core complex include Bortezomib and cur cumin analogs EF24 and 4H-TTD.
- novel transposon-based vectors useful in providing gene therapy to an animal. It is an object of the present invention to provide novel transposon-based vectors for use in the preparation of a medicament useful in providing gene therapy to an animal or human. It is another object of the present invention to provide novel transposon-based vectors that encode for the production of desired proteins or peptides in cells. Yet another object of the present invention to provide novel transposon-based vectors that encode for the production of desired nucleic acids in cells. It is a further object of the present invention to provide methods for cell and tissue specific incorporation of transposon-based DNA or RNA constructs comprising targeting a selected gene to a specific cell or tissue of an animal.
- Yet another object of the present invention is to provide a method for gene therapy of animals through administration of transposon-based vectors comprising tissue specific promoters and a gene of interest to facilitate tissue specific incorporation and expression of a gene of interest to produce a desired protein, peptide or nucleic acid.
- Another object of the present invention is to provide a method for gene therapy of animals through administration of transposon-based vectors comprising cell specific promoters and a gene of interest to facilitate cell specific incorporation and expression of a gene of interest to produce a desired protein, peptide or nucleic acid.
- Still another object of the present invention is to provide a method for gene therapy of animals through administration of transposon-based vectors comprising cell specific promoters and a gene of interest to facilitate cell specific incorporation and expression of a gene of interest to produce a desired protein, peptide or nucleic acid, wherein the desired protein, peptide or nucleic acid has a desired biological effect in the animal.
- FIG. 1A illustrates a general mechanism of action of retrotransposons.
- I is a schematic representing the overall lifecycle of an autonomous retrotransposon.
- P LINE-1 retrotransposon comprises LINE-1 elements, which encode two proteins ORFlp and ORF2p that are expressed as mRNAs. The bicistronic mRNA is translated into the two proteins, and when ORF2p is translated by a read-through event by the ribosome, it binds the 3 ’end of its own mRNA through the poly A tail (III).
- ORF2p cleaves at a consensus sequence TAAAA, where the poly A at the 3’ end of the mRNA hybridizes and primes the reverse transcriptase activity of the ORF2 protein. The protein reverse-transcribes the mRNA back into DNA leading to an insertion of the LINE-1 sequence back into a new location in the genome (IV).
- FIG. IB illustrates various exemplary designs for integrating an mRNA encoding a transgene into the genome of a cell.
- GFP shown here in a box is an exemplary transgene.
- FIG. 1C illustrates various exemplary designs for integrating an mRNA encoding a transgene into the genome of a cell.
- GFP shown here in a box is an exemplary transgene.
- FIG. 2A illustrates three exemplary designs for expressing an exemplary transgene GFP by stably incorporating the sequence encoding GFP using the constructs. Expected GFP expression levels at 72 hours are shown on the right side.
- FIG. 2B illustrates three exemplary designs for expressing an exemplary transgene GFP by stably incorporating the sequence encoding RFP, RFP and GFP or ORF2p and GFP using the constructs. Expected GFP and RFP expression levels at 72 hours are shown on the right side.
- FIG. 3A illustrates an exemplary diagram of conventional circRNA structure and formation.
- FIG. 3B illustrates two views of an exemplary RL-GAAA tectoRNA motif designs.
- FIG. 3C illustrates exemplary structures of chip-flow piece RNAs as platforms for testing potential tectoRNA.
- FIG. 4A illustrates an exemplary schematic showing ORF2p binding to an ORF2 poly A region.
- FIG. 4B illustrates an exemplary schematic showing how a fusion of ORF2p with an MS2 RNA binding domain binds to an MS2 binding RNA sequence in the 3’UTR of an mRNA encoding the ORF2 an increase specificity.
- FIG. 4C illustrates exemplary designs of retrotransposon systems for stably integrating a nucleic acid into the genome of a cell at specific sites.
- the upper panel shows a design using an ORFp2-MegaTAL DNA binding domain fusion where the DNA binding and endonuclease activity of ORF2p is mutated to be inactive.
- the middle panel shows a chimeric ORF2p where the endonuclease domain has been replaced with a high specificity and high-fidelity nuclease domain of another protein.
- the lower panel shows a fusion of a DNA binding domain of a heterologous protein with ORF2p such that the fusion protein binds to ORF2 binding site as well additional DNA sequences in the vicinity of the ORF2 site.
- FIG. 5 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
- FIG. 6A illustrates an exemplary construct with a sequence encoding ORFlp for integrating an mRNA encoding a transgene into the genome of a cell.
- FIG. 6B illustrates an exemplary construct without a sequence encoding ORFlp for integrating an mRNA encoding a transgene into the genome of a cell.
- FIG. 7A illustrates exemplary methods of improving mRNA half-life by inhibiting degradation by 5’-3’ exonucleases, such as XRN1, or 3’-5’ exosomal degradation, by introducing structures corresponding to a G-quadruplex, or, a pseudoknot in the 5’UTR; and/or xrRNAs, a triplex motifs and/or a non-A nucleotide residues in the 3’UTR.
- 5’-3’ exonucleases such as XRN1, or 3’-5’ exosomal degradation
- FIG. 7B illustrates an exemplary schematic of a myeloid cell expressing a transgene encoding a chimeric receptor that binds a cancer cell and induces anti-cancer activity.
- FIG. 7C shows expected results of introducing bulk or purified RNA encoding a chimeric receptor that binds a cancer cell as described in FIG. 7B on increased and prolonged expression of the chimeric receptors.
- FIG. 8A shows an exemplary plasmid design and expected LINE-1 mRNA transcript with a cargo nucleic acid sequence.
- the plasmid has a LINE-1 sequence (comprising ORF1 and ORF2 protein encoding sequences) and a cargo sequence which is a nucleic acid sequence encoding GFP, where the coding sequence of GFP is interrupted with an intron. The GFP is not expressed until the sequence is integrated in the genome and the intron is spliced.
- FIG. 8B shows exemplary results showing successful integration of the mRNA transcript encoded by the plasmid shown in FIG. 8A and expression of GFP relative to mock-transfected cells (fold increase in mean fluorescence intensity of GFP positive cells is shown). Mock transfected cells were transfected by the vector lacking the GFP cargo sequence.
- FIG. 8C shows exemplary flow cytometry results from the results shown in FIG. 8B.
- FIG. 9A shows an exemplary plasmid design and expected LINE-1 mRNA transcript with a cargo nucleic acid sequence.
- the plasmid has a LINE-1 sequence (comprising ORF1 and ORF2 protein encoding sequences) and a cargo sequence which is a nucleic acid sequence encoding a recombinant chimeric fusion receptor protein (ATAK receptor) that has extracellular region capable of binding to CD5 and an intracellular region comprising an FCR intracellular domain and a PI3 kinase recruitment domain.
- ATAK receptor recombinant chimeric fusion receptor protein
- FIG. 9B shows exemplary results showing successful integration of the mRNA transcript encoded by the plasmid shown in FIG. 9A and expression of ATAK relative to mock-transfected cells (fold increase in mean fluorescence intensity of ATAK positive cells is shown). Mock transfected cells were transfected by the vector lacking the ATAK cargo sequence. Expression of ATAK receptor protein was detected by binding with a labeled CD5 antibody.
- FIG. 9C shows exemplary flow cytometry results from the results shown in FIG. 9B.
- FIG. 10A shows an exemplary plasmid design and expected LINE-1 mRNA transcript with a cargo nucleic acid sequence.
- the plasmid has a LINE-1 sequence (comprising ORF1 and ORF2 protein encoding sequences) and a cargo sequence which is a nucleic acid sequence encoding a recombinant chimeric fusion receptor protein (ATAK receptor) followed by a T2A self-cleavage sequence followed by a split GFP sequence (all in a reverse orientation relative to the LINE-1 sequence).
- the coding sequence of the GFP is interrupted with an intron. Expected mRNA after reverse transcription and integration of the cargo are depicted.
- FIG. 10B shows exemplary results showing successful integration of the mRNA transcript encoded by the plasmid shown in FIG. 10A and expression of ATAK-T2A-GFP relative to mock- transfected cells (fold change in GFP and ATAK double positive cells is shown). Mock transfected cells were transfected by the vector lacking the ATAK cargo sequence. Expression of ATAK receptor protein was detected by binding with a labeled CD5 antibody.
- FIG. IOC shows representative flow cytometry data from two separate experimental runs for expression of both GFP and CD5 binder (ATAK) using the experimental setup shown in FIG. 10A.
- FIG. 10D shows representative flow cytometry data from two separate experimental runs for expression of both GFP and CD5 binder (ATAK) using the experimental setup shown in FIG. 10A.
- FIG. 11A shows exemplary mRNA constructs for retrotranspositi on-based gene delivery.
- the ORF1 and ORF2 sequences are in two difference mRNA molecules.
- the ORF2p (ORF2) coding mRNA comprises and inverted GFP coding sequence.
- FIG. 11B depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) upon electroporating both ORFl-mRNA and ORF2-FLAG-GFPai mRNA normalized to electroporation of ORF2-FLAG-GFPai mRNA only.
- FIG. 12A depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) upon electroporating ORFl-mRNA and ORF2-FLAG-GFPai mRNA at different amounts. Fold increase is relative to lx ORF2-GFPao and lx ORFl mRNA.
- FIG. 12B shows an exemplary fluorescent microscopy image of GFP+ cells following electroporation of the mRNA depicted in FIG. 11A.
- FIG. 13A shows exemplary mRNA constructs where the ORFl and ORF2 sequences are in two difference mRNA molecules (top panel) and a LINE-1 mRNA transcript comprising ORFl and ORF2 protein encoding sequences on a single mRNA molecule (bottom panel) for gene delivery.
- mRNA contains the bicistronic ORFl and ORF2 sequence with a CMV-GFP sequence in the 3’UTR going from 3’-5 ⁇
- LINE-1 mRNA Upon retrotransposition of the delivered ORF2-cmv-GFP antisense (LINE-1 mRNA), cells are expected to express GFP.
- FIG. 13B depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) upon electroporating the constructs depicted in FIG. 13A.
- FIG. 14A shows an exemplary experimental design for testing whether multiple electroporations increases retrotransposition efficiency.
- HEK293T cells were electroporated every 48 hours with the Maxcyte system and assessed for GFP positive cells using flow after culturing for 24-72 hrs.
- FIG. 14B depicts exemplary data showing expression of GFP at the indicated times (fold increase in mean fluorescence intensity of GFP positive cells is shown) upon electroporating 1-5 times according to FIG. 14A.
- FIG. 15A depicts exemplary constructs to enhance retrotransposition via mRNA delivery.
- a nuclear localization signal (NLS) sequence is fused to the C terminus of the ORF2 sequence (ORF2-NLS fusion).
- a Minke whale ORF2 sequence was used in place of the human ORF2.
- a minimal sequence of the Alu element (AJL-H33delta) is inserted in the 3’UTR of the LINE-1 sequence.
- MS2 hairpins are inserted in the 3’UTR of the LINE-1 sequence and an MS2 hairpin binding protein (MCP) sequence is fused to the ORF2 sequence.
- MCP MS2 hairpin binding protein
- FIG. 15B depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) using the constructs depicted in FIG. 15A.
- FIG. 16A shows exemplary plasmid constructs where the ORFl and ORF2 sequences are in two difference plasmid molecules (top panel) and a plasmid encoding a LINE-1 mRNA transcript comprising ORFl and ORF2 protein encoding sequences on a single mRNA molecule with various replacements of the inter-ORF sequence between ORFl and ORF2 (bottom panel) for gene delivery.
- FIG. 16B depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) using the constructs depicted in FIG. 16A.
- FIG. 17A depicts an exemplary plasmid construct encoding a LINE-1 mRNA transcript comprising ORFl and ORF2 protein encoding sequences on a single mRNA molecule with a GFP sequence (top panel) and an exemplary LINE-1 mRNA transcript comprising ORFl and ORF2 protein encoding sequences on a single mRNA molecule with a GFP sequence.
- FIG. 17B depicts exemplary data showing expression of GFP (fold increase in mean fluorescence intensity of GFP positive cells is shown) in Jurkat cells using the constructs depicted in FIG. 17A.
- the plasmid construct was transfected, and the mRNA construct was electroporated.
- FIG. 18A shows an exemplary plasmid design and expected LINE-1 mRNA transcript with a cargo nucleic acid sequence.
- the plasmid has a LINE-1 sequence (comprising ORFl and ORF2 protein encoding sequences) and a cargo sequence which is a nucleic acid sequence encoding a recombinant chimeric fusion receptor protein (ATAK receptor) followed by a T2A self-cleavage sequence followed by a split GFP sequence (all in a reverse orientation relative to the LINE-1 sequence).
- the coding sequence of the GFP is interrupted with an intron. Expected mRNA after reverse transcription and integration of the cargo are depicted.
- FIG. 18B shows exemplary results showing successful integration of the mRNA transcript encoded by the plasmid shown in FIG. 10A and expression of ATAK-T2A-GFP relative to mock- transfected cells (fold change in GFP and ATAK double positive cells is shown) in a myeloid cell line (THP-1). Data represents expression at 6 days post transfection, normalized over mock plasmid transfected cells wherein the mock plasmid does not have GFP coding sequence.
- FIG. 19 illustrates an exemplary experimental set up for cell synchronization.
- a heterogenous cell population is sorted based on cell cycle stage, prior to delivery of an exogenous nucleic acid.
- Cell cycle synchronization is expected to result in higher expression and stabilization of the exogenous nucleic acid delivered. If cells are not homogeneous after cell sorting, then cells can be further incubated with a suitable agent that arrests cell cycle at a stage.
- FIG. 20 illustrates an exemplary method for increasing retrotransposon efficiency by inducing DNA double stranded breaks, with or without inhibiting DNA repair pathways, such as by inducing DNA ligase inhibitor SCR7 or inhibiting host surveillance proteins, for example, using miRNA to HUSH complex TASOR protein.
- FIG. 21 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
- FIG. 22 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
- FIG. 23 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
- FIG. 24 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
- FIG. 25 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
- FIG. 26 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
- FIG. 27 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
- FIG. 28 illustrates exemplary constructs for integrating an mRNA encoding a transgene into the genome of a cell.
- the present invention arises in part from the exciting discovery that a polynucleotide could be designed and developed to accomplish transfer and integration of a genetic cargo (e.g., large genetic cargo) into the genome of a cell.
- the polynucleotide comprises (i) a genetic material for stable expression, and (ii) a self-integrating genomic integration machinery that allows stable integration of the genetic material into a cell by non-viral means, that is both safe and efficacious.
- the genetic material may be integrated at a locus other than a ribosomal locus; the genetic material may be integrated site-specifically; and/or the integrated genetic material appear to express without triggering a cell’s natural silencing machinery.
- CRISPR Clustered Regularly -Interspaced Short Palindromic Repeats
- HDR homology-directed repair
- CRISPR/Cas9 is a naturally occurring RNA-guided endonuclease. While the CRISPR/Cas9 system has demonstrated great promise for site-specific gene editing and other applications, there are several factors that influence its efficacy which must be addressed, especially if it is to be used for in vivo human gene therapy. These factors include target DNA site selection, sgRNA design, off-target cutting, incidence/efficiency of HDR vs.
- Zinc finger nucleases ZFNs are a fusion protein of Cys2-His2 zinc finger proteins (ZFPs) and a non-specific DNA restriction enzyme derived from Fokl endonucleases. Challenges with ZFPs include design and engineering of the ZFP for high-affinity binding of the desired sequence, which is non-trivial. Also, not all sequences are available for ZFP binding, so site selection is limited. Another significant challenge is off- target cutting.
- Transcription activator-like effector nucleases are a fusion protein comprised of a TALE and a Fokl nuclease.
- TALENs While off-target cutting remains a concern, TALENs have been shown in one side-by-side comparison study to be more specific and less cytotoxic than ZFNs. However, TALENs are substantially larger, and the cDNA encoding TALEN only is 3kb. This makes delivery of a pair of TALENs more challenging than a pair of ZFNs due to delivery vehicle cargo size limitations. Further, packaging and delivery of TALENs in some viral vectors may be problematic due to the high level of repetition in the TALENs sequence.
- a mutant Cas9 system, a fusion protein of inactive dCas9 and a Fokl nuclease dimer increase specificity and reduce off-target cutting, the number of potential target sites is lower due to PAM and other sgRNA design constraints.
- the present invention addresses the problems described above by providing new, effective and efficient compositions comprising transposon-based vectors for providing therapy, including gene therapy, to animals and humans.
- the present invention provides methods of using these compositions for providing therapy to animals and humans.
- These transposon-based vectors can be used in the preparation of a medicament useful for providing a desired effect to a recipient following administration.
- Gene therapy includes, but is not limited to, introduction of a gene, such as an exogenous gene, into an animal using a transposon-based vector.
- These genes may serve a variety of functions in the recipient such as coding for the production of nucleic acids, for example RNA, or coding for the production of proteins and peptides.
- the present invention can facilitate efficient incorporation of the polynucleotide sequences, including the genes of interest, promoters, insertion sequences, poly A and any regulatory sequences.
- the invention is based on the finding that human LINE-1 elements are capable of retrotransposition in human cells as well as cells of other animal species and can be manipulated in a versatile manner to achieve efficient delivery and integration of a genetic cargo into the genome of a cell.
- Such LINE-1 elements have a variety of uses in human and animal genetics including, but not limited to, uses in diagnosis and treatment of genetic disorders and in cancer.
- the LINE-1 elements of the invention are also useful for the treatment of various phenotypic effects of various diseases. For example, LINE-1 elements may be used for transfer of DNA encoding anti-tumorigenic gene products into cancer cells. Other uses of the LINE-1 elements of the invention will become apparent to the skilled artisan upon a reading of the present specification.
- a human LINE-1 element comprises a 5' UTR with an internal promoter, two non overlapping reading frames (ORF1 and ORF2), a 200 bp 3' UTR and a 3' poly A tail.
- the LINE-1 retrotransposon can also comprise an endonuclease domain at the LINE-1 ORF2 N-terminus.
- the finding that LINE-1 encodes an endonuclease demonstrates that the element is capable of autonomous retrotransposition.
- LINE-1 is a modular protein that contains non-overlapping functional domains which mediate its reverse transcription and integration.
- the sequence specificity of the LINE-1 endonuclease itself can be altered or the LINE-1 endonuclease can be replaced with another site- specific endonuclease.
- the LINE-1 retrotransposon may be manipulated using recombinant DNA technology to comprise and/or be contiguous with, other DNA elements which render the retrotransposon suitable for insertion of substantial lengths (up to 1 kb, or greater than 1 kb) of heterologous or homologous DNA into the genome of a cell.
- the LINE-1 retrotransposon may also be manipulated using the same type of technology such that insertion of the DNA into the genome of a cell is site-directed (site into which such DNA is inserted is known). Alternatively, the LINE-1 retrotransposon may be manipulated such that the insertion site of the DNA is random.
- the retrotransposon may also be manipulated to effect insertion of a desired DNA sequence into regions of DNA which are normally transcriptionally silent, wherein the DNA sequence is expressed in a manner such that it does not disrupt the normal expression of genes in the cell.
- the integration or retrotransposition is in the trans orientation. In some embodiments, the integration or retrotransposition occurs in the cis orientation.
- LINE-1 Since LINE-1 is native to human cells, when the constructs are placed into human cells, they should not be rejected by the immune system as foreign. In addition, the mechanism of LINE-1 retrointegration ensures that only one copy of the gene is integrated at any specific chromosomal location. Accordingly, there is a copy number control built into the system. In contrast, gene transfer procedures using ordinary plasmids offer little or no control regarding copy number and often result in complex arrays of DNA molecules tandemly integrated into the same genomic location.
- the term “about” or “approximately” may mean within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” may mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” may mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term may mean within an order of magnitude, within 5 -fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term "about” meaning within an acceptable error range for the particular value should be assumed.
- exogenous nucleic acid is configured for stable integration in the genome of a cell, such as a myeloid cell.
- the stable integration of the exogenous nucleic acid may be at specific targets within the genome.
- the exogenous nucleic acid comprises one or more coding sequences.
- the exogenous nucleic acid may comprise one or more coding comprising a nucleic acid sequence encoding an immune receptor.
- the present disclosure provides methods and compositions for a stable incorporation of a nucleic acid encoding a transmembrane receptor implicated in an immune response function (e.g. a phagocytic receptor or synthetic chimeric antigen receptor) into human macrophage or dendritic cell or a suitable myeloid cell or a myeloid precursor cell.
- An exogenous nucleic acid can refer to a nucleic acid that was not originally in a cell and is added from outside the cell, irrespective of whether it comprises a sequence that may already be present in the cell endogenously.
- An exogenous nucleic acid may be a DNA or an RNA molecule.
- An exogenous nucleic acid may comprise a sequence encoding a transgene.
- An exogenous nucleic acid may encode a recombinant protein, such as a recombinant receptor, or a chimeric antigen receptor (CAR).
- An exogenous nucleic acid may be referred to as a "genetic cargo" in the context of the exogenous nucleic acid being delivered inside a cell.
- the genetic cargo may be a DNA or an RNA.
- Genetic material can generally be delivered inside a cell ex vivo by a few different known techniques using either chemical (CaCT- medicated transfection), or physical (electroporation), or biological (e.g. viral infection or transduction) means.
- plasmid refers to a non-viral expression vector, e.g., a nucleic acid molecule that encodes for genes and/or regulatory elements necessary for the expression of genes.
- a "viral vector,” as used herein, refers to a viral-derived nucleic acid that is capable of transporting another nucleic acid into a cell.
- a viral vector is capable of directing expression of a protein or proteins encoded by one or more genes carried by the vector when it is present in the appropriate environment. Examples for viral vectors include, but are not limited to retroviral, adenoviral, lentiviral and adeno-associated viral vectors.
- RNA is mRNA.
- one or more mRNA comprising one or more nucleic acid sequences are delivered.
- the one or more mRNA may comprise at least one modified nucleotide.
- nucleotide refers to a base-sugar-phosphate combination.
- a nucleotide may comprise a synthetic nucleotide.
- a nucleotide may comprise a synthetic nucleotide analog.
- Nucleotides may be monomeric units of a nucleic acid sequence (e.g. deoxyribonucleic acid (DNA) and ribonucleic acid (RNA)).
- the term nucleotide may include ribonucleoside triphosphates adenosine triphosphate (ATP), uridine triphosphate (UTP), cytosine triphosphate (CTP), guanosine triphosphate (GTP) and deoxyribonucleoside triphosphates such as dATP, dCTP, dITP, dUTP, dGTP, or derivatives thereof.
- nucleotide may refer to dideoxyribonucleoside triphosphates (ddNTPs) and their derivatives.
- ddNTPs dideoxyribonucleoside triphosphates
- Illustrative examples of dideoxyribonucleoside triphosphates may include, but are not limited to, ddATP, ddCTP, ddGTP, ddITP, and ddTTP.
- a nucleotide may be unlabeled or detectably labeled by well-known techniques.
- Detectable labels may include, for example, radioactive isotopes, fluorescent labels, chemiluminescent labels, bioluminescent labels and enzyme labels.
- Fluorescent labels of nucleotides may include but are not limited fluorescein, 5-carboxyfluorescein (FAM), 2'7'-dimethoxy-4'5-dichloro-6-carboxyfluorescein (JOE), rhodamine, 6-carboxyrhodamine (R6G), N,N,NcN-tetramethyl-6-carboxyrhodamine (TAMRA), 6-carboxy- X-rhodamine (ROX), 4-(4'dimethylaminophenylazo) benzoic acid (DABCYL), Cascade Blue, Oregon Green, Texas Red, Cyanine and 5-(2'-aminoethyl)aminonaphthalene-l-sulfonic acid (EDANS).
- fluorescently labeled nucleotides may include [R6G]dUTP, [TAMRA]dUTP, [R110]dCTP, [R6G]dCTP, [TAMRA] dCTP, [JOE]ddATP, [R6G] ddATP, [FAM] ddCTP, [R110]ddCTP, [T AN 1 RA] ddGTP, [ROX] ddTTP, [dR6G] ddATP, [dRl 10]ddCTP, [dTAMRA] ddGTP, and [dROX]ddTTP available from Perkin Elmer, Foster City, Calif.
- Nucleotides may also be labeled or marked by chemical modification.
- a chemically-modified single nucleotide can be biotin-dNTP.
- biotinylated dNTPs can include, biotin-dATP (e.g., bio-N6-ddATP, biotin- 14-dATP), biotin-dCTP (e.g., biotin- 11-cICTP, biotin- 14- dCTP), and biotin-dUTP (e.g. biotin- 11-dUTP, biotin- 1.6-dUTP, biotin-20-dUTP).
- biotin-dATP e.g., bio-N6-ddATP, biotin- 14-dATP
- biotin-dCTP e.g., biotin- 11-cICTP, biotin- 14- dCTP
- biotin-dUTP e.g. biotin- 11-dUTP, biotin- 1.6-dUTP, biotin-20-dUTP.
- polynucleotide oligonucleotide
- nucleic acid refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof, either in single-, double-, or multi-stranded form.
- a polynucleotide may be exogenous or endogenous to a cell.
- a polynucleotide may exist in a cell-free environment.
- a polynucleotide may be a gene or fragment thereof.
- a polynucleotide may be DNA.
- a polynucleotide may be RNA.
- a polynucleotide may have any three-dimensional structure, and may perform any function, known or unknown.
- a polynucleotide may comprise one or more analogs (e.g. altered backbone, sugar, or nucleobase). If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
- modified nucleotides or analogs include: pseudouridine, 5-bromouracil, 5- methylcytosine, peptide nucleic acid, xeno nucleic acid, morpholinos, locked nucleic acids, glycol nucleic acids, threose nucleic acids, dideoxynucleotides, cordycepin, 7-deaza-GTP, florophores (e.g.
- thiol containing nucleotides thiol containing nucleotides, biotin linked nucleotides, fluorescent base analogs, CpG islands, methyl-7-guanosine, methylated nucleotides, inosine, thiouridine, pseudourdine, dihydrouridine, queuosine, and wyosine.
- Non-limiting examples of polynucleotides include coding or non coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA (tRNA), ribosomal RNA (rRNA), short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, eDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, cell-free polynucleotides including cell-free DNA (cfDNA) and cell-free RNA (cfRNA), nucleic acid probes, and primers.
- loci locus
- locus defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA (tRNA), ribosomal RNA (rRNA), short interfering
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- the nucleic acid composition may comprise one or more mRNA, comprising at least one mRNA encoding a transmembrane receptor implicated in an immune response function (e.g. a phagocytic receptor or synthetic chimeric antigen receptor) into human macrophage or dendritic cell or a suitable myeloid cell or a myeloid precursor cell.
- the nucleic acid composition comprises one or more mRNA, and one or more lipids for delivery of the nucleic acid into a cell of hematopoietic origin, such as a myeloid cell or a myeloid cell precursor cell.
- the one or more lipids may form a liposomal complex.
- composition described herein may be used for delivery inside a cell.
- a cell may originate from any organism having one or more cells. Some non-limiting examples include: a prokaryotic cell, eukaryotic cell, a bacterial cell, an archaeal cell, a cell of a single-cell eukaryotic organism, a protozoa cell, a cell from a plant (e.g.
- algal cells from plant crops, fruits, vegetables, grains, soy bean, com, maize, wheat, seeds, tomatoes, rice, cassava, sugarcane, pumpkin, hay, potatoes, cotton, cannabis, tobacco, flowering plants, conifers, gymnosperms, ferns, clubmosses, homworts, liverworts, mosses), an algal cell, (e.g., Botryococcus braunii, Chlamydomonas reinhardtii, Nannochloropsis gaditana, Chlorella pyrenoidosa, Sargassum patens C. Agardh, and the like), seaweeds (e.g., Botryococcus braunii, Chlamydomonas reinhardtii, Nannochloropsis gaditana, Chlorella pyrenoidosa, Sargassum patens C. Agardh, and the like), seaweeds (e.g.
- a fungal cell e.g., a yeast cell, a cell from a mushroom
- an animal cell e.g. fruit fly, cnidarian, echinoderm, nematode, etc.
- a cell from a vertebrate animal e.g., fish, amphibian, reptile, bird, mammal
- a cell from a mammal e.g., a pig, a cow, a goat, a sheep, a rodent, a rat, a mouse, a non-human primate, a human, etc.
- a cell may not be originating from a natural organism (e.g.
- a cell may be a synthetically made, sometimes termed an artificial cell).
- the cell referred to herein is a mammalian cell.
- the cell is a human cell.
- the methods and compositions described herein relates to incorporating a genetic material in a cell, more specifically a human cell, wherein the human cell can be any human cell.
- a human cell may be of any origin, for example, a somatic cell, a neuron, a fibroblast, a muscle cell, an epithelial cell, a cardiac cell, or a hematopoietic cell.
- the methods and compositions described herein can also be applicable to and useful for incorporating exogenous nucleic acid in hard-to-transfect human cell.
- compositions are simple and universally applicable, once a suitable exogenous nucleic acid construct has been designed and developed.
- the methods and compositions described herein are applicable to incorporate an exogenous nucleic acid in a cell ex vivo.
- the compositions may be applicable for systemic administration in an organism, where the nucleic acid material in the composition may be taken up by a cell in vivo, whereupon it is incorporated in cell in vivo.
- the methods and compositions described herein may be directed to incorporating an exogenous nucleic acid in a human hematopoietic cell, for example, a human cell of hematopoietic origin, such as a human myeloid cell or a myeloid cell precursor.
- a human cell of hematopoietic origin such as a human myeloid cell or a myeloid cell precursor.
- the methods and compositions described herein can be used or made suitable for use in any biological cell with minimum modifications. Therefore, a cell as may refer to any cell that is a basic structural, functional and/or biological unit of a living organism.
- nucleic acid composition may comprise one or more nucleic sequences, such as a gene, where the gene is a transgene.
- genomic DNA refers to a nucleic acid (e.g., DNA such as genomic DNA and cDNA) and its corresponding nucleotide sequence that is involved in encoding an RNA transcript.
- genomic DNA includes intervening, non-coding regions as well as regulatory regions and may include 5' and 3' ends.
- the term encompasses the transcribed sequences, including 5' and 3' untranslated regions (5'-UTR and 3'-UTR), exons and introns.
- the transcribed region will contain "open reading frames" that encode polypeptides.
- a “gene” comprises only the coding sequences (e.g., an "open reading frame” or "coding region") necessary for encoding a polypeptide.
- genes do not encode a polypeptide, for example, ribosomal RNA genes (rRNA) and transfer RNA (tRNA) genes.
- rRNA ribosomal RNA genes
- tRNA transfer RNA
- the term “gene” includes not only the transcribed sequences, but in addition, also includes non-transcribed regions including upstream and downstream regulatory regions, enhancers and promoters.
- a gene may refer to an "endogenous gene” or a native gene in its natural location in the genome of an organism.
- a gene may refer to an "exogenous gene” or a non-native gene.
- a non-native gene may refer to a gene not normally found in the host organism, but which is introduced into the host organism by gene transfer.
- a non-native gene may also refer to a gene not in its natural location in the genome of an organism.
- a non-native gene may also refer to a naturally occurring nucleic acid or polypeptide sequence that comprises mutations, insertions and/or deletions (e.g., non-native sequence).
- transgene refers to any nucleic acid molecule that is introduced into a cell, that may be intermittently termed herein as a recipient cell.
- the resultant cell after receiving a transgene may be referred to a transgenic cell.
- a transgene may include a gene that is partly or entirely heterologous (i.e., foreign) to the transgenic organism or cell, or may represent a gene homologous to an endogenous gene of the organism or cell.
- transgenes include any polynucleotide, such as a gene that encodes a polypeptide or protein, a polynucleotide that is transcribed into an inhibitory polynucleotide, or a polynucleotide that is not transcribed (e.g., lacks an expression control element, such as a promoter that drives transcription).
- Transcripts and encoded polypeptides may be collectively referred to as "gene product.” If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.
- Up-regulated refers to an increased expression level of a polynucleotide (e.g., RNA such as mRNA) and/or polypeptide sequence relative to its expression level in a wild-type state while “down-regulated” refers to a decreased expression level of a polynucleotide (e.g., RNA such as mRNA) and/or polypeptide sequence relative to its expression in a wild-type state.
- RNA e.g., RNA such as mRNA
- Expression of a transfected gene may occur transiently or stably in a cell. During “transient expression” the transfected gene is not transferred to the daughter cell during cell division. Since its expression is restricted to the transfected cell, expression of the gene is lost over time.
- transfected gene in contrast, stable expression of a transfected gene may occur when the gene is co-transfected with another gene that confers a selection advantage to the transfected cell.
- a selection advantage may be a resistance towards a certain toxin that is presented to the cell.
- the application envisages the use of codon-optimized sequences.
- An example of a codon optimized sequence may be a sequence optimized for expression in a eukaryote, e.g., humans (i.e. being optimized for expression in humans), or for another eukaryote, animal or mammal. Codon optimization for a host species other than human, or for codon optimization for specific organs is known.
- the coding sequence encoding a protein may be codon optimized for expression in particular cells, such as eukaryotic cells.
- the eukaryotic cells may be those of or derived from a particular organism, such as a plant or a mammal, including but not limited to human, or non-human eukaryote or animal or mammal as herein discussed, e.g., mouse, rat, rabbit, dog, livestock, or non-human mammal or primate.
- Codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g., about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence.
- codons e.g., about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons
- Codon bias differs in codon usage between organisms
- mRNA messenger RNA
- tRNA transfer RNA
- the predominance of selected tRNAs in a cell may generally reflect the codons used most frequently in peptide synthesis. Accordingly, genes may be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the "Codon Usage Database" available at www.kazusa.orjp/codon/ and these tables may be adapted in a number of ways. Computer algorithms for codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, PA), are also available.
- a “multicistronic transcript” as used herein refers to an mRNA molecule that contains more than one protein coding region, or cistron.
- a mRNA comprising two coding regions is denoted a "bicistronic transcript.”
- the "5 '-proximal" coding region or cistron is the coding region whose translation initiation codon (usually AUG) is closest to the 5' end of a multicistronic mRNA molecule.
- a “5 '-distal" coding region or cistron is one whose translation initiation codon (usually AUG) is not the closest initiation codon to the 5' end of the mRNA.
- transfection refers to introduction of a nucleic acid into a cell by non- viral or viral-based methods.
- the nucleic acid molecules may be gene sequences encoding complete proteins or functional portions thereof. See, e.g., Sambrook et al., 1989, Molecular Cloning: A Laboratory Manual, 18.1-18.88.
- promoter refers to a polynucleotide sequence capable of driving transcription of a coding sequence in a cell.
- promoters used in the polynucleotide constructs of the disclosure include cis-acting transcriptional control elements and regulatory sequences that are involved in regulating or modulating the timing and/or rate of transcription of a gene.
- a promoter may be a cis-acting transcriptional control element, including an enhancer, a promoter, a transcription terminator, an origin of replication, a chromosomal integration sequence, 5' and 3' untranslated regions, or an intronic sequence, which are involved in transcriptional regulation.
- a "constitutive promoter” is one that is capable of initiating transcription in nearly all tissue types, whereas a “tissue-specific promoter” initiates transcription only in one or a few particular tissue types.
- An “inducible promoter” is one that initiates transcription only under particular environmental conditions, developmental conditions, or drug or chemical conditions. Exemplary inducible promoter may be a doxycycline or a tetracycline inducible promoter.
- Tetracycline regulated promoters may be both tetracycline inducible or tetracycline repressible, called the tet-on and tet-off systems.
- the tet regulated systems rely on two components, i.e., a tetracycline-controlled regulator (also referred to as transactivator) (tTA or rtTA) and a tTA/rtTA-dependent promoter that controls expression of a downstream cDNA, in a tetracycline-dependent manner.
- tTA is a fusion protein containing the repressor of the TnlO tetracycline-resistance operon of Escherichia coli and a carboxyl-terminal portion of protein 16 of herpes simplex virus (VP16).
- the tTA- dependent promoter consists of a minimal RNA polymerase II promoter fused to tet operator (tetO) sequences (an array of seven cognate operator sequences). This fusion converts the tet repressor into a strong transcriptional activator in eukaryotic cells.
- tTA In the absence of tetracycline or its derivatives (such as doxycycline), tTA binds to the tetO sequences, allowing transcriptional activation of the tTA-dependent promoter. However, in the presence of doxycycline, tTA cannot interact with its target and transcription does not occur.
- the tet system that uses tTA is termed /e -OFF, because tetracycline or doxycycline allows transcriptional down-regulation.
- rtTA a mutant form of tTA, termed rtTA, has been isolated using random mutagenesis.
- rtTA is not functional in the absence of doxycycline but requires the presence of the ligand for transactivation.
- exon refers to a nucleic acid sequence found in genomic DNA that is bioinformatically predicted and/or experimentally confirmed to contribute contiguous sequence to a mature mRNA transcript.
- intron refers to a sequence present in genomic DNA that is bioinformatically predicted and/or experimentally confirmed to not encode part of or all of an expressed protein, and which, in endogenous conditions, is transcribed into RNA (e.g. pre-mRNA) molecules, but which is spliced out of the endogenous RNA (e.g. the pre-mRNA) before the RNA is translated into a protein.
- RNA e.g. pre-mRNA
- splice acceptor site refers to a sequence present in genomic DNA that is bioinformatically predicted and/or experimentally confirmed to be the acceptor site during splicing of pre- mRNA, which may include identified and unidentified natural and artificially derived or derivable splice acceptor sites.
- IRES internal ribosome entry site
- mRNA messenger RNA
- IRESs are commonly located in the 5' UTR of positive-stranded RNA viruses with uncapped genomes.
- Another means to express 2 proteins from a single mRNA molecule is by insertion of a 2A peptide(-like) sequence in between their coding sequence.
- 2A peptide(-like) sequences mediate self-processing of primary translation products by a process variously referred to as “ribosome skipping", “stop-go” translation and “stop carry-on” translation.
- 2A peptide(-like) sequences are present in various groups of positive- and double-stranded RNA viruses including Picomaviridae, Flaviviridae, Tetraviridae, Dicistroviridae, Reoviridae and Totiviridae.
- the term "2A peptide” refers to a class of 18-22 amino-acid (AA)-long viral oligopeptides that mediate "cleavage” of polypeptides during translation in eukaryotic cells.
- the designation "2A” refers to a specific region of the viral genome and different viral 2As have generally been named after the virus they were derived from. The first discovered 2A was F2A (foot-and-mouth disease virus), after which E2A (equine rhinitis A virus), P2A (porcine tescho virus- 1 2 A), and T2A (thosea asigna virus 2 A) were also identified.
- 2A-mediated "self-cleavage” is believed to be ribosome skipping the formation of a glycyl-prolyl peptide bond at the C-terminus of the 2A sequence.
- 2A peptide(-like) sequences mediate self-processing of primary translation products by a process variously referred to as “ribosome skipping", "stop-go” translation and "stop carry-on” translation.
- 2A peptide(-like) sequences are present in various groups of positive- and double-stranded RNA viruses including Picomaviridae, Flaviviridae, Tetraviridae, Dicistroviridae, Reoviridae and Totiviridae.
- operably linked refers to a functional relationship between two or more segments, such as nucleic acid segments or polypeptide segments. Typically, it refers to the functional relationship of a transcriptional regulatory sequence to a transcribed sequence.
- termination sequence refers to a nucleic acid sequence which is recognized by the polymerase of a host cell and results in the termination of transcription.
- the termination sequence is a sequence of DNA that, at the 3' end of a natural or synthetic gene, provides for termination of mRNA transcription or both mRNA transcription and ribosomal translation of an upstream open reading frame.
- Prokaryotic termination sequences commonly comprise a GC-rich region that has a two-fold symmetry followed by an AT-rich sequence.
- a commonly used termination sequence is the T7 termination sequence.
- termination sequences are known in the art and may be employed in the nucleic acid constructs of the present invention, including the TINT3, TL13, TL2, TR1, TR2, and T6S termination signals derived from the bacteriophage lambda, and termination signals derived from bacterial genes, such as the trp gene of E. coli.
- polyadenylation sequence (also referred to as a "poly A site” or “poly A sequence”) refers to a DNA sequence which directs both the termination and polyadenylation of the nascent RNA transcript. Efficient polyadenylation of the recombinant transcript is desirable, as transcripts lacking a poly A tail are typically unstable and rapidly degraded.
- the poly A signal utilized in an expression vector may be "heterologous” or "endogenous". An endogenous poly A signal is one that is found naturally at the 3' end of the coding region of a given gene in the genome.
- a heterologous poly A signal is one which is isolated from one gene and placed 3' of another gene, e.g., coding sequence for a protein.
- a commonly used heterologous poly A signal is the SV40 poly A signal.
- the SV40 poly A signal is contained on a 237 bp BamFE/BclI restriction fragment and directs both termination and polyadenylation; numerous vectors contain the SV40 poly A signal.
- Another commonly used heterologous poly A signal is derived from the bovine growth hormone (BGH) gene; the BGH poly A signal is also available on a number of commercially available vectors.
- BGH bovine growth hormone
- the poly A signal from the Herpes simplex virus thymidine kinase (HSV tk) gene is also used as a poly A signal on a number of commercial expression vectors.
- the polyadenylation signal facilitates the transportation of the RNA from within the cell nucleus into the cytosol as well as increases cellular half-life of such an RNA.
- the polyadenylation signal is present at the 3 ’-end of an mRNA.
- complement refers to a sequence that is complementary to and hybridizable to the given sequence.
- a sequence hybridized with a given nucleic acid is referred to as the "complement” or “reverse-complement” of the given molecule if its sequence of bases over a given region is capable of complementarity binding those of its binding partner, such that, for example, A-T, A-U, G-C, and G-U base pairs are formed.
- a first sequence that is hybridizable to a second sequence is specifically or selectively hybridizable to the second sequence, such that hybridization to the second sequence or set of second sequences is preferred (e.g. thermodynamically more stable under a given set of conditions, such as stringent conditions commonly used in the art) to hybridization with non-target sequences during a hybridization reaction.
- hybridizable sequences share a degree of sequence complementarity over all or a portion of their respective lengths, such as between 25%-100% complementarity, including at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and 100% sequence complementarity.
- Sequence identity such as for the purpose of assessing percent complementarity, may be measured by any suitable alignment algorithm, including but not limited to the Needleman-Wunsch algorithm (see e.g.
- the EMBOSS Needle aligner available at www.ebi.ac.uk/Tools/psa/embossneedle/nucleotide.html
- the BLAST algorithm see e.g. the BLAST alignment tool available at blast.ncbi.nlm.nih.gov/Blast.cgi, optionally with default settings
- the Smith-Waterman algorithm see e.g. the EMBOSS Water aligner available at www.ebi.ac. ukaools/psa/emboss_water/nucleotide.html, optionally with default settings.
- Optimal alignment can be assessed using any suitable parameters of a chosen algorithm, including default parameters.
- Complementarity may be perfect or substantial/sufficient. Perfect complementarity between two nucleic acids may mean that the two nucleic acids may form a duplex in which every base in the duplex is bonded to a complementary base by Watson-Crick pairing. Substantial or sufficient complementary may mean that, a sequence in one strand is not completely and/or perfectly complementary to a sequence in an opposing strand, but that sufficient bonding occurs between bases on the two strands to form a stable hybrid complex in set of hybridization conditions (e.g., salt concentration and temperature). Such conditions may be predicted by using the sequences and standard mathematical calculations to predict the melting temperature (T m ) of hybridized strands, or by empirical determination of T m by using routine methods.
- T m melting temperature
- Transposons as used herein are segments within the chromosome that can translocate within the genome, also known as "jumping gene”. There are two different classes of transposons: class 1, or retrotransposons, that mobilize via an RNA intermediate and a “copy-and-paste” mechanism, and class II, or DNA transposons, that mobilize via excision integration, or a "cut-and-paste” mechanism (Ivies Nat Methods 2009). Bacterial, lower eukaryotic (e.g. yeast) and invertebrate transposons appear to be largely species specific, and cannot be used for efficient transposition of DNA in vertebrate cells.
- Sleeping Beauty (Ivies Cell 1997), was the first active transposon that was artificially reconstructed by sequence shuffling of inactive TEs from fish. This made it possible to successfully achieve DNA integration by transposition into vertebrate cells, including human cells. Sleeping Beauty is a class P DNA transposon belonging to the Tcl/mariner family of transposons (Ni Genomics Proteomics 2008). In the meantime, additional functional transposons have been identified or reconstructed from different species, including Drosophila, frog and even human genomes, that all have been shown to allow DNA transposition into vertebrate and also human host cell genomes. Each of these transposons have advantages and disadvantages that are related to transposition efficiency, stability of expression, genetic payload capacity etc.
- Exemplary class II transposases that have been created include Sleeping Beauty, PiggyBac, Frog Prince, Himarl, Passport, Minos, hAT, Toll, Tol2, AciDs, PIF, Harbinger, Harbinger3- DR, and Hsmarl.
- Heterologous includes molecules such as DNA and RNA which may not naturally be found in the cell into which it is inserted.
- DNA when mouse or bacterial DNA is inserted into the genome of a human cell, such DNA is referred to herein as heterologous DNA.
- the term "homologous” as used herein denotes molecules such as DNA and RNA that are found naturally in the cell into which it is inserted.
- the insertion of mouse DNA into the genome of a mouse cell constitutes insertion of homologous DNA into that cell.
- homologous DNA it is not necessary that the homologous DNA be inserted into a site in the cell genome in which it is naturally found; rather, homologous DNA may be inserted at sites other than where it is naturally found, thereby creating a genetic alteration (a mutation) in the inserted site.
- a "transposase” is an enzyme that is capable of forming a functional complex with a transposon end-containing composition (e.g., transposons, transposon ends), and catalyze insertion or transposition of the transposon end-containing composition into double stranded DNA which is incubated with an in vitro transposon reaction.
- transposon end means a double-stranded DNA that contains the nucleotide sequences (the “transposon end sequences”) necessary to form the complex with the transposase or integrase enzyme that is functional in an in vitro transposition reaction.
- a transposon end forms a complex or a synaptic complex or a transposon complex or a transposon composition with a transposase or integrase that recognizes and binds to the transposon end, and which complex is capable of inserting or transposing the transposon end into target DNA with which it is incubated in an in vitro transposition reaction.
- a transposon end exhibits two complementary sequences consisting of a transferred transposon end sequence or transferred strand and a non-transferred transposon end sequence, or non-transferred strand
- one transposon end that forms a complex with a hyperactive Tn5 transposase that is active in an in vitro transposition reaction comprises a transferred strand that exhibits a transferred transposon end sequence as follows: 5' AGATGTGTATAAGAGACAG 3', and a non-transferred strand that exhibits a "non-transferred transposon end sequence" as follows: (5' CTGTCTCTTATACACATCT 3
- the 3'-end of a transferred strand is joined or transferred to target DNA in an in vitro transposition reaction.
- the non-transferred strand, which exhibits a transposon end sequence that is complementary to the transferred transposon end sequence is not joined or transferred to the target DNA in an in vitro transposition reaction.
- the transferred strand and non-transferred strand are covalently joined.
- the transferred and non-transferred strand sequences are provided on a single oligonucleotide, e.g., in a hairpin configuration.
- the non-transferred strand becomes attached to the DNA fragment indirectly, because the non-transferred strand is linked to the transferred strand by the loop of the hairpin structure.
- an "cleavage domain" refers to a nucleic acid sequence that is susceptible
- a "restriction site domain” means a tag domain that exhibits a sequence for the purpose of facilitating cleavage using a restriction endonuclease.
- the restriction site domain is used to generate di-tagged linear ssDNA fragments.
- the restriction site domain is used to generate a compatible double-stranded 5'-end in the tag domain so that this end can be ligated to another DNA molecule using a template-dependent DNA ligase.
- the restriction site domain in the tag exhibits the sequence of a restriction site that is present only rarely, if at all, in the target DNA (e.g., a restriction site for a rare-cutting restriction endonuclease such as Notl or Ascl).
- recombinant nucleic acid molecule refers to a recombinant DNA molecule or a recombinant RNA molecule.
- a recombinant nucleic acid molecule is any nucleic acid molecule containing joined nucleic acid molecules from different original sources and not naturally attached together.
- Recombinant RNA molecules include RNA molecules transcribed from recombinant DNA molecules.
- a recombinant nucleic acid may be synthesized in the laboratory.
- a recombinant nucleic acid can be prepared by using recombinant DNA technology by using enzymatic modification of DNA, such as enzymatic restriction digestion, ligation, and DNA cloning.
- a recombinant DNA may be transcribed in vitro, to generate a messenger RNA (mRNA), the recombinant mRNA may be isolated, purified and used to transfect a cell.
- a recombinant nucleic acid may encode a protein or a polypeptide.
- a recombinant nucleic acid under suitable conditions, can be incorporated into a living cell, and can be expressed inside the living cell.
- expression of a nucleic acid usually refers to transcription and/or translation of the nucleic acid.
- the product of a nucleic acid expression is usually a protein but can also be an mRNA.
- Detection of an mRNA encoded by a recombinant nucleic acid in a cell that has incorporated the recombinant nucleic acid is considered positive proof that the nucleic acid is "expressed" in the cell.
- the process of inserting or incorporating a nucleic acid into a cell can be via transformation, transfection or transduction. Transformation is the process of uptake of foreign nucleic acid by a bacterial cell. This process is adapted for propagation of plasmid DNA, protein production, and other applications. Transformation introduces recombinant plasmid DNA into competent bacterial cells that take up extracellular DNA from the environment. Some bacterial species are naturally competent under certain environmental conditions, but competence is artificially induced in a laboratory setting.
- Transfection is the forced introduction of small molecules such as DNA, RNA, or antibodies into eukaryotic cells. Just to make life confusing, ‘transfection’ also refers to the introduction of bacteriophage into bacterial cells. ‘Transduction’ is mostly used to describe the introduction of recombinant viral vector particles into target cells, while ‘infection’ refers to natural infections of humans or animals with wild-type viruses.
- a "stem-loop" sequence refers to a nucleic acid sequence (e.g., RNA sequence) with sufficient self-complementarity to hybridize and form a stem and the regions of non-complementarity that bulges into a loop.
- the stem may comprise mismatches or bulges.
- vector refers to a nucleic acid molecule capable of transporting or mediating expression of a heterologous nucleic acid.
- a "vector sequence” as used herein, refers to a sequence of nucleic acid comprising at least one origin of replication and at least one selectable marker gene.
- Vectors capable of directing the expression of genes and/or nucleic acid sequence to which they are operatively linked are referred to herein as "expression vectors”.
- a plasmid is a species of the genus encompassed by the term "vector.”
- expression vectors of utility are often in the form of "plasmids” which refer to circular double stranded DNA molecules which, in their vector form are not bound to the chromosome, and typically comprise entities for stable or transient expression of the encoded DNA.
- Other expression vectors that can be used in the methods as disclosed herein include, but are not limited to plasmids, episomes, bacterial artificial chromosomes, yeast artificial chromosomes, bacteriophages or viral vectors, and such vectors can integrate into the host's genome or replicate autonomously in the cell.
- a vector can be a DNA or RNA vector.
- a safe harbor locus is a region within the genome where additional exogenous or heterologous nucleic acid sequence can be inserted, and the host genome is able to accommodate the inserted genetic material.
- Exemplary safe harbor sites include but are not limited to: AAVS1 site, GGTA1 site, CMAH site, B4GALNT2 site, B2M site, ROSA26 site, COLA1 site, and TIGRE site.
- the heterologous nucleic acid described in this disclosure may be integrated at one or more sites in the genome of the cell, wherein the one or more locations is selected from the group consisting of: AAVS1 site, GGTA1 site, CMAH site, B4GALNT2 site, B2M site, ROSA26 site, C0LA1 site, and TIGRE site.
- the nucleic acid cargo comprising the transgene may be delivered to a R2D locus.
- the nucleic acid cargo comprising the transgene may be delivered to the genome in an intergenic or intragenic region.
- the nucleic acid cargo comprising the transgene is integrated into the genome 5' or 3' within 0.1 kb, 0.25 kb, 0.5 kb, 0.75, kb, 1 kb, 2 kb, 3 kb, 4 kb, 5 kb, 7.5 kb, 10 kb, 15 kb, 20 kb, 25 kb, 50, 75 kb, or 100 kb of an endogenous active gene.
- the nucleic acid cargo comprising the transgene is integrated into the genome 5' or 3' within 0.1 kb, 0.25 kb, 0.5 kb, 0.75, kb, 1 kb, 2 kb, 3 kb, 4 kb, 5 kb, 7.5 kb, 10 kb, 15 kb, 20 kb, 25 kb, 50, 75 kb, or 100 kb of an endogenous promoter or enhancer.
- the nucleic acid cargo comprising the transgene is 50-50,000 base pairs, e.g., between 50-40,000 bp, between 500-30,000 bp between 500- 20,000 bp, between 100-15,000 bp, between 500-10,000 bp, between 50-10,000 bp, between 50-5,000 bp. In some embodiments the nucleic acid cargo comprising the transgene is less than 1,000, 1,300, 1500, 2,000, 3,000, 4,000, 5,000, or 7,500 nucleotides in length.
- Retrotransposons can contain transposable elements that are active participants in reorganizing their resident genomes. Broadly, retrotransposons can refer to DNA sequences that are transcribed into RNA and translated into protein and have the ability to reverse-transcribe themselves back into DNA. Approximately 45% of the human genome is comprised of sequences that result from transposition events. Retrotransposition occasionally generates target site deletions or adds non-retrotransposon DNA to the genome by processes termed 5'- and 3 '-transduction. Recombination between non-homologous retrotransposons causes deletions, duplications or rearrangements of gene sequence. Ongoing retrotransposition can generate novel splice sites, polyadenylation signals and promoters, and so builds new transcription modules.
- retrotransposons may be grouped into two classes, the retrovirus-like LTR retrotransposons, and the non-LTR elements such as human LI elements, Neurospora TAD elements (Kinsey, 1990, Genetics 126:317-326), I factors from Drosophila (Bucheton et al, 1984, Cell 38:153-163), and R2Bm from Bombyx mori (Luan et al, 1993, Cell 72: 595-605). These two types of retrotransposons are structurally different and also retrotranspose using radically different mechanisms. Exemplary, non- limiting examples of LINE-encoded polypeptides are found in GenBank Accession Nos.
- LINE-1 or L1- elements are autonomous as they encode all of the machinery alone to complete this reverse transcription and integration process;
- LI elements are abundant in the human genome, such that these elements may be considered as a naturalized element of the genome;
- LI retrotransposon retrotransposes its own mRNA with high degree of specificity, compared to other mRNAs floating around in the cells.
- the LI expresses a 6-kb bicistronic RNA that encodes the 40 kDa Open Reading Frame-1 RNA- binding protein (ORFlp) of essential but uncertain function, and a 150 kDa ORF2 protein with endonuclease and reverse transcriptase (RT) activities.
- LI retrotransposition is a complex process involving transcription of the LI, transport of its RNA to the cytoplasm, translation of the bicistronic RNA, formation of a ribonucleoprotein (RNP) particle, its re-import to the nucleus and target-primed reverse transcription at the integration site.
- RNP ribonucleoprotein
- LI RNA forms an RNP in cis with the proteins that are translated from the transcript.
- LI integrates into genomic DNA by target-site primer reverse transcription (TPRT) by ORF2p cleavage at the 5’-TTTT-3’ where a poly A sequence of LI RNA anneals and primes reverse transcriptase (RT) activity to make LI cDNA.
- TPRT target-site primer reverse transcription
- RT reverse transcriptase
- Alu elements are such mobile DNA elements that belong to the class of short interspersed elements (SINEs) that are non-autonomous retrotransposons and acquire trans-factors to integrate.
- SINEs short interspersed elements
- Alu elements and SINE-1 elements can associate with the LI ribonucleoproteins in trans to be also retrotransposed by ORFlp and ORF2p.
- ORFlp and ORF2p Somewhat similar to the LI RNA, the Alu element ends with a long A-run, often referred to as the A-tail, and it also has a smaller A-rich region (indicated by AA) separating the two halves of a diverged dimer structure.
- Alu elements are likely to have the internal components of an RNA polymerase III promoter (such as, commonly designated as an A box and a B box promoters), but they do not encode a terminator for RNA polymerase IP. They may utilize a stretch of T nucleotides at various distances downstream of the Alu element to terminate a transcription.
- a typical Alu transcript encompasses the entire Alu, including the A-tail, and has a 3' region that is unique for each locus.
- the Alu RNA folds into separate structures for each monomer unit. The RNA has been shown to bind the 7SL RNA SRP9 and 14 heterodimer, as well as poly A-binding protein (PABP).
- PABP poly A-binding protein
- the poly A tail of Alu primes with T rich (TTTT) region of the genome and attracts ORF2p to bind to the primed region and cleaves at the T rich region via its endonuclease activity.
- the T-rich region primes reverse transcription by ORF2p on the 3' A-tail region of the Alu element. This creates a cDNA copy of the body of the Alu element.
- a nick occurs by an unknown mechanism on the second strand and second-strand synthesis is primed.
- the new Alu element is then flanked by short direct repeats that are duplicates of the DNA sequence between the first and second nicks.
- Alu elements are extremely prevalent within RNA molecules, owing to their preference for gene-rich regions.
- a full-length Alu ( ⁇ 300 bp) is derived from the signal recognition particle RNA 7SL and consists of two similar monomers with an A-rich linker in-between, A- and B-boxes present in the 5' monomer, and a poly-A tail lacking the preceding polyadenylation signal resulting in an elongated tail (up to 100 bp in length).
- Alus can be transcribed by RNA polymerase III using the internal promoters within the A- and B-boxes; however, Alus contain no ORFs and therefore do not encode for protein products.
- SVAs and HERV-Ks.
- a full-length SVA (SINE-VNTR-A/M) element ( ⁇ 2-3 kb) is a composite unit that contains a CCCTCT repeat, two A/w-like sequences, a VNTR, a SINE-R region with env (envelope) gene, the 3' LTR of HERV-K10, and a polyadenylation signal followed by a poly-A tail. It is most likely that SVAs are transcribed by RNA polymerase II, although it is unknown whether SVA elements carry an internal promoter.
- a full-length HERV-K element ( ⁇ 9-10 kb) is comprised of ancient remnants of endogenous retroviral sequences and includes two flanking LTR regions surrounding three retroviral ORFs: (1) gag encoding the structural proteins of a retroviral capsid; (2) pol-pro encoding the enzymes: protease, RT, and integrase; and (3) env encoding proteins allowing for horizontal transfer.
- the LTR of HERV-K contains an internal, bidirectional promoter that appears to be under the transcriptional control of RNA polymerase II.
- LI retrotransposition and RNA binding can take place at or near poly-A tail.
- the 3’-UTR plays a role in the recognition of stringent-type LINE RNA of ORF1 protein (ORFlp).
- Stringent-type LINEs can contain a stem-loop structure located at the end of the 3'UTR. Branched molecules consisting of junctions between transposon 3 '-end cDNA and the target DNA, as well as specific positioning of LI RNA within ORF2 protein (ORF2p), were detected during initial stages of LI retrotransposition in vitro. Secondary or tertiary RNA structure shared by LI and Alu are likely to be responsible for recognition by and binding of ORF2, possibly along with a poly-A tail.
- the stem-loop structure located downstream of the poly-A sequence correlates with cleavage intensity.
- Non-homologous end-joining repair proteins such as XRCC1, Ku70 and DNA-PK, have been implicated in resolution of the LI integrate at the time of insertion.
- the cell has evolved a number of proteins that stand against unrestricted retrotransposition, including the APOBEC3 family of cytosine deaminases, adenosine deaminase ADAR1, chromatin-remodeling factors and members of the piRNA pathway for post-transcription gene silencing that functions in the male germ line.
- compositions comprising nucleic acid constructs and methods involved for stable expression of encoded protein
- a recombinant nucleic acid encoding one or more proteins for expression in a cell, such as a myeloid cell.
- the recombinant nucleic acid is designed for stable expression of the one or more proteins or polypeptides encoded by the recombinant nucleic acid.
- the stable expression is achieved by incorporation of recombinant nucleic acid within the genome of the cell.
- compositions and methods described herein can be utilized to design products in which the recombinant nucleic acid may comprise one or more sequences that do not translate as a protein or a polypeptide component, but may encode an oligonucleotide that can be a regulatory nucleic acid, such as an inhibitor oligonucleotide product, such as an activator oligonucleotide.
- composition comprising a synthetic nucleic acid, comprising a nucleic acid sequence encoding a gene of interest and one or more retrotransposable elements to stably incorporate a non- endogenous nucleic acid into a cell.
- the cell is a hematopoietic cell.
- the cell is a myeloid cell.
- the cell is a precursor cell.
- the cell is undifferentiated.
- the cell has further differentiation potential.
- the cell is not a stem cell.
- the present disclosure may utilize a retrotransposable system to stably incorporate into the genome and express a non- endogenous nucleic acid, where the non-endogenous nucleic acid comprises retrotransposable elements within the nucleic acid sequence.
- the present disclosure may utilize a cell’s endogenous retrotransposable system (e.g., proteins and enzymes), to stably express a non-endogenous nucleic acid in the cell.
- the present disclosure may utilize a cell’s endogenous retrotransposable system (e.g., proteins and enzymes, such as a LINE1 retrotransposition system), but may further express one or more components of the retrotransposable system to stably express a non-endogenous nucleic acid in the cell.
- a cell s endogenous retrotransposable system (e.g., proteins and enzymes, such as a LINE1 retrotransposition system)
- a cell s endogenous retrotransposable system
- proteins and enzymes such as a LINE1 retrotransposition system
- a synthetic nucleic acid is provided herein, the synthetic nucleic acid encoding a transgene, and encoding one or more components for retrotransposition.
- the synthetic nucleic acid described herein is interchangeably termed as a nucleic acid construct, transgene or the exogenous nucleic acid.
- a method of integrating a nucleic acid sequence into a genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA into the cell, wherein the mRNA comprises: an insert sequence, wherein the insert sequence comprises an exogenous sequence, or a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence; wherein the 5’ UTR sequence or the 3 ’ UTR sequence comprises a binding site for a human ORF protein, and wherein the insert sequence is integrated into the genome of the cell.
- the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for human ORF2p.
- a method for integrating a nucleic acid sequence into the genome of an immune cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence, wherein the 5’ UTR sequence or the 3 ’ UTR sequence comprises an endonuclease binding site and/or a reverse transcriptase binding site, and wherein the transgene sequence is integrated into the genome of the immune cell.
- a method for integrating a nucleic acid sequence into the genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence, a sequence of a human retrotransposon downstream of the 5’ UTR sequence, and a 3’ UTR sequence downstream of the sequence of a human retrotransposon; wherein the 5 ’ UTR sequence or the 3 ’ UTR sequence comprises an endonuclease binding site and/or a reverse transcriptase binding site, and wherein the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs, and wherein the insert sequence is integrated into the genome of the cell.
- the 5 ’ UTR sequence or the 3 ’ UTR sequence comprises an ORF2p binding site.
- the ORF2p binding site is a poly A sequence in the 3' UTR sequence.
- the mRNA comprises a sequence of a human retrotransposon.
- the sequence of a human retrotransposon is downstream of the 5’ UTR sequence.
- the sequence of a human retrotransposon is upstream of the 3 ’ UTR sequence.
- the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs.
- the two ORFs are non overlapping ORFs.
- the two ORFs are ORF1 and ORF2.
- the ORF1 encodes ORFlp and ORF2 encodes ORF2p.
- the sequence of a human retrotransposon comprises a sequence of a non- LTR retrotransposon.
- the sequence of a human retrotransposon encodes comprises a LINE-1 retrotransposon.
- the LINE-1 retrotransposon is a human LINE-1 retrotransposon.
- the sequence of a human retrotransposon comprises a sequence encoding an endonuclease and/or a reverse transcriptase.
- the endonuclease and/or a reverse transcriptase is ORF2p.
- the reverse transcriptase is a group II intron reverse transcriptase domain.
- the endonuclease and/or a reverse transcriptase is a minke whale endonuclease and/or a reverse transcriptase.
- the sequence of a human retrotransposon comprises a sequence encoding ORF2p.
- the insert sequence is integrated into the genome at a poly T site using specificity of an endonuclease domain of the ORF2p.
- the poly T site comprises the sequence TTTTTA.
- the sequence of a human retrotransposon comprises a sequence encoding ORFlp
- the mRNA does not comprise a sequence encoding ORFlp
- the mRNA comprises a replacement of the sequence encoding ORFlp with a 5' UTR sequence from the complement gene.
- the mRNA comprises a first mRNA molecule encoding ORFlp, and a second mRNA molecule encoding an endonuclease and/or a reverse transcriptase.
- the mRNA is an mRNA molecule comprising a first sequence encoding ORFlp, and a second sequence encoding an endonuclease and/or a reverse transcriptase.
- the first sequence encoding ORFlp and the second sequence encoding an endonuclease and/or a reverse transcriptase are separated by a linker sequence.
- the linker sequence comprises an internal ribosome entry sequence (IRES).
- IRES is an IRES from CVB3 or EV71.
- the linker sequence encodes a self-cleaving peptide sequence.
- the linker sequence encodes a T2A, a E2A or a P2A sequence
- the sequence of a human retrotransposon comprises a sequence that encodes ORFlp fused to an additional protein sequence and/or a sequence that encodes ORF2p fused to an additional protein sequence.
- the ORFlp and/or the ORF2p is fused to a nuclear retention sequence.
- the nuclear retention sequence is an Alu sequence.
- the ORFlp and/or the ORF2p is fused to an MS2 coat protein.
- the 5’ UTR sequence or the 3’ UTR sequence comprises at least one, two, three or more MS2 hairpin sequences.
- the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that promotes or enhances interaction of a poly A tail of the mRNA with the endonuclease and/or a reverse transcriptase. In some embodiments, the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that promotes or enhances interaction of a poly-A-binding protein (PABP) with the endonuclease and/or a reverse transcriptase. In some embodiments, the 5’ UTR sequence or the 3’ UTR sequence comprises a sequence that increases specificity of the endonuclease and/or a reverse transcriptase to the mRNA relative to another mRNA expressed by the cell. In some embodiments, the 5’ UTR sequence or the 3’ UTR sequence comprises an Alu element sequence.
- PABP poly-A-binding protein
- the first sequence encoding ORFlp and the second sequence encoding an endonuclease and/or a reverse transcriptase have the same promoter.
- the insert sequence has a promoter that is different from the promoter of the first sequence encoding ORFlp.
- the insert sequence has a promoter that is different from the promoter of the second sequence encoding an endonuclease and/or a reverse transcriptase.
- the first sequence encoding ORFlp and/or the second sequence encoding an endonuclease and/or a reverse transcriptase have a promoter or transcription initiation site selected from the group consisting of an inducible promoter, a CMV promoter or transcription initiation site, a T7 promoter or transcription initiation site, an EF1 a promoter or transcription initiation site and combinations thereof.
- the insert sequence has a promoter or transcription initiation site selected from the group consisting of an inducible promoter, a CMV promoter or transcription initiation site, a T7 promoter or transcription initiation site, an EF1 a promoter or transcription initiation site and combinations thereof.
- the first sequence encoding ORFlp and the second sequence encoding an endonuclease and/or a reverse transcriptase are codon optimized for expression in a human cell.
- the mRNA comprises a WPRE element. In some embodiments, the mRNA comprises a selection marker. In some embodiments, the mRNA comprises a sequence encoding an affinity tag. In some embodiments, the affinity tag is linked to the sequence encoding an endonuclease and/or a reverse transcriptase.
- the 3' UTR comprises a poly A sequence or wherein a poly A sequence is added to the mRNA in vitro.
- the poly A sequence is downstream of a sequence encoding an endonuclease and/or a reverse transcriptase.
- the insert sequence is upstream of the poly A sequence.
- the 3' UTR sequence comprises the insert sequence.
- the insert sequence comprises a sequence that is a reverse complement of the sequence encoding the exogenous polypeptide.
- the insert sequence comprises a polyadenylation site.
- the insert sequence comprises an SV40 polyadenylation site.
- the insert sequence comprises a polyadenylation site upstream of the sequence that is a reverse complement of the sequence encoding the exogenous polypeptide.
- the insert sequence is integrated into the genome at a locus that is not a ribosomal locus.
- the insert sequence integrates into a gene or regulatory region of a gene, thereby disrupting the gene or downregulating expression of the gene. In some embodiments, the insert sequence integrates into a gene or regulatory region of a gene, thereby upregulating expression of the gene. In some embodiments, the insert sequence integrates into the genome and replaces a gene. In some embodiments, the insert sequence is stably integrated into the genome. In some embodiments, the insert sequence is retrotransposed into the genome. In some embodiments, the insert sequence is integrated into the genome by cleavage of a DNA strand of a target site by an endonuclease encoded by the mRNA. In some embodiments, the insert sequence is integrated into the genome via target-primed reverse transcription (TPRT). In some embodiments, the insert sequence is integrated into the genome via reverse splicing of the mRNA into a DNA target site of the genome.
- TPRT target-primed reverse transcription
- the cell is an immune cell.
- the immune cell is a T cell or aB cell.
- the immune cell is a myeloid cell.
- the immune cell is selected from a group consisting of a monocyte, a macrophage, a dendritic cell, a dendritic precursor cell, and a macrophage precursor cell.
- the mRNA is a self-integrating mRNA.
- the method comprises introducing into the cell the mRNA.
- the method comprises introducing into the cell the vector encoding the mRNA.
- the method comprises introducing the mRNA or the vector encoding the mRNA into a cell ex vivo.
- the method further comprises administering the cell to a human subject.
- the method comprises administering the mRNA or the vector encoding the mRNA to a human subject.
- an immune response is not elicited in the human subject.
- the mRNA or the vector is substantially non-immunogenic.
- the vector is a plasmid or a viral vector.
- the vector comprises a non-LTR retrotransposon.
- the vector comprises a human LI element.
- the vector comprises a LI retrotransposon ORF1 gene.
- the vector comprises a LI retrotransposon ORL2 gene.
- the vector comprises a LI retrotransposon.
- the mRNA is at least about 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, or 3 kilobases. In some embodiments, the mRNA is a most about
- the mRNA comprises a sequence that inhibits or prevents degradation of the mRNA.
- the sequence that inhibits or prevents degradation of the mRNA inhibits or prevents degradation of the mRNA by an exonuclease or an RNAse.
- the sequence that inhibits or prevents degradation of the mRNA is a G quadruplex, pseudoknot or triplex sequence.
- the sequence the sequence that inhibits or prevents degradation of the mRNA is an exoribonuclease-resistant RNA structure from a flaviviral RNA or an ENE element from KSV.
- the sequence that inhibits or prevents degradation of the mRNA inhibits or prevents degradation of the mRNA by a deadenylase. In some embodiments, the sequence that inhibits or prevents degradation of the mRNA comprises non-adenosine nucleotides within or at a terminus of a poly A tail of the mRNA. In some embodiments, the sequence that inhibits or prevents degradation of the mRNA increases stability of the mRNA.
- the exogenous sequence comprises a sequence encoding an exogenous polypeptide. In some embodiments, the sequence encoding an exogenous polypeptide is not in frame with a sequence encoding an endonuclease and/or a reverse transcriptase.
- the sequence encoding an exogenous polypeptide is not in frame with a sequence encoding an endonuclease and/or a reverse transcriptase. In some embodiments, the exogenous sequence does not comprise introns. In some embodiments, the exogenous sequence comprises a sequence encoding an exogenous polypeptide selected from the group consisting of an enzyme, a receptor, a transport protein, a structural protein, a hormone, an antibody, a contractile protein and a storage protein. In some embodiments, the exogenous sequence comprises a sequence encoding an exogenous polypeptide selected from the group consisting of a chimeric antigen receptor (CAR), a ligand, an antibody, a receptor, and an enzyme.
- CAR chimeric antigen receptor
- the exogenous sequence comprises a regulatory sequence.
- the regulatory sequence comprises a cis-acting regulatory sequence.
- the regulatory sequence comprises a cis-acting regulatory sequence selected from the group consisting of an enhancer, a silencer, a promoter or a response element.
- the regulatory sequence comprises a trans-acting regulatory sequence.
- the regulatory sequence comprises a trans-acting regulatory sequence that encodes a transcription factor.
- integration of the insert sequence does not adversely affect cell health.
- the endonuclease, the reverse transcriptase or both are capable of site-specific integration of the insert sequence.
- the mRNA comprises a sequence encoding an additional nuclease domain or a nuclease domain that is not derived from ORF2.
- the mRNA comprises a sequence encoding a megaTAL nuclease domain, a TALEN domain, a Cas9 domain, a zinc finger binding domain from an R2 retroelement, or a DNA binding domain that binds to repetitive sequences such as a Rep78 from AAV.
- the endonuclease comprises a mutation that reduces activity of the endonuclease compared to the endonuclease without the mutation.
- the endonuclease is an ORF2p endonuclease and the mutation is S228P.
- the mRNA comprises a sequence encoding a domain that increases fidelity and/or processivity of the reverse transcriptase.
- the reverse transcriptase is a reverse transcriptase from a retroelement other than ORF2 or reverse transcriptase that has higher fidelity and/or processivity compared to a reverse transcriptase of ORF2p.
- the reverse transcriptase is a group II intron reverse transcriptase.
- the group II intron reverse transcriptase is a group IIA intron reverse transcriptase, a group PB intron reverse transcriptase, or a group IIC intron reverse transcriptase. In some embodiments, the group II intron reverse transcriptase is TGIRT-II or TGIRT-III.
- the mRNA comprises a sequence comprising an Alu element and/or a ribosome binding aptamer. In some embodiments, the mRNA comprises a sequence encoding a polypeptide comprising a DNA binding domain. In some embodiments, the 3' UTR sequence is derived from a viral 3' UTR or a beta-globin 3' UTR.
- composition comprising a recombinant mRNA or vector encoding an mRNA, wherein the mRNA comprises a human LINE-1 transposon sequence comprising a human LINE-1 transposon 5’ UTR sequence, a sequence encoding ORFlp downstream of the human LINE-1 transposon 5’ UTR sequence, an inter-ORF linker sequence downstream of the sequence encoding ORFlp,a sequence encoding ORF2p downstream of the inter-ORF linker sequence, and a 3 ’ UTR sequence derived from a human LINE-1 transposon downstream of the sequence encoding ORF2p; wherein the 3’ UTR sequence comprises an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide or a reverse complement of a sequence encoding an exogenous regulatory element.
- the insert sequence integrates into the genome of a cell when introduced into the cell. In some embodiments, the insert sequence integrates into a gene associated a condition or disease, thereby disrupting the gene or downregulating expression of the gene. In some embodiments, the insert sequence integrates into a gene, thereby upregulating expression of the gene. In some embodiments, the recombinant mRNA or vector encoding the mRNA is isolated or purified.
- composition comprising a nucleic acid comprising a nucleotide sequence encoding (a) a long interspersed nuclear element (LINE) polypeptide, wherein the LINE polypeptide includes human ORFlp and human ORF2p; and (b) an insert sequence, wherein the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide or a reverse complement of a sequence encoding an exogenous regulatory element, wherein the composition is substantially non-immunogenic.
- LINE long interspersed nuclear element
- the composition comprises human ORFlp and human ORF2p proteins.
- the composition comprises a ribonucleoprotein (RNP) comprising human ORFlp and human ORF2p complexed to the nucleic acid.
- RNP ribonucleoprotein
- the nucleic acid is mRNA.
- a composition comprising a cell comprising a composition described herein.
- the cell is an immune cell.
- the immune cell is a T cell or a B cell.
- the immune cell is a myeloid cell.
- the immune cell is selected from a group consisting of a monocyte, a macrophage, a dendritic cell, a dendritic precursor cell, and a macrophage precursor cell.
- the insert sequence is a reverse complement of a sequence encoding an exogenous polypeptide and the exogenous polypeptide is a chimeric antigen receptor (CAR).
- a pharmaceutical composition comprising a composition described herein, and a pharmaceutically acceptable excipient.
- the pharmaceutical composition is for use in gene therapy.
- the pharmaceutical composition is for use in the manufacture of a medicament for treating a disease or condition.
- the pharmaceutical composition is for use in treating a disease or condition.
- a method of treating a disease in a subject comprising administering a pharmaceutical composition described herein to a subject with a disease or condition.
- the method increases an amount or activity of a protein or functional RNA in the subject.
- the subject has a deficient amount or activity of a protein or functional RNA.
- the deficient amount or activity of a protein or functional RNA is associated with or causes the disease or condition.
- the method further comprising administering an agent that inhibits human silencing hub (HUSH) complex, an agent that inhibits FAM208A, or an agent that inhibits TRIM28.
- the agent that inhibits human silencing hub (HUSH) complex is an agent that inhibits Periphilin, TASOR and/or MPP8.
- the agent that inhibits human silencing hub (HUSH) complex inhibits assembly of the HUSH complex.
- the agent inhibits the fanconia anemia complex. In some embodiments, the agent inhibits FANCD2-FANC1 heterodimer monoubiquitination. In some embodiments, the agent inhibits FANCD2-FANC1 heterodimer formation. In some embodiments the agent inhibits the Fanconi Anemia (FA) core complex.
- FA core complex is a component of the fanconi anemia DNA damage repair pathway, e.g., in chemotherapy induced DNA inter-strand crosslinks.
- the FA core complex comprises two central dimers of the FANCB and FA-associated protein of 100 kDa (FAAP100) subunits, flanked by two copies of the RING finger subunit, FANCL.
- sequences to be inserted may be placed under the control of tissue- specific elements, such that the entire inserted DNA is only functional in those cells in which the tissue- specific element is active.
- a heterologous nucleic acid or gene of interest e.g., a transgene, a regulatory sequence, for example, a sequence for an inhibitory nucleic acid, an siRNA, a miRNA
- the heterologous nucleic acid is termed insert for the purpose of the description in this document, where the insert is the nucleic acid sequence that will be reverse transcribed and inserted into the genome of the cell by the intended design of the constructs described herein.
- the heterologous nucleic acid is also termed the cargo, or cargo sequence for the purpose of the description in this document.
- the cargo can comprise the sequence of the heterologous nucleic acid that that is inserted in the genome.
- the cell may be a cell mammalian cell.
- the mammalian cell may be of epithelial, mesothelial or endothelial origin.
- the cell may be a stem cell.
- the cell may be a precursor cell.
- the cell may be a cell that is terminally differentiated.
- the cell may be a muscle cell, a cardiac cell, an epithelial cell, a hematopoietic cell, a mucous cell, an epidermal cell, a squamous cell, a cartilage cell, a bone cell, or any cell of mammalian origin.
- the cell is of hematopoietic lineage.
- he cell is of myeloid lineage, or a phagocytic cell, for example a monocyte, macrophage, a dendritic cell or a myeloid precursor cell.
- the nucleic acid encoding the transgene is an mRNA.
- the retrotransposable elements may be derived from a non-LTR retrotransposon.
- the insert sequence comprises (i) an exogenous sequence, or (ii) a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for a human ORF protein.
- the ORF protein is a human LINE 1 ORF2 protein. In some embodiments, the ORF protein is a non-human ORF protein. In some embodiments, the ORF protein is a chimeric protein, a recombinant protein or an engineered protein.
- a method for integrating a nucleic acid sequence into the genome of an immune cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises, (a) an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; (b) 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence, wherein the 5’ UTR sequence or the 3’ UTR sequence comprises an endonuclease binding site and a reverse transcriptase binding site, and wherein the transgene sequence is integrated into the genome of the immune cell.
- the structural elements that mediate RNA integration or transposition may be encoded in a synthetic construct and are relied upon to deliver a heterologous gene of interest to the cell.
- the synthetic construct may comprise a nucleic acid encoding the heterologous gene of interest and the structural elements that cause integration or retrotransposition of a heterologous gene of interest into the genome.
- the structural elements that cause integration or retrotransposition may include a 5’ LI RNA region, and a 3 ’-LI region, the latter comprising a poly A 3’ region for priming.
- the 5’ LI RNA region may comprise one or more stem loop regions.
- the LI- 3’ region may comprise one or more stem loop regions.
- the 5’- and 3’ LI regions are constructed as flanking the nucleic acid sequence encoding the heterologous gene of interest (the transgene).
- the structural elements may include a region from an LI or an Alu RNA comprising the hairpin loop structure that includes the A-Box and the B-Box elements that are ribosomal binding sites
- the synthetic nucleic acid may comprise a Ll-Ta promoter.
- the transgene, or transcript of interest may be flanked by transposable elements from a LI or an Alu sequence at the 5’ and the 3’ end.
- the 5’ region of a retrotransposon comprises an Alu sequence.
- the 3’ region of a retrotransposon comprises an Alu sequence.
- the 5’ region of a retrotransposon comprises an LI sequence.
- the 3’ region of a retrotransposon comprises an LI sequence.
- the transgene or transcript of interest is flanked by an SVA transposon sequence.
- the transcript of interest may comprise an LI or an Alu sequence, encoding the binding regions for ORF2p and the 3 ’ - poly A priming regions.
- the heterologous nucleic acid encoding the transgene of interest may be flanked by an LI or an Alu sequence, encoding the binding regions for ORFlp and the 3’- poly A priming regions.
- the 3 ’-region may comprise one or more stem loop structures.
- the transcript of interest is structured for cis integration or retrotransposition. In some embodiments, the transcript of interest is structured for trans integration or retrotransposition.
- the retrotransposon is a human retrotransposon.
- the sequence of a human retrotransposon can comprise a sequence encoding an endonuclease and/or a reverse transcriptase.
- the sequence of a human retrotransposon can encode for two proteins that are translated from a single RNA containing two non-overlapping ORFs.
- the two ORFs are ORF1 and ORF2.
- a method for stably integrating a heterologous nucleic acid encoding a transgene into the genome of a cell comprising introducing to the cell a nucleic acid encoding: the transgene; one or more 5 ’nucleic acid sequences flanking the region encoding the transgene, comprising a 5’ region of a retrotransposon; and one or more 3’ nucleic acid sequence flanking the region encoding the transgene, comprising a 3’ region of a retrotransposon, wherein the 3’ region of the retrotransposon comprises a genomic DNA priming sequence and a LINE transposase binding sequence, having the respective endonuclease and reverse transcriptase (RT) activity.
- RT reverse transcriptase
- a method for integrating a nucleic acid sequence into the genome of a cell comprising introducing a recombinant mRNA or a vector encoding an mRNA, wherein the mRNA comprises an insert sequence, wherein the insert sequence comprises (i) an exogenous sequence or (ii) a sequence that is a reverse complement of the exogenous sequence; (b) a 5’ UTR sequence, a sequence of a human retrotransposon downstream of the 5’ UTR sequence, and a 3’ UTR sequence downstream of the sequence of a human retrotransposon; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises an endonuclease binding site and a reverse transcriptase binding site, and wherein the sequence of a human retrotransposon encodes for two proteins that are translated from a single RNA containing two ORFs, and wherein the insert sequence is integrated into the genome of the cell.
- the method comprising using a single nucleic acid molecule for delivering and integrating the insert sequence into the genome of a cell.
- the single nucleic acid molecule may be a plasmid vector.
- the single nucleic acid may be DNA or an RNA molecule.
- the single nucleic acid may be an mRNA.
- the method comprises introducing into a cell one or more polynucleotides comprising the human retrotransposon and a heterologous nucleic acid sequence.
- the one or more polynucleotides comprises (i) a first nucleic acid molecule encoding an ORFlp; (ii) a second nucleic acid molecule encoding an ORF2p and a sequence encoding a cargo.
- the first nucleic acid and the second nucleic acid are mRNA.
- the first nucleic acid and the second nucleic acid are DNA, e.g., encoded in separate plasmid vectors.
- a self-integrating polynucleotide that comprises a sequence which is inserted into the genome of a cell, and insert is stably integrated into the genome by the self-integrating naked polynucleotide.
- the polynucleotide is an RNA.
- the polynucleotide is an mRNA.
- the polynucleotide is an mRNA that has modifications.
- the modifications ensure protection against RNases in the intracellular milieu.
- the modifications include substituted modified nucleotides, e.g., 5 -methyl cyti dine, pseudouridine or 2-thiouridine.
- a single polynucleotide is used for delivery and genomic integration of the insert (or cargo) nucleic acid.
- the single polynucleotide is bicistronic.
- the single polynucleotide is tricistronic.
- the single polynucleotide is multi-cistronic.
- a two or more polynucleotide molecules are used for delivery and genomic integration of the insert (or cargo) nucleic acid.
- a retrotransposable genetic element may be generated, the retrotransposable genetic element comprising (i) a heterologous nucleic acid encoding a transgene or a non coding sequence to be inserted into the genome of a cell (the insert); (ii) a nucleic sequence encoding one or more retrotransposon ORF- encoding sequences; (iii) one or more UTR regions of the ORF-coding sequences, such that the heterologous nucleic acid encoding a transgene or a non-coding sequence to be inserted is comprised within the UTR sequences; wherein the 3’ region of the retrotransposon ORF- encoding sequences comprises a genomic DNA priming sequence.
- the retrotransposable genetic element may be introduced into a cell for stably integrating the transgene into the genomic DNA.
- the retrotransposable genetic element comprises (a) a retrotransposon protein coding sequence, and a 3 ’ UTR; and (b) a sequence comprising a heterologous nucleic acid that is to be inserted (e.g, integrated) within the genome of a cell.
- the retrotransposon protein coding sequence, and the 3 ’ UTR may be a complete and sufficient unit for delivering the heterologous nucleic acid sequence within the genome of the cell, and comprise the retrotransposable elements, such as an endonuclease, a reverse transcriptase, a sequence in the 3’ UTR for binding to and priming the genomic DNA at the region cleaved by the endonuclease to start reverse transcribing and incorporating the heterologous nucleic acid.
- the retrotransposable elements such as an endonuclease, a reverse transcriptase, a sequence in the 3’ UTR for binding to and priming the genomic DNA at the region cleaved by the endonuclease to start reverse transcribing and incorporating the heterologous nucleic acid.
- the coding sequence of the insert is in forward orientation with respect to the coding sequence of the one or more ORFs. In some embodiments, the coding sequence of the insert is in reverse orientation with respect to the coding sequence of the one or more ORFs.
- the coding sequence of the insert and the coding sequence of the one or more ORFs may comprise distinct regulatory elements, including 5’ UTR, 3’ UTR, promoter, enhancer, etc.
- the 3’ UTR or the 5 ’-UTR of the insert may comprise the coding sequence of the one or more ORFs, and likewise, the coding sequence of the insert may be situated within in the 3’ UTR of the coding sequence of the one or more ORFs.
- a retrotransposable genetic element may be generated, the retrotransposable genetic element comprising: (a) an insert sequence, comprising (i) an exogenous sequence, a sequence that is a reverse complement of the exogenous sequence; a 5’ UTR sequence and a 3’ UTR sequence downstream of the 5’ UTR sequence; wherein the 5’ UTR sequence or the 3’ UTR sequence comprises a binding site for a human ORF protein.
- the retrotransposon may comprise a SINE or LINE element. In some embodiments, the retrotransposon comprises a SINE or LINE stem loop structure, such as an Alu element. [00215] In some embodiments, the retrotransposon is a LINE-1 (LI) retrotransposon. In some embodiments, the retrotransposon is human LINE-1. Human LINE-1 sequences are abundant in the human genome. There are approximately 13,224 total human Lis, of which 480 are active, which make up about 3.6%. Therefore, human LI proteins are well tolerated and non-immunogenic in humans.
- the retrotransposable constructs designed herein may comprise targeted and specific incorporation of the insert sequence.
- the retrotransposable genetic element may comprise designs intended to overcome the silencing machinery actively prevalent in human cells, while being careful that random integration resulting in genomic instability is not initiated.
- the retrotransposable constructs may comprise a sequence encoding a human LINE- 1 ORF1 protein; and a human LINE-1 ORL2 protein.
- the construct comprises a nucleic acid sequence encoding an ORLlp protein with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least
- the construct comprises a nucleic acid sequence with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to atgggcaagaagcaaaatcgcaagacggggaattccaagacacaatccgctagcccaccacctaaagagcgttctagctccccctgctactgagcagtc ctggatggaaaacgacttccgggaagagggatttaggcgatccaactattcagaactccgcgcgaagatatccagacaaggggaggaggaggaggaggaggaggaggaggagga
- the construct comprises a nucleic acid sequence encoding an ORF2p protein with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to MT GSN SHITILTLNIN GLNS AIKRHRL AS WIKS QDPS VCCIQETHLT CRDTHRLKIKGWRKIY Q AN GKQKKAGV AILV SDKTDFKPTKIKRDKEGHYIMVKGSIQQEELTILNIY APNT GAPRFIKQVLSDL QRDLDSHTLIMGDFNTPLSTLDRSTRQKVNKDTQELNSALHQADLIDIYRTLHPKSTEYTFFSAP HH
- the construct comprises a nucleic acid sequence with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least
- the construct comprises a nucleic acid sequence encoding an ORF2p protein with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to
- GGIRLPDFRLYYKAT VIKTIWYWHKNRNIDQ WNKIE SPEINPRT Y GQLI YDKGGKDIQ WRKD SLF NKW C WENWT AT CKRMKLE Y SLTPYTKIN SKWIRDLNIRLDTIKLLEENIGRTLFDINHSKIFFDPP PRVMEIKTKINKWDLMKLQSFCTAKETINKTKRQPSEWEKIFANESTDKGLISKIYKQLIQLNIKE TNTPIQKWAEDLNRHFSKEDIQTATKHMKRCSTSLIIREMQIKTTMRYHLTPVRMGIIRKSTNNK CWRGCGEKGTFFHCWWECKFIQPFWRTIWRFFKKFKIEFPYDPAIPFFGIYPEKTVIQKDTCTR MFIAALFTIARSWKQPKCPSTDEWIKKMWYIYTMEYY SAIKRNEIGSFLETWMDLETVIQSEVSQ KEKNKYRILTHICGTWKNGTD
- the construct comprises a nucleic acid sequence with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to atggtcataggaacatacatatcgataattaccttaaacgtgaatggattaaatgccccaaccaaaaagacatagactggctgaatggatacaaaacaaga cccatatatatgctgtctacaagagacccacttcagacctagggacacatacagactgaaagtgaggggatggaaaagatattccatgcaaatggaaat caaaagaaagctgga
- the construct comprises a nucleic acid sequence encoding a nuclear localization sequence with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to PAAKRVKLD.
- the nuclear localization sequence is fused to the ORF2p sequence.
- the construct comprises a nucleic acid sequence encoding a flag tag having the sequence DYKDDDDK.
- the flag tag is fused to the ORF2p sequence. In some embodiments, the flag tag is fused to the nuclear localization sequence.
- the construct comprises a nucleic acid sequence encoding an MS2 coat protein with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to ASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEV PKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIYAMASNFTQFVLVD NGGT GDVTVAPSNFANGIAEWIS SN SRSQ AYKVTCSVRQS S AQNRKYTIKVEVPKGAWRS YLN MELTIPIFAT
- the transgene may comprise a flanking sequence which comprises an Alu ORF2p recognition sequence.
- additional elements may be introduced into the mRNA.
- the additional elements may be an IRES element or a T2A element.
- the mRNA transcript comprises one, two, three or more stop codons at the 3 ’-end.
- the one, two, three or more stop codons are designed to be in tandem. In some embodiments, the one, two, three or more stop codons are designed to be in all three reading frames. In some embodiments, the one, two, three or more stop codons may be designed to be both in multiple reading frames and in tandem.
- one or more target specific nucleotides may be added at the priming end of the LI or the Alu RNA priming region.
- the 5’ UTR sequence or the 3’ UTR sequence in addition to be able to bind the ORF protein may also be capable of binding to one or more endogenous proteins that regulate gene retrotransposition and/or stable integration.
- the flanking sequence is capable of binding to a PABP protein.
- the 5 ’region flanking the transcript may comprise a strong promoter.
- the promoter is a CMV promoter.
- an additional nucleic encoding LI ORF2p is introduced into the cell.
- the sequence encoding LI ORF1 is omitted, and only L1-ORF2 is included.
- the nucleic acid encoding the transgene with the flanking elements is mRNA.
- the endogenous Ll-ORFlp function may be suppressed or inhibited.
- the nucleic acid encoding the transgene with the retrotransposition flanking elements comprise one or more nucleic acid modifications. In some embodiments, the nucleic acid encoding the transgene with the retrotransposition flanking elements comprises one or more nucleic acid modifications in the transgene. In some embodiments, the modifications comprise codon optimization of the transgene sequence. In some embodiments, the codon optimization is for more efficient recognition by the human translational machinery, leading to more efficient expression in a human cell.
- the one or more nucleic acid modification is performed in the 5 ’-flanking sequence or the 3’- flanking sequence including one or more stem-loop regions
- the nucleic acid encoding the transgene with the retrotransposition flanking elements comprise one, two, three, four, five, six, seven eight, nine, ten or more nucleic acid modifications.
- the retrotransposed transgene is stably expressed for the life of the cell.
- the cell is a myeloid cell.
- the myeloid cell is a monocyte precursor cell.
- the myeloid cell is an immature monocyte.
- the monocyte is an undifferentiated monocyte.
- the myeloid cell is a CD14+ cell. In some embodiments, the myeloid cell does not express CD16 marker.
- the myeloid cell is capable of remaining functionally active for a desired period of greater than 3 days, greater than 4 days, greater than 5 days, greater than 6 days, greater than 7 days, greater than 8 days, greater than 9 days, greater than 10 days, greater than 11 days, greater than 12 days, greater than 13 days, greater than 14 days or more under suitable conditions.
- a suitable condition may denote an in vitro condition, or an in vivo condition or a combination of both.
- the retrotransposed transgene may be stably expressed in the cell for about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days or about 10 days. In some embodiments, the retrotransposed transgene is stably expressed in the cell for more than 10 days. In some embodiments, the retrotransposed transgene is stably expressed in the cell for more than 2 weeks. In some embodiments, the retrotransposed transgene is stably expressed in the cell for about 1 month.
- the retrotransposed transgene may be modified for stable expression. In some embodiments, the retrotransposed transgene may be modified for resistant to in vivo silencing. [00232] In some embodiments, the expression of the retrotransposed transgene may be controlled by a strong promoter. In some embodiments, the expression of the retrotransposed transgene may be controlled by a moderately strong promoter. In some embodiments, the expression of the retrotransposed transgene may be controlled by a strong promoter that can be regulated in an in vivo environment. In some embodiments, the promoter is a CMV promoter. In some embodiments, the promoter is a Ll-Ta promoter.
- the ORFlp may be overexpressed. In some embodiments, the ORF2 may be overexpressed. In some embodiments, the ORFlp or ORF2p or both are overexpressed. In some embodiments, upon overexpression of an ORF1, ORFlp is at least 1.1 fold, 1.5 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 12 fold, 14 fold, 16 fold, 18 fold, 20 fold, 30 fold, 40 fold, 50 fold, 60 fold, 70 fold, 80 fold, 90 fold, or at least 100 fold higher than a cell not overexpressing and ORF1.
- ORF2p upon overexpression of an ORF2 sequence, is at least 1.1 fold, 1.5 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 12 fold, 14 fold, 16 fold, 18 fold, 20 fold, 30 fold, 40 fold, 50 fold, 60 fold, 70 fold, 80 fold, 90 fold, or at least 100 fold higher than a cell not overexpressing and ORF2p.
- the LINE-1 elements can bind to their own mRNA poly A tail to initiate retrotransposition.
- LINE- 1 elements preferably retrotranspose their own mRNA over random mRNAs (Dewannieux et al., 2013, 3,000-fold higher LINE-1 retrotransposition as compared to random mRNAs).
- LINE-1 elements can also integrate non-specific poly-A sequences within a genome.
- retrotransposition compositions and methods of using the same with increased retrotransposition specificity are provided herein.
- retrotransposition compositions with high specificity may be used for highly specific and efficient reverse transcription and subsequently, integration into genome of a target cell, e.g., a myeloid cell.
- a retrotransposition composition provided herein comprises a retrotransposition cassete that comprises one or more additional components that increases integration or retrotransposing specificity.
- the retrotransposon cassette may encode one or more additional elements that allows for high affinity RNA-protein interaction to out compete non-specific binding between poly-A sequences and ORF2.
- One exemplary measure for enhancing integration or retrotransposition efficiency is external manipulation of the cells.
- the endonuclease function of the retrotransposition machinery delivered in a cell may likely be subject to inhibition by the cell’s transposition silencing machinery, such as DNA repair pathways.
- transposition silencing machinery such as DNA repair pathways.
- small molecules can be used to modulate or inhibit DNA repair pathways in the cells prior to introducing the nucleic acid.
- cell sorting and/or synchronization can be used prior to introducing the nucleic acid, such as by electroporation, as cell cycle synchronized cell populations were shown to increase gene transfer to the cells.
- Cell sorting may be utilized to synchronize or homogenize the cell types and increase uniform transfer and expression of the exogenous nucleic acid.
- Uniformity may be achieved sorting stem cells from non-stem cells.
- Another exemplary measure for enhancing integration or retrotransposition efficiency is to enhance biochemical activity. For example, this may be achieved by increasing reverse-transcriptase processivity or DNA cleavage (endonuclease) activity.
- Another exemplary measure for enhancing integration or retrotransposition efficiency is to subvert endogenous silencing mechanisms. For example, this may be achieved by replacing entire LINE-1 sequence with a different organisms’ LINE-1.
- Another exemplary measure for enhancing integration or retrotransposition efficiency is to enhance translation and ribosome binding. For example, this may be achieved by increasing expression of LINE-1 proteins, increasing LINE protein binding LINE-1 mRNA, or increasing LINE-1 complex binding to ribosomes.
- Another exemplary measure for enhancing integration or retrotransposition efficiency is to increase nuclear import or retention. For example, this may be achieved by fusing the LINE- 1 sequence to a nuclear retention signal sequence.
- Another exemplary measure for enhancing integration or retrotransposition efficiency is to enhance specific-specific insertion. For example, this may be achieved by fusing a targeting domain to ORF2 to increase sequence specific retrotransposition.
- the method encompasses enhancing the retrotransposon for increasing specificity and robustness of expression of the cargo by modifying the UTR sequence of the LINE-1 ORFs.
- the 5 ’UTR upstream of ORFl or ORF2 encoding sequence may be further modified to comprise a sequence that is complementary to the sequence of a target region within the genome that helps in homologous recombination at the specific site where the ORF nuclease can act and the retrotransposition can take place.
- the sequence that can bind to a target sequence by homology is between 2-15 nucleotides long.
- the sequence having homology to a genomic target that is included in the 5 ’UTR of an ORFl mRNA may be about 3 nucleotides, about 4 nucleotides, about 5 nucleotides, about 6 nucleotides, about 7 nucleotides, about 8 nucleotides, about 9 nucleotides or about 10 nucleotides long.
- the sequence having homology to a genomic target is about 12 or about 15 nucleotides long.
- the sequence having homology to a genomic target comprises about 2-5, about 2-6, about 2-8 or about 2-10, or about 2-12 contiguous nucleotides that share complementarity with the respective target region within the genome.
- an ORF2 is associated with or fused to an additional protein domain that comprises RNA binding activity.
- the retrotransposon cassette comprises a cognate RNA sequence that comprises affinity with the additional protein domain associated with or fused to the ORF2.
- the ORF2 is associated with or fused to a MS2-MCP coat protein.
- the retrotransposon cassette further comprises a MS2 hairpin RNA sequence in the 3’ or 5’ UTR sequence that interacts with the MS2-MCP coat protein.
- the ORF2 is associated with or fused to a PP7 coat protein.
- the retrotransposon cassette further comprises a PP7 hairpin RNA sequence in the 3’ or 5’ UTR sequence that interacts with the MS2-MCP coat protein.
- the one or more additional elements increases retrotransposition specificity by at least 1.5 fold, at least 2 fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 10 fold, at least 20 fold, at least 30 fold, at least 50 fold, at least 100 fold, at least 200 fold, at least 300 fold, at least 500 fold, at least 1000 fold, at least 1500 fold, at least 2000 fold, at least 3000 fold, at least 5000 fold or more as compared to a retrotransposon cassette without the one or more additional elements.
- the DNA endonuclease domain appears to have specificity for a series of purines 3’ of the target site followed by a series of pyrimidines (Py) n
- An exemplary sequence may be ( Adenosine)n
- provided herein are methods of using retrotransposition having high target specificity. Consequently, provided herein is a method and compositions for stable incorporation of a transgene into the genome of a myeloid cell, such as a monocyte or macrophage, wherein the method comprises incorporating the transgene using a non-LTR retrotransposon system, wherein the retrotransposition occurs at a specific genomic locus with a target specificity, high precision and fidelity.
- the method comprises administration to the cell a composition comprising a system having at least one transgene, flanked with one or more retrotransposable elements, and one or more nucleic acids encoding one or more proteins for increasing the transposition specificity, and/or further comprising modifying one or more genes associated with the retrotransposition.
- the nucleic acid comprising the transgene, situated in UTR region of the retrotransposable elements is often referred to as a retrotransposition cassette.
- the retrotransposition cassette comprises the nucleic acid encoding the transgene and flanking Alu transposable elements.
- the retrotransposable elements comprise a sequence for binding the retrotransposons, for example, Ll-transposons, such as Ll-ORF proteins, ORFlp and ORF2p. ORF proteins are known to bind to their own mRNA sequence for retrotransposition.
- the retrotransposition cassette comprises the nucleic acid encoding the transgene; a flanking Ll-ORF2p binding sequence, and/or a Ll-ORFlp binding sequence, comprising a sequence encoding a Ll-ORFlp encoding sequence and a Ll-ORF2p encoding sequence outside the transgene sequence.
- the L1-ORF1 and L1-ORF2 are interspersed by a spacer region, also termed as an ORF1- ORF2 inter-region.
- the L1-ORF1 and L1-ORF2 coding sequences are in an opposite orientation with respect to the coding region of the transgene.
- the retrotransposition cassette can comprise a poly A region downstream of the Ll- ORF2-coding sequence and the transgene sequence is placed downstream of the poly A sequence.
- the Ll- ORF2 comprises a nucleic acid sequence that encodes an endonuclease (EN) and a reverse transcriptase (RT) followed by the poly A sequence.
- the L1-ORF2 sequence in the retrotransposition cassette described herein is a complete (intact) sequence, that is, encodes the full length native (WT) L1-ORF2 sequence.
- the L1-ORF2 sequence in the retrotransposition cassette described herein comprises a partial or modified sequence.
- the system described herein can comprise a promoter for expressing the Ll-ORFlp and Ll- ORF2p.
- the transgene expression is driven by a separate promoter.
- the transgene and the ORFs are in tandem orientation. In some embodiments, the transgene and the ORFs are in opposite orientation.
- the method comprises incorporating one or more elements in addition to the retrotransposon cassette.
- the one or more additional elements comprise a nucleic acid sequence encoding one or more domains of a heterologous protein.
- the heterologous protein may be a sequence specific nucleic acid binding protein, for example, a sequence specific DNA binding protein domain (DBD).
- the heterologous protein is a nuclease or a fragment thereof.
- the additional elements comprise a nucleic acid sequence encoding one or more nuclease domains or fragments thereof from a heterologous protein.
- the heterologous nuclease domain has reduced nuclease activity.
- the heterologous nuclease domain is rendered inactive.
- the ORF2 nuclease is rendered inactive; whereas one or more nuclease domains from the heterologous protein is configured to render specificity to the retrotransposition.
- one or more nuclease domains or fragments thereof from the heterologous protein targets a specific desired polynucleotide within the genome where retrotransposition and incorporation of the polynucleotide of interest is to be incorporated.
- the one or more nuclease domains from the heterologous protein comprise a mega-TAL nuclease domain, TALENs, or a zinc finger nuclease domain, for example, a mega-TAL, a TALE, or a zinc finger domain fused to or associated with a nuclease domain, e.g., a Fokl nuclease domain.
- the one or more nuclease domains from the heterologous protein comprise a CRISPR-Cas protein domain loaded with a specific guide nucleic acid, e.g., a guide RNA (gRNA) for a specific target locus.
- gRNA guide RNA
- the CRISPR-Cas protein is a Cas9, a Cast 2a, a Cast 2b, a Cast 3, a CasX, or a CasY protein domain.
- the one or more nuclease domains from the heterologous protein has target specificity.
- the additional nuclease domain may be incorporated into the ORF2 domain.
- the additional nuclease may be fused with the ORF2p domain.
- the additional nuclease domain may be fused to an ORF2p, wherein the ORF2p includes a mutation in the ORF2p endonuclease domain.
- the mutation inactivates the ORF2p endonuclease domain.
- the mutation is a point mutation.
- the mutation is a deletion.
- the mutation is an insertion.
- the mutation abrogates the ORF2 endonuclease (nickase) activity.
- a mutation inactivates the DNA target recognition of ORF2p endonuclease.
- the mutation covers a region associated with ORF2p nuclease-DNA recognition.
- a mutation reduces the DNA target recognition of ORF2p endonuclease.
- the ORF2p endonuclease domain mutation is in the N-terminal region of the protein. In some embodiments, the ORF2p endonuclease domain mutation is in a conserved region of the protein. In some embodiments, the ORF2p endonuclease domain mutation is in the conserved N-terminal region of the protein. In some embodiments, the mutation comprises the N14 amino acid within LI endonuclease domain. In some embodiments, the mutation comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more consecutive amino acids including the N14 amino acid within LI endonuclease domain. In some embodiments, the mutation comprises the comprises the E43 amino acid within LI endonuclease.
- the mutation comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more consecutive amino acids including the E43 amino acid within LI endonuclease domain. In some embodiments, the mutation comprises 2 or more amino acids in the LI endonuclease domain including N14, or E43 or a combination thereof. In some embodiments, the mutation comprises D145 of the LI endonuclease domain. In some embodiments, the mutation may be D145A. In some embodiments, the may be a comprise D205 of the LI endonuclease domain. In some embodiments, the mutation may be D205G. In some embodiments, the mutation may comprise H230 of LI endonuclease domain. In some embodiments, the may be a comprise S228 of the LI endonuclease domain. In some embodiments, the mutation may be S228P.
- a mutation reduces the DNA target recognition of ORL2p endonuclease by at least 50%. In some embodiments, a mutation reduces the DNA target recognition of ORL2p endonuclease by at least 60%. In some embodiments, a mutation reduces the DNA target recognition of ORL2p endonuclease by at least 70%. In some embodiments, a mutation reduces the DNA target recognition of ORL2p endonuclease 80%. In some embodiments, a mutation reduces the DNA target recognition of ORL2p endonuclease 90%. In some embodiments, a mutation reduces the DNA target recognition of ORL2p by 95%.
- a mutation reduces the DNA target recognition of ORL2p by 100%.
- the mutation is a deletion.
- the deletion is complete, i.e., 100% of the LI endonuclease domain is deleted.
- the deletion is partial.
- the about 98%, about 95%, about 94%, about 93%, about 92% about 91%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, or about 50% of the ORF2 endonuclease domain is deleted.
- an additional nuclease domain is inserted into the ORF2 protein sequence.
- ORF2 endonuclease domain is deleted, and is replaced with an endonuclease domain from a heterologous protein.
- the ORF2 endonuclease is partially deleted and replaced with an endonuclease domain from a heterologous protein.
- the endonuclease domain from a heterologous protein may be a mega-TAL nuclease domain.
- the endonuclease domain from a heterologous protein may be a TALENs.
- the endonuclease domain from a heterologous protein may be a Cas9 loaded with a specific gRNA for a locus.
- the endonuclease is an endonuclease that has (i) a specific target on the genome and (ii) it creates a 5’-P and a 3 ’-OH terminus at the cleavage site.
- the additional endonuclease domain from a heterologous protein is an endonuclease domain from a related retrotransposon.
- the endonuclease domain from a heterologous protein may comprise a bacterial endonuclease engineered for targeting a specific site.
- the endonuclease domain from a heterologous protein may comprise a domain of a homing endonuclease or a fragment thereof.
- the endonuclease is a homing endonuclease.
- the homing endonuclease is an engineered LAGLIDADG homing endonucleases (LHEs) or a fragment thereof.
- additional endonucleases may be a restriction endonuclease, Cre, Cas TAL or fragments thereof.
- the endonuclease may comprise a Group II intron encoded protein (ribozyme) or a fragment thereof.
- an engineered or modified Ll-ORF2p as discussed in the preceding paragraphs, that is endowed with specific DNA targeting capability due to the additional/heterologous endonuclease is expected to be highly advantageous in driving targeted stable integration of a transgene into the genome.
- the engineered Ll-ORF2p can generate much reduced off-target effects when expressed in a cell than using a native, non- engineered Ll-ORF2p.
- the engineered Ll-ORF2p generates no off-target effect.
- the engineered or modified Ll-ORF2p targets a recognition site that is other than the usual (Py) n j(Pu) n site.
- engineered Ll-ORF2p targets a recognition site that comprises the (Py) n j(Pu) n site, for example, TTTT/AA site, such as a hybrid target site.
- the engineered LI -ORF2p targets a recognition site having at least one nucleotide in addition to the conventional L1-ORF2 (Py) n
- the engineered Ll-ORF2p targets a recognition site that is in addition to the conventional Ll-ORF2p (Py) n j(Pu) n site. In some embodiments, the engineered Ll-ORF2p targets a recognition site that is other than to the conventional Ll-ORF2p (Py) n
- the engineered Ll-ORF2p can be engineered to retain its ability to bind to its own mRNA after translation and reverse transcribe with high efficiency.
- the engineered Ll-ORF2p has enhanced efficiency of reverse transcription compared to a native (WT) Ll-ORF2p.
- the system comprising a retrotransposable element further comprises a gene modification that reduces non-specific retrotransposition.
- the gene modification may comprise a sequence encoding the Ll-ORF2p.
- the modification may comprise mutation of one or more amino acids that are essential for binding to a protein that helps ORF2p binding to the target genomic DNA.
- a protein that helps ORF2p binding to the target genomic DNA may be part of the chromatin-ORF interactome.
- the modification may comprise one or more amino acids that are essential for binding to a protein that helps ORF2p DNA endonuclease activity.
- the modification may comprise one or more amino acids that are essential for binding to a protein that helps ORF2p RT activity.
- the modification may comprise at a protein binding site on ORF2p such that the association of a protein with ORF2p is altered, wherein binding of the protein to ORF2p is required for binding to chromatin.
- the modification may comprise at a protein binding site on ORF2p such that the association of the protein with ORF2p is more stringent and/or specific than in absence of the modification.
- the modification may reduce binding of ORF2 to one or more proteins that are part of the ORF2p chromatin interactome.
- the gene modification may be in the PIP domain of ORF2p.
- the gene modification may be in one or more genes encoding a protein that binds to an ORF2p and helps in the recognition, binding, endonuclease or RT activity of ORF2p.
- the gene modification may be in one or more genes encoding PCNA, PARP1, PABP, MCM, TOPI, RPA, PURA, PURB, RUVBL2, NAP1, ZCCHC3, UPF1 or MOV10 proteins at an ORF2p interacting site for each protein or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
- the modification may be on an ORF2p binding domain of PCNA at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
- the modification may be on an ORF2p binding domain of TOPI.
- the modification may be on an ORF2p binding domain of RPA.
- the modification may be on an ORF2p binding domain of PARP1 at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
- the modification may be on an ORF2p binding domain of PABP (e.g., PABPCl) at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
- PABP e.g., PABPCl
- the gene modification may be on an MCM gene.
- the gene modification may be on a gene encoding MCM3 protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
- the gene modification may be on a gene encoding MCM5 protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA. In some embodiments, the gene modification may be on a gene encoding MCM6 protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA. In some embodiments, the gene modification may be on a gene encoding MEPCE protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
- the gene modification may be on a gene encoding on a gene encoding RUVBL1 or RUVBL2 protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
- the gene modification may be on a gene encoding on a gene encoding TROVE protein at an ORF2p interacting site or at a site that affects the protein’s interaction with ORF2p or the interaction of ORF2p with target DNA.
- the retrotransposition system disclosed herein comprises one or more elements that increase the fidelity of reverse transcription.
- the L1-ORF2 RT domain is modified.
- the modification includes one or more of: increasing fidelity, increasing processivity, increasing DNA-RNA substrate affinity; or inactivating RNase H activity.
- the modification comprises introducing one or more mutations in the RT domain of the L1-ORF2, such that the fidelity of the RT is increased.
- the mutation comprises a point mutation.
- the mutation comprises alteration, such as substitution of one, two three, four, five, six or more amino acids in the Ll-ORF2p RT domain.
- the mutation comprises deletion of one or more amino acids, for example, one, two, three, four, five, six, seven, eight, nine, ten or more amino acids in the Ll-ORF2p RT domain.
- the mutation may comprise an in-del mutation.
- the mutation may comprise a frame- shift mutation.
- the modification may comprise inclusion of an additional RT domain or fragment thereof from a second protein.
- the second protein is a viral reverse transcriptase.
- the second protein is a non-viral reverse transcriptase.
- the second protein is a retrotransposable element.
- the second protein is a non-LTR retrotransposable element.
- the second protein is a group II intron protein.
- the group II intron is as TGIRTII.
- the second protein is a Cas nickase, wherein the retrotransposable system further comprises introducing a guide RNA.
- the second protein is a Cas9 endonuclease, wherein the retrotransposable system further comprises introducing a guide RNA.
- the second protein or fragment thereof is fused to the N-terminus of the L1-ORF2 RT domain or the modified L1-ORF2 RT domain.
- the second protein or fragment thereof is fused to the C-terminus of the LI -ORF2 RT domain or the modified L1-ORF2 RT domain.
- the additional RT domain or fragment thereof from the second protein is incorporated in the retrotransposition system in addition to the full-length WT Ll-ORF2p RT domain.
- the additional RT domain or fragment thereof from the second protein is incorporated in presence of a modified (engineered) Ll-ORF2p RT domain or a fragment thereof, where the modification (or engineering) may comprise a mutation for enhancement of the Ll-ORF2p RT processivity, stability and/or fidelity of the modified Ll-ORF2p RT compared to the native or WT ORF2p.
- the reverse transcriptase domain could be replaced with other more highly processive and high-fidelity RT domains from other retroelements or group II introns, such as TGIRTII.
- the modification may comprise a fusion with an additional RT domain or fragment thereof from a second protein.
- the second protein may comprise a retroelement.
- the additional RT domain or fragment thereof from a second protein is configured to increase the fidelity of reverse transcription of the fused Ll-ORF2p RT domain.
- the nucleic acid encoding the additional RT domain or fragment thereof is fused to a native or WT L1-ORF2 encoding sequence.
- the nucleic acid encoding the additional RT domain or fragment thereof from a second protein is fused to a modified L1-ORF2 encoding sequence.
- the modification comprises introducing one or more mutations in the RT domain of the L1-ORF2 or fragment thereof, such that the fidelity of the fused RT is increased.
- the mutation in the RT domain of the L1-ORF2 or fragment thereof comprises a point mutation.
- the mutation comprises alteration, such as substitution of one, two three, four, five, six or more amino acids in the Ll-ORF2p RT domain.
- the mutation comprises deletion of one or more amino acids, for example, one, two, three, four, five, six, seven, eight, nine, ten or more amino acids in the Ll- ORF2p RT domain.
- the mutation may comprise an in-del mutation.
- the mutation may comprise a frame-shift mutation.
- the modified Ll-ORF2p RT domain has increased processivity than the WT LI - ORF2p RT domain. [00267] In some embodiments, the modified Ll-ORF2p RT domain has at least 10% higher processivity and/or fidelity over the WT LI- ORF2p RT domain. In some embodiments, the modified Ll-ORF2p RT domain has at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 150%, 200%, 300%, 400%, 500%, 1000% or higher processivity and/or fidelity over the WT LI- ORF2p RT domain.
- the modified RT can process greater than 6kb nucleic acid stretch. In some embodiments, the modified RT can process greater than 7kb nucleic acid stretch. In some embodiments, the modified RT can process greater than 8kb nucleic acid stretch. In some embodiments, the modified RT can process greater than 9kb nucleic acid stretch. In some embodiments, the modified RT can process greater than lOkb nucleic acid stretch.
- Group II enzymes are mobile ribozymes that self-splice precursor RNAs, yielding excised intron lariat RNAs.
- the introns encode a reverse transcriptase.
- the reverse transcriptase may stabilize the RNA for forward and reverse splicing, and later in converting the integrated intron RNA to DNA.
- Group II RNAs are characterized by a conserved secondary structure spanning 400-800b nucleotides.
- the secondary structure is formed by six domains DI-VI, and is organized in a structure resembling a wheel, where the domains radiate from a central point.
- the domains interact to form a conserved tertiary structure that brings together distant sequences to form an active site.
- the active site binds the splice sites and branch point residue nucleotide and in association of Mg2+ cations, activate catalysis of splicing.
- the DV domain is within the active site, which has the conserved catalytic AGC and an AY bulge and both these regions bind Mg2+ ions necessary for the catalysis.
- DI is the largest domain with upper and lower halves separated by kappa and zeta motifs.
- the lower half contains the ⁇ ’ motif, which is associated with an active site.
- the upper half contains sequence elements that bind to the 5’ and 3 ’ exons at the active sites.
- DIV encodes the intron-encoded protein (IEP) with subdomain IVa near the 5 ’- end containing the high affinity binding site for IEP.
- Group P introns have conserved 5’- and 3’- end sequences, GUGYG and AY respectively.
- Group II RNA introns can be utilized to retrotranspose a sequence of interest into DNA via target primed reverse transcription. This process of transposition by Group II RNA introns is often referred to as retrohoming. Group II introns recognize DNA target sites by base pairing of the intron RNA to the DNA target sequence, they can be modified to retarget a specific sequence carried within the intron to a desired DNA site.
- the method and compositions for retrotransposition described herein may comprise a Group II intron sequence, a modified Group II intron sequence or a fragment thereof.
- exemplary Group II IEPs include but are not limited to bacterial, fungal, yeast IEPs, that are functional in human cells.
- the nuclease leaves a 3 ’-OH at the cleavage site of the DNA which can be utilized by another RT for priming and reverse transcription.
- An exemplary Group II maturase may be TGIRT (thermally stable group II intron maturase).
- the nucleic acid construct comprises an RNA. In one or more embodiments of several aspects of the disclosure, the nucleic acid construct is an RNA. In one or more embodiments of several aspects of the disclosure, the nucleic acid construct is an mRNA. In one aspect, the mRNA comprises a sequence of a heterologous gene or portion thereof, wherein the heterologous gene or portion thereof encodes a polypeptide or protein. In some embodiments, the mRNA comprises a sequence encoding a fusion protein. In some embodiments, the mRNA comprises a sequence encoding a recombinant protein. In some embodiments, the mRNA comprises a sequence encoding a synthetic protein.
- the nucleic acid comprises one or more sequences, wherein the one or more sequences encode on or more heterologous proteins, one or more recombinant proteins, or one or more synthetic proteins or a combination thereof. In some embodiments, the nucleic acid comprises one or more sequences, wherein the one or more sequences encode on or more heterologous proteins comprising a synthetic protein or a recombinant protein. In some embodiments, the synthetic or recombinant protein is a recombinant fusion protein.
- the nucleic acid construct is developed for expressing in a eukaryotic cell. In some embodiments, the nucleic acid construct is developed for expressing in a human cell. In some embodiments, the nucleic acid construct is developed for expressing in a hematopoietic cell. In some embodiments, the nucleic acid construct is developed for expressing in a myeloid cell. In some embodiments, the myeloid cell is a human cell.
- the recombinant nucleic acid is modified for enhanced expression of the protein encoded by a sequence of the nucleic acid.
- Enhanced expression of the protein encoded therein can be a function of the nucleic acid stability, translation efficiency and the stability of the translated protein.
- a number of modifications are contemplated herein for incorporation in the design of the nucleic acid construct that can confer nucleic acid stability, such as stability of the messenger RNA encoding the exogenous or heterologous protein, which may be a synthetic recombinant protein or a fragment thereof.
- the nucleic acid is mRNA, comprising one or more sequences, wherein the one or more sequences encode one or more heterologous proteins comprising a synthetic or a recombinant fusion protein.
- one or more modifications are made in the mRNA comprising a sequence encoding a recombinant or fusion protein to increase the mRNA half-life.
- the 5’- cap comprises a guanosine triphosphate arranged as GpppG at the 5 ’terminus of the nucleic acid.
- the mRNA comprises a 5’ 7-methyl guanosine cap, m7-GpppG.
- a 5’ 7-methylguanosine cap increases mRNA translational efficiency and prevents degradation of mRNA 5’- 3 ’exonucleases.
- the mRNA comprises "anti -reverse" cap analog (ARCA, m 7 ⁇ 3 °GpppG). Translational efficiency however, can be markedly increased by usage of the ARCA.
- the guanosine cap is a Cap 0 structure. In some embodiments, the guanosine cap is a Cap 1 structure.
- the mRNA cap also functions as a protective group from 5' to 3' exonuclease cleavage and a unique identifier for recruiting protein factors for pre-mRNA splicing, polyadenylation and nuclear export. It acts as the anchor for the recruitment of initiation factors that initiate protein synthesis and the 5' to 3' looping of mRNA during translation.
- RNA triphosphatase RNA triphosphatase
- GTase RNA guanylyltransferase
- guanine-N7 methyl transferase guanine-N7 MTase
- Each of these enzyme activities carries out an essential step in the conversion of the 5' triphosphate of nascent RNA to the Cap 0 structure.
- RNA TPase removes the g-phosphate from the 5' triphosphate to generate 5' diphosphate RNA.
- GTase transfers a GMP group from GTP to the 5' diphosphate via a lysine- GMP covalent intermediate.
- the guanine-N7 MTase then adds a methyl group to the N7 amine of the guanine cap to form the cap 0 structure.
- m7G-specific 2 ⁇ methyltransferase (2 ⁇ MTase) methylates the +1 ribonucleotide at the 2 ⁇ position of the ribose to generate the cap 1 structure.
- the nuclear RNA capping enzyme interacts with the polymerase subunit of RNA polymerase P complex at phosphorylated Ser5 of the C-terminal heptad repeats.
- RNA guanine-N7 methyltransferase also interacts with the RNA polymerase P phosphorylated heptad repeats.
- the cap is a G- quadruplex cap.
- the mRNA is synthesized by in vitro transcription (IVT).
- IVT in vitro transcription
- mRNA synthesis and capping may be performed in one step. Capping may occur in the same reaction mixture as IVT.
- mRNA synthesis and capping may be performed in separate steps. mRNA thus formed by IVT is purified and then capped.
- the nucleic acid construct e.g., the mRNA construct
- comprises one or more sequences encoding a protein or a polypeptide of interest can be designed to comprise elements that protect, prevent, inhibit or reduce degradation of the mRNA by endogenous 5 ’-3’ exoribonucleases, for example, Xml.
- Xml is a cellular enzyme in the normal RNA decay pathways that degrades 5' monophosphorylated RNAs.
- some viral RNA structural elements are found to be particularly resistant to such RNases, for example, the Xml -resistant structure in flaviviral sfRNAs, called the ‘xrRNA’.
- the mosquito-bome flaviviruses (MBFV) genomes contain discrete RNA structures in their 3 '-untranslated region (UTR) that block the progression of Xml. These RNA elements are sufficient to block Xml without the use of accessory proteins.
- xrRNAs halt the enzyme at a defined location such that the viral RNA located downstream of the xrRNAs is protected from degradation.
- the xrRNAs from Zikavirus or Murray Valley encephalitis virus for example, comprise three-way junction and multiple pseudoknot interactions that create an unusual and complex fold that requires a set of nucleotides conserved across the MBFVs structure.
- xrRNAs halt the enzyme at a defined location such that the viral RNA located downstream of the xrRNAs is protected from degradation.
- the 5 ’-end of the RNA passes through a ring- like structure of the fold and is believed to remain protected from the Xml -like exonuclease.
- the nucleic acid construct comprising the one or more sequences that encode a protein of interest may comprise one or more xrRNA structures incorporated therein.
- the xrRNA is a stretch of nucleotides having the conserved regions of the 3’ UTR of one or more viral xrRNA sequences.
- 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more xrRNA elements are incorporated within the nucleic acid construct.
- 2 or more xrRNA elements are incorporated in tandem within the nucleic acid construct.
- the xrRNA comprise one or more regions comprising conserved sequences or fragments thereof or modifications thereof.
- the xrRNA is placed at the 3 ’UTR of a retrotransposon element. In some embodiments, the xrRNA is placed at upstream of the sequences encoding the one or more proteins or polypeptides. In some embodiments, the xrRNA is placed in the 3 ’UTR of a retrotransposon element, such as an ORF2 sequence, and upstream of the sequences encoding the one or more proteins or polypeptides.
- a retrotransposon element such as an ORF2 sequence
- the xrRNA structure comprises a MBFV xrRNA sequence, or a sequence that is at least 90% identical thereof. In some embodiments, the xrRNA structure comprises a tick-bome flaviviruses (TBFVs) xrRNA sequence, or a sequence that is at least 90% identical thereof. In some embodiments, the xrRNA structure comprises a tick-bome flaviviruses (TBFVs) xrRNA sequence, or a sequence that is at least 90% identical thereof. In some embodiments, the xrRNA structure comprises a tick-bome flaviviruses (TBFVs) xrRNA sequence, or a sequence that is at least 90% identical thereof.
- TPFVs tick-bome flaviviruses
- the xrRNA structure comprises a xrRNA sequence from a member of no known arthropod vector flaviviruses (NKVFVs), or a sequence that is at least 90% identical thereof.
- the xrRNA structure comprises a xrRNA sequence from a member of insect-specific flaviviruses (ISFVs), or a sequence that is at least 90% identical thereof.
- the xrRNA structure comprises a Zikavirus xrRNA sequence, or a sequence that is at least 90% identical thereof. It is hereby contemplated that any known xrRNA structural elements or conceivable non-obvious variations thereof may be used for the purpose described herein.
- a pseudoknot is a RNA structure that is minimally composed of two helical segments connected by single-stranded regions or loops. Although several distinct folding topologies of pseudoknots exist.
- the poly A structure in the 3’UTR of an mRNA is an important regulator of mRNA half-life. Exosomal deadenylation at the poly A tail initiates mRNA body degradation.
- the length of the poly A tail of the mRNA construct is taken into critical consideration and designed for maximizing the expression of the protein encoded by the mRNA coding region, and the mRNA stability.
- the nucleic acid construct comprises one or more poly A sequences.
- the poly A sequence at the 3’UTR of the sequences encoding the one or more proteins or polypeptides comprise 20-200 adenosine nucleobases.
- the poly A sequence comprises 30-200 adenosine nucleobases. In some embodiments, the poly A sequence comprises 50-200 adenosine nucleobases. In some embodiments, the poly A sequence comprises 80-200 adenosine nucleobases. In some embodiments, the mRNA segment comprising the sequences that encode one or more proteins or polypeptides comprises a 3’-UTR having a poly-A tail comprising about 180 adenosine nucleobases, or about 140 adenosine nucleobases, or about 120 adenosine nucleobases. In some embodiments, the poly A tail comprises about 122 adenosine nucleobases.
- the poly A sequence comprises 50 adenosine nucleobases. In some embodiments, the poly A sequence comprises 30 adenosine nucleobases. In some embodiments, the adenosine nucleobases in the poly A tail are placed in tandem, with or without intervening non-adenosine bases. In some embodiments, one or more non adenosine nucleobases are incorporated in the poly A tail, which confer further resistance to certain exonucleases.
- the stretch of adenosines in poly A tail of the construct comprises one or more non-adenosine (A) nucleobase.
- the non-A nucleobase is present at -3, -2, -1, and/or +1 position at the poly A 3 ’-terminal region.
- the non-A bases comprise a guanosine (G) or a cytosine (C) or an uracil base (U).
- the non-A base is a G.
- the non-A base more than one, in tandem, for example, GG.
- the modification at the 3 ’ end of the poly A tail with one or more non-A base is directed at disrupting the A base stacking at the poly A tail.
- the poly A base stacking is effective for deadenylation by various deadenylating enzymes, and therefore 3 ’end of poly ending in -AAAG, -AAAGA, or -AAAGGA are effective in conferring stability against deadenylation.
- a GC sequence intervening a poly A sequence is shown to effectively show down 3 ’-5’ exonuclease mediated decay.
- a modification contemplated herein comprises an intervening non-A residue, or a non-A residue duplex intervening a poly A stretch at the 3 ’end.
- a triplex structure is introduced in the 3 ’ UTR which effectively stalls or slows down exonuclease activity involving the 3 ’-end.
- the mRNA with the modifications described above has an extended half- life and demonstrates stable expression over a longer period than the unmodified mRNA.
- the mRNA stably expresses for greater than 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days 9 days or 10 days or more, and the mRNA or its protein product is detectable in vivo.
- the mRNA is detected up to 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days or 15 days in vivo.
- a protein product of the mRNA is detected up to 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 20 days, 25 days or 30 days in vivo.
- Circular RNA is useful in the design and production of stable form of RNA used as a messenger RNA to direct synthesis protein chains, such as long, multiply repeating protein chains.
- Another technique relies on the ability of T4 DNA ligase to act as an RNA ligase when the RNA ends to be ligated are held together by an oligonucleotide.
- a third technique uses the cyclization or circularization activity of group I introns where most of the intron sequences that carry out the reaction must remain a part of the circle.
- Group I introns share a complex set of secondary and tertiary structures containing a series of conserved RNA stem loops which form the catalytic core. Many of these introns are self-splicing in vitro and can splice and form two ligated exons as RNA with no accessory protein factors.
- the products created by the group I autocatalytic reaction are (1) an upstream exon ligated at the 5' splice site to the 3' splice site of a downstream exon and (2) a linear intron that can undergo further reversible auto-catalysis to form a circular intron.
- the presence of such a large highly structured nucleic acid sequence severely limits the types of RNA sequences that can be made circular by that technique.
- the catalytic activity of the intron may remain and interfere with structure and function of the circular RNA.
- RNA sequences that fold a three-dimensional structure to form a stable binding interaction that is independent of sequence.
- tectoRNA molecular units, defined as RNA molecules capable of self-assembly. The use of such type of tertiary interactions allows one to control and modulate the assembly process by manipulating cation concentration (e.g.
- RNA molecules Mg 2+ ), and/or suitable temperature and employing modularly designed ‘selector’ RNA molecules.
- a basic modular unit was designed that comprises a 4-way junction with an interacting module on each helical arm.
- the interacting module is a GAAA loop or a specific GAAA loop receptor.
- Each tectoRNA can interact with two other tectoRNAs via the formation of four loop-receptor interactions, two with each partner molecule.
- the tectoRNA structures are suitably selected, and integrated in the RNA comprising the exon and intron to form a circRNA.
- the integration is done by well- known molecular biology techniques such as ligation.
- the tectoRNA forms a stable structure at high temperatures. The tectoRNA structure do not compete with internal RNA sequences, thereby creating high efficiency circularization and splicing.
- the circRNA can comprise a coding sequence described in any of the preceding sections.
- it can comprise a sequence encoding fusion protein comprising a tethering or a receptor molecule.
- the receptor can be a phagocytic receptor fusion protein.
- the intron is a self-splicing intron.
- the terminal regions having the tertiary structures are about 30 nucleotides to about 100 nucleotides long.
- the tertiary structure motif is about 45 nucleotides, about 50 nucleotides, about 55 nucleotides, about 60 nucleotides, about 65 nucleotides, about 70 nucleotides or about 75 nucleotides long.
- the tertiary motifs are formed at high temperatures. In some embodiments, the tertiary motifs are stable.
- the nucleic acid construct having the one or more modifications as described herein and comprising one or more sequences encoding one or more proteins or polypeptides is stable when administered in vivo.
- the nucleic acid is an mRNA.
- the mRNA comprising one or more sequences encoding one or more proteins or polypeptides is stable in vivo for more than 2 days, for more than 3 days, more than 4 days, more than 5 days, more than 6 days, more than 7 days, more than 8 days, more than 9 days, more than 10 days, more than 11 days, more than 12 days, more than 13 days, more than 14 days, more than 15 days, more than 16 days, more than 17 days, more than 18 days, more than 19 days, or more than 20 days.
- the protein encoded by the sequences in the mRNA can be detected in vivo at greater than 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, or 20 days. In some embodiments, the protein encoded by the sequences in the mRNA can be detected in vivo for about 7 days after the mRNA is administered. In some embodiments, the protein encoded by the sequences in the mRNA can be detected in vivo for about 14 days after the mRNA is administered.
- the protein encoded by the sequences in the mRNA can be detected in vivo for about 21 days after the mRNA is administered. In some embodiments, the protein encoded by the sequences in the mRNA can be detected in vivo for about 30 days after the mRNA is administered. In some embodiments, the protein encoded by the sequences in the mRNA can be detected in vivo for more than about 30 days after the mRNA is administered.
- enhancing nucleic acid uptake or incorporation within the cell is contemplated for enhancing expression of the retrotransposition.
- One of the methods include obtaining a homogenous population of cells to initiate incorporation of the nucleic acid, e.g. via transfection, in case of plasmid vector constructs, or via electroporation or any other means that may be used suitably to deliver a nucleic acid molecule into the cell.
- cell cycle synchronization may be sought. Cell cycle synchronization may be accomplished by sorting cells for a certain common phenotype.
- the cell population may be subjected to a treatment with a reagent that can stall cell cycle progression of all cells at a certain stage.
- Exemplary reagents can be found in commercial databases, such as www.tocris.com/cell-biology/cell-cycle-inhibitors, or www.scbt.com/browse/chemicals-Other- Chemicals-cell-cycle-arresting-compounds.
- itraconazole or nocodazole inhibits cell cycle at G1 phase, or reagents that arrest cell cycle at G0/G1 phase, for example, 5-[(4-Ethylphenyl)methylene]-2- thioxo-4-thiazolidinone (compound 10058-F4) (Tocris Bioscience); or a G2M cell cycle blocker, such as AZD 5438 (chemical name, 4-[2-Methyl- 1 -( 1 -methylethyl)- 1 //-imidazol-5-yl]-A-[4- (methylsulfonyl)phenyl]-2-pyrimidinamine) which blocks cell cycle at G2M, G1 or S phases, to name a few.
- AZD 5438 chemical name, 4-[2-Methyl- 1 -( 1 -methylethyl)- 1 //-imidazol-5-yl]-A-[4- (methylsulfonyl)phenyl]-2-pyr
- Cyclosporin, hydroxyurea, thymidine are well known reagents that can cause cell cycle arrests. Some reagents may irreversibly alter a cell state or may be toxic for the cells. Serum deprivation of cells for about 2-16 hours prior to electroporation or transfection, depending on the cell type, may also be an easy and reversible strategy for cell synchronization.
- retrotransposition efficiency may be increased by encouraging generation of DNA double stranded breaks to a cell that has been transfected with or electroporated with the retrotransposition constructs as described herein and/or modulating the DNA repair machinery.
- Application of these techniques may be limited depending on end uses of the cell that would undergo the genetic manipulation ex vivo for stable incorporation of a nucleic acid sequence by this method. In some cases, use of such techniques may be contemplated where robust expression of the protein or transcript encoded by the incorporated nucleic acid is expected as an outcome for a determined period of time.
- Method of introducing double stranded breaks in a cell include subjecting the cell to controlled ionizing radiation of about 0.1 Gy or less for a short period.
- efficiency of LINE-1 mediated retrotransposition may be increased by treating the cell with small molecule inhibitors of DNA repair proteins to increase the window for the reverse transcriptase to act.
- Exemplary small molecule inhibitors of DNA repair proteins may be Benzamide (CAS 55-21-0), Olaparib (Lynparza) (CAS 763113-22-0), Rucaparib (Clovis -AG014699, PF- 01367338 Pfizer), Nirapanb (MK- 827 Tesaro) CAS 1038915-60- 4); Vehparib (ABT-888 Abbvie) (CAS 912444-00-9); Camptothecm (CPT) (CAS 7689-03-4); Irmotecan (CAS 100286-90-6); Topotecan (Hycamtm® GlaxoSmithKline) (CAS 123948-87-8); NSC 19630 (CAS 72835-26-8); NSC 617145 (CAS 203115-63-3); ML216 (CAS 55-21-0), Olaparib (
- the transgene or noncoding sequence that is the heterologous nucleic acid sequence to be inserted within the genome of a cell is delivered as an mRNA.
- the mRNA may comprise greater than about 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, 10,000 bases.
- the mRNA may be more than 10,000 bases long.
- the mRNA may be about 11,000 bases long.
- the mRNA may be about 12,000 bases long.
- the mRNA comprises a transgene sequence that encodes a fusion protein.
- the nucleic acid is delivered as a plasmid.
- the nucleic acid is delivered in the cell by transfection. In some embodiments, the nucleic acid is delivered in the cell by electroporation. In some embodiments, the transfection or electroporation is repeated more than once to enhance incorporation of the nucleic acid into the cell.
- the CFPs comprise: a PR subunit comprising: a transmembrane domain, and an intracellular domain comprising an intracellular signaling domain; and an extracellular domain comprising an antigen binding domain specific to an antigen of a target cell; wherein the transmembrane domain and the extracellular domain are operatively linked.
- the nucleic acid comprises a sequence encoding a chimeric fusion protein (CFP), the CFP comprising an extracellular domain comprising a CD5 binding domain, and a transmembrane domain operatively linked to the extracellular domain.
- the CD5 binding domain is a CD5 binding protein, such as an antigen binding fragment of an antibody, a Fab fragment, an scFv domain or an sdAb domain.
- the CD5 binding domain comprises an scFv comprising (i) a variable heavy chain (VH) sequence with at least 90% sequence identity to
- VL variable light chain sequence with at least 90% sequence identity to DIQMTQSPSSLSASVGDRVTITCRASQDINSYLSWFQQKPGKAPKTLIYRANRLESGVPSRFSGSG SGTDYTLTIS SLQYEDF GIYYCQQYDESPWTFGGGTKLEIK.
- the CFP further comprises an intracellular domain, wherein the intracellular domain comprises one or more intracellular signaling domains, and wherein a wild-type protein comprising the intracellular domain does not comprise the extracellular domain.
- the one or more intracellular signaling domains comprises a phagocytic signaling domain.
- the phagocytosis signaling domain comprises an intracellular signaling domain derived from a receptor other than Megfl 0, MerTk, FcaR, and Bai 1.
- the phagocytosis signaling domain comprises an intracellular signaling domain derived from FcyR, FcaR or FcsR.
- the phagocytosis signaling domain comprises an intracellular signaling domain with at least 90% sequence identity to LY CRRLKIQ VRKAAIT S YEKSDGVYT GLSTRN QETYETLKHEKPP.
- the one or more intracellular signaling domains further comprises a proinflammatory signaling domain.
- the proinflammatory signaling domain comprises a PI3 -kinase (PI3K) recruitment domain.
- the proinflammatory signaling domain comprises a sequence with at least 90% sequence identity to YEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENM.
- the proinflammatory signaling domain is derived from an intracellular signaling domain of CD40.
- the proinflammatory signaling domain comprises a sequence with at least 90% sequence identity to
- the transmembrane domain comprises a CD8 transmembrane domain. In some embodiments, the transmembrane domain comprises a sequence with at least 90% sequence identity to IYIWAPLAGTCGVLLLSLVIT. In some embodiments, the extracellular domain further comprises a hinge domain derived from CD8, wherein the hinge domain is operatively linked to the transmembrane domain and the CD5 binding domain. In some embodiments, the extracellular domain comprises a sequence with at least 90% sequence identity to
- the CFP comprises an extracellular domain comprising a scFv that specifically binds CD5, and a hinge domain derived from CD8; a hinge domain derived from CD28 or at least a portion of an extracellular domain from CD68; a CD8 transmembrane domain, a CD28 transmembrane domain or a CD68 transmembrane domain; and an intracellular domain comprising at least two intracellular signaling domains, wherein the at least two intracellular signaling domains comprise: a first intracellular signaling domain derived from FcyR or FcsR, and a second intracellular signaling domain comprising a PI3K recruitment domain, or derived from CD40.
- the recombinant polynucleic acid is an mRNA or circRNA.
- the nucleic acid is delivered into a myeloid cell.
- the nucleic acid is delivered into a CD14+ cell, a CD14+CD16- cell, an MO macrophage, an M2 macrophage, an Ml macrophage or a mosaic myeloid cell/macrophage.
- the fusion protein comprises a sequence with at least 90% sequence identity to EIQLVQSGGGLVKPGGSVRISCAASGYTFTNYGMNWVRQAPGKGLEWMGWINTHTGEPTYAD SFKGRFTFSLDD SKNT A YLQIN SLRAEDT A VYF CTRRGYD WYFD VWGQGTTVTV S S GGGGSGG GGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDINSYLSWFQQKPGKAPKTLIYRANRLESG VPSRFSGSGSGTDYTLTISSLQYEDFGIYYCQQYDESPWTFGGGTKLEIKSGGGGSGALSNSIMYF SHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDIYIWAPLAGTCGV LLLSLVITLYCRRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQGSGSYEDMRGI L
- the fusion protein is a transmembrane protein, an intracellular protein or an intracellular protein.
- the fusion protein is directed to enhancing the function of an immune cell, e.g., a myeloid cell, selected from monocyte, macrophages dendritic cells or precursors thereof.
- the fusion protein augments a cellular function of an immune cell, such as phagocytosis.
- the disclosure is not limited by the transgenes that can be expressed using the methods and compositions described.
- the transgenes indicated in this section are exemplary.
- Provided herein are exemplary transgene candidates, for stable integration into the genome of a phagocytic cell.
- the transgene is a recombinant nucleic acid encoding a phagocytic receptor (PR) fusion protein (CFP).
- the recombinant nucleic acid has a PR subunit comprising: (i) a transmembrane domain, and (ii) an intracellular domain comprising a phagocytic receptor intracellular signaling domain; and an extracellular antigen binding domain specific to an antigen of a target cell; wherein the transmembrane domain and the extracellular antigen binding domain are operatively linked such that antigen binding to the target by the extracellular antigen binding domain of the fused receptor activated in the intracellular signaling domain of the phagocytic receptor.
- the recombinant nucleic acid encodes a chimeric antigen receptor.
- the chimeric antigen receptor is a chimeric antigen receptor (phagocytosis) (CAR-P).
- the fusion protein is a recombinant protein for locking anti-phagocytic signals.
- the fusion protein is a phagocytosis enhancing chimeric protein.
- the chimeric protein has intracellular domains comprising active phagocytosis signal transduction domains.
- the chimeric protein enhances the phagocytic potential by enhancing the inflammatory potential of the phagocytic cell in which it expresses.
- the transgene is designed to express a chimeric protein which is activated by contact with an antigen in a target cell, whereupon the phagocytic cell phagocytoses the target cell and kills the target cell.
- spacer or "linker” as used in reference to a fusion protein refers to a peptide sequence that joins the protein domains of a fusion protein.
- a spacer has no specific biological activity other than to join or to preserve some minimum distance or other spatial relationship between the proteins or RNA sequences.
- the constituent amino acids of a spacer can be selected to influence some property of the molecule such as the folding, net charge, or hydrophobicity of the molecule.
- Suitable linkers for use in an embodiment of the present disclosure are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers.
- the linker is used to separate two antigenic peptides by a distance sufficient to ensure that, in some embodiments, each antigenic peptide properly folds.
- Exemplary peptide linker sequences adopt a flexible extended conformation and do not exhibit a propensity for developing an ordered secondary structure.
- Typical amino acids in flexible protein regions include Gly, Asn and Ser. Virtually any permutation of amino acid sequences containing Gly, Asn and Ser would be expected to satisfy the above criteria for a linker sequence.
- Other near neutral amino acids, such as Thr and Ala also can be used in the linker sequence.
- the PSP subunit comprises a transmembrane (TM) domain of a phagocytic receptor.
- the PSP subunit comprises an ICD domain of a phagocytic receptor.
- the ICD encoded by the recombinant nucleic acid comprises a domain selected from the group consisting of lectin, dectin 1, mannose receptor (CD206), scavenger receptor A1 (SRA1), MARCO, CD36, CD163, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, CD68, OLR1, SCARF 1, SCARF2, CXCL16, STABl, STAB2, SRCRB4D, SSC5D, CD205, CD207, CD209, RAGE, CD 14, CD64, F4/80, CCR2, CX3CR1, CSF1R, Tie2, HuCRIg(L), and CD169 receptor.
- the ICD comprises the signaling domain derived from any one or more of: lectin, dectin 1, mannose receptor (CD206), scavenger receptor A1 (SRA1), MARCO (Macrophage Receptor with Collagenous Structure, aliases: SRA6, SCARA2), CD36 (Thrombospondin receptor, aliases: Scavenger Receptor class B, member 3), CD163 (Scavenger receptor, cysteine rich- type 1), MSR1, SCARA3, COLEC12 (aliases: Scavenger Receptor With C-Type Lectin, SCARA4, or Collectin 12), SCARA5, SCARBl, SCARB2, CD68 (SCARD, microsialin), OLR1 (Oxidized Low Density Lipoprotein Receptor 1, LOX1, or C-Type Lectin Domain Family 8 Member A), SCARF1, SCARL2, SRCRB4D, SSC5D, and CD169 (aliases
- the recombinant nucleic acid encodes, for example, an intracellular domain of human MARCO.
- the PSR subunit comprises an intracellular domain having a 44 amino acid ICD of human MARCO having an amino acid sequence:
- the PSR subunit comprises a variant which is at least 70%, 75%, 80%, 85%, 90% or 95% identical to the intracellular domain of MARCO.
- the PSR phagocytic scavenger receptor
- the PSR comprises a transmembrane region of human MARCO.
- the recombinant nucleic acid encodes an intracellular domain of human SRA1.
- the PSR subunit comprises an intracellular domain having a 50 amino acid ICD of human SRA1 having an amino acid sequence: MEQWDHFHNQQEDTDSCSESVKLDARSMTA LLPPNPKNSPSLQEKLKSFK.
- the PSR subunit comprises a variant which is at least 70%, 75%, 80%, 85%, 90% or 95% identical to the intracellular domain of human SRA1.
- the intracellular region of SRA has a phosphorylation site.
- the PSR comprises a transmembrane region of human SRA1.
- the recombinant nucleic acid comprises an intracellular domain of CD36.
- the recombinant nucleic acid comprises a TM domain of CD36.
- Naturally occurring full length CD36 has two TM domains and two short intracellular domains, and an extracellular domain of CD36 binds to oxidized LDL.
- Both of the intracellular domains contain pairs of cysteines that are fatty acid acylated. It lacks known signaling domains (e.g. kinase, phosphatase, g-protein binding, or scaffolding domains).
- N-terminal cytoplasmic domain is extremely short (5-7 amino acid residues) and is closely associated with the internal leaflet of the plasma membrane.
- the carboxy-terminal domain contains 13 amino acids, containing a CXCX5K motif homologous to a region in the intracellular domain of CD4 and CD8 that is known to interact with signaling molecules.
- the intracellular domain of CD36 is capable of assembling a signaling complex that activates lyn kinases, MAP kinases and Focal Adhesion Kinases (FAK), and inactivation of src homology 2-containing phosphotyrosine phosphatase (SHP-2).
- GEFs guanine nucleotide exchange factors
- the recombinant nucleic acid encodes for example, an intracellular domain of human SCARA3.
- the PSR subunit comprises a variant which is at least 70%, 75%, 80%, 85%, 90% or 95% identical to the intracellular domain of human SCARA3.
- the PSR comprises the TM domain of SCARA3.
- the TM domains are about 20-30 amino acids long.
- Scavenger receptors may occur as homo or hetero dimers.
- MARCO for example occurs as a homo trimer.
- the TM domain or the ICD domain of the PSP is not derived from FcR, MegflO, Bail or MerTK.
- the ICD of the PSR does not comprise a CD3 zeta intracellular domain.
- the intracellular domain and transmembrane domains are derived from FcR beta.
- the recombinant nucleic acid encodes a chimeric antigenic receptor for enhanced phagocytosis (CAR-P), which is a phagocytic scavenger receptor (PSR) fusion protein (CFP) comprising: (a) an extracellular domain comprising an extracellular antigen binding domain specific to an antigen of a target cell, (b) a transmembrane domain, and (c) a recombinant PSR intracellular signaling domain, wherein the recombinant PSR intracellular signaling domain comprises a first portion derived from a phagocytic and a second portion derived from non-phagocytic receptor.
- CAR-P a chimeric antigenic receptor for enhanced phagocytosis
- PSR phagocytic scavenger receptor
- CFP fusion protein
- the second portion is not a PI3K recruitment domain. In some embodiments, the second portion is a PI3K recruitment domain.
- the second portion derived from non-phagocytic receptor may comprise an intracellular signaling domain that enhances phagocytosis, and/or inflammatory potential of the engineered phagocytic cells expressing the recombinant nucleic acid.
- the second portion derived from non- phagocytic receptor comprises more than one intracellular domain (ICD).
- the second portion derived from non-phagocytic receptor comprises a second ICD.
- the second portion derived from non-phagocytic receptor comprises a second and a third ICD.
- the second portion derived from non-phagocytic receptor comprises a second, a third and a fourth ICD, wherein the second portion is encoded by the recombinant nucleic acid.
- the respective second portions comprising a second, or third or fourth ICD derived from non-phagocytic receptor are described as follows.
- the recombinant nucleic acid encodes a second intracellular domain in addition to the phagocytic ICD, which confers capability of potent pro-inflammatory immune activation, such as when macrophages engage in fighting infection.
- the second intracellular domain (second ICD) is fused to the cytoplasmic terminus of the first phagocytic ICD.
- the second intracellular domain provides a second signal is necessary to trigger inflammasomes and pro-inflammatory signals.
- NLRs Nod-like receptors
- the tumor microenvironment constitutes an immunosuppressive environment. Influence of IL-10, glucocorticoid hormones, apoptotic cells, and immune complexes can interfere with innate immune cell function. Immune cells, including phagocytic cells settle into a tolerogenic phenotype. In macrophages, this phenotype, commonly known as the M2 phenotype is distinct from the Ml phenotype, where the macrophages are potent and capable of killing pathogens.
- Macrophages exposed to LPS or IFN- gamma can polarize towards an Ml phenotype, whereas macrophages exposed to IL-4 or IL- 13 will polarize towards an M2 phenotype.
- LPS or IFN-gamma can interact with Toll-like receptor 4 (TLR4) on the surface of macrophages inducing the Trif and MyD88 pathways, inducing the activation of transcription factors IRF3, AP-1, and NFKB and thus activating TNFs genes, interferon genes, CXCL10, NOS2, IL-12, etc., which are necessary in a pro-inflammatory Ml macrophage response.
- TLR4 Toll-like receptor 4
- IL-4 and IL-13 bind to IL-4R, activation the Jak/Stat6 pathway, which regulates the expression of CCL17, ARGl, IRF4, IL-10, SOCS3, etc., which are genes associated with an anti-inflammatory response (M2 response).
- Expression of CD14, CD80, D206 and low expression of CD163 are indicators of macrophage polarization towards the Ml phenotype.
- the recombinant nucleic acid encodes one or more additional intracellular domains, comprising a cytoplasmic domain for inflammatory response.
- expression of the recombinant nucleic acid encoding the phagocytic receptor (PR) fusion protein (CFP) comprising the cytoplasmic domain for inflammatory response in the engineered macrophages confers potent pro- inflammatory response similar to the Ml phenotype.
- PR phagocytic receptor
- CFP fusion protein
- the cytoplasmic domain for inflammatory response can be the signal transducing domains or regions of TLR3, 4, 9, MYD88, TRIF, RIG-1, MDA5, CD40, IFN receptor, NLRP- 1 - 14, NODI, NOD2, Pyrin, AIM2, NLRC4, CD40.
- the expression of the recombinant nucleic acid encoding the phagocytic scavenger receptor (PSR) fusion protein (CFP) comprises a pro-inflammatory cytoplasmic domain for activation of IL-1 signaling cascade.
- the cytoplasmic portion of the chimeric receptor comprises a cytoplasmic domain from a toll-like receptor, such as the intracellular signaling domains of toll-like receptor 3 (TLR3), toll-like receptor 4 (TLR4), toll-like receptor 7 (TLR7), toll-like receptor 8 (TLR8), toll-like receptor 9 (TLR9).
- a toll-like receptor such as the intracellular signaling domains of toll-like receptor 3 (TLR3), toll-like receptor 4 (TLR4), toll-like receptor 7 (TLR7), toll-like receptor 8 (TLR8), toll-like receptor 9 (TLR9).
- the cytoplasmic portion of the chimeric receptor comprises a suitable region from interleukin-1 receptor-associated kinase 1 (IRAKI )._In some embodiments, the cytoplasmic portion of the chimeric receptor comprises a suitable region from differentiation primary response protein (MYD88)._In some embodiments, the cytoplasmic portion of the chimeric receptor comprises a suitable region from myelin and lymphocyte protein (MAL). In some embodiments, the cytoplasmic portion of the chimeric receptor comprises a suitable region from retinoic acid inducible gene (RIG-1).
- IRAKI interleukin-1 receptor-associated kinase 1
- MYD88 differentiation primary response protein
- MAL myelin and lymphocyte protein
- the cytoplasmic portion of the chimeric receptor comprises a suitable region from retinoic acid inducible gene (RIG-1).
- the transmembrane domain of the PSR comprises the transmembrane domain of any one of MYD88, TLR3, TLR4, TLR7, TLR8, TLR9, MAL, IRAKI, proteins.
- the recombinant PSR intracellular signaling domain comprises a first portion derived from a phagocytic and a second portion derived from non-phagocytic receptor wherein the second portion derived from non-phagocytic receptor comprises a phosphorylation site.
- the phosphorylation site comprises amino acid sequences suitable for an autophosphorylation site.
- the phosphorylation site comprises amino acid sequences suitable phosphorylation by Src family kinases.
- the phosphorylation site comprises amino acid sequences, which upon phosphorylation are capable of binding to SH2 domains in a kinase.
- a receptor tyrosine kinase domain is fused at the cytoplasmic end of the CFP in addition to the first cytoplasmic portion.
- the phosphorylation is a tyrosine phosphorylation.
- the second intracellular domain is an Immune receptor Tyrosine Activation Motif (ITAM).
- ITAM motif is present in mammalian a and b immunoglobulin proteins, TCR g receptors, FCR g receptors subunits, CD3 chains receptors and NFAT activation molecule.
- the CFP intracellular domain comprises one ITAM motif. In some embodiments, the CFP intracellular domain comprises more than one ITAM motifs. In some embodiments, the CFP intracellular domain comprises two or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises three or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises four or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises five or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises six or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises seven or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises eight or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises nine or more ITAM motifs. In some embodiments, the CFP intracellular domain comprises ten or more ITAM motifs.
- one or more domains in the first phagocytic ICD comprises a mutation.
- one or more domains in the second ICD comprises a mutation to enhance a kinase binding domain, to generate a phosphorylation site, to generate an SH2 docking site or a combination thereof.
- the recombinant nucleic acid comprises a coding sequence for a pro-inflammatory gene, which is co-expressed with the CFP in the engineered cell.
- the pro- inflammatory gene is a cytokine. Examples include but not limited to TNF-a, IL-la, IL-Ib, IL-6, CSF, GMCSF, or IL-12 or interferons.
- the recombinant nucleic acid encoding the proinflammatory gene can be monocistronic, wherein the two coding sequences for (a) the PSP and (b) the proinflammatory gene are post-transcriptionally or post-translationally cleaved for independent expression.
- the two coding sequences comprise a self-cleavage domain, encoding a P2A sequence, for example.
- the two coding regions are separated by an IRES site.
- the two coding sequences are encoded by a bicistronic genetic element.
- the coding regions for (a) the PSP and (b) the proinflammatory gene can be unidirectional, where each is under a separate regulatory control. In some embodiments, the coding regions for both are bidirectional and drive in opposite directions. Each coding sequence is under a separate regulatory control.
- Coexpression of the proinflammatory gene is designed to confer strong inflammatory stimulation of the macrophage and activate the surrounding tissue for inflammation.
- Each subunit is a type I transmembrane glycoprotein that has relatively large extracellular domains and, with the exception of the b4 subunit, a short cytoplasmic tail.
- Individual integrin family members have the ability to recognize multiple ligands. Integrins can bind to a large number of extracellular matrix proteins (bone matrix proteins, collagens, fibronectins, fibrinogen, laminins, thrombospondins, vitronectin, and von Willebrand factor), reflecting the primary function of integrins in cell adhesion to extracellular matrices. Many "counter-receptors" are ligands, reflecting the role of integrins in mediating cell-cell interactions. Integrins undergo conformational changes to increase ligand affinity.
- the Integrin b2 subfamily consists of four different integrin receptors, ow 2 (CD1 lb/CD18, Mac- 1, CR3, Mo-1), ai 3 2 (CDlla/CD18, LFA-1), a c b 2 (CDllc/CD18), and aob 2 (CDlld/CD18).
- These leukocyte integrins are involved in virtually every aspect of leukocyte function, including the immune response, adhesion to and transmigration through the endothelium, phagocytosis of pathogens, and leukocyte activation.
- the a subunits of all b2 integrins contain an inserted region of ⁇ 200 amino acids, termed the I or A domain. Highly conserved I domains are found in several other integrin a subunits and other proteins, such as certain coagulation and complement proteins. I domains mediate protein-protein interactions, and in integrins, they are integrally involved in the binding of protein ligands. Although the I domains dominate the ligand binding functions of their integrins, other regions of the a subunits do influence ligand recognition.
- a mAb (OKM1) recognizing an epitope outside the I domain but in the (X M subunit inhibits ligand binding; and the EF-hand regions in a.i_b2 and O ⁇ bi, integrins with I domains in their a subunits, contribute to ligand recognition.
- the (XM subunit, and perhaps other a subunits, contains a lectin-like domain, which is involved in engagement of non-protein ligands, and occupancy may modulate the function of the I domain.
- integrins lack enzymatic activity
- signaling is instead induced by the assembly of signaling complexes on the cytoplasmic face of the plasma membrane. Formation of these complexes is achieved in two ways; first, by receptor clustering, which increases the avidity of molecular interactions thereby increasing the on-rate of binding of effector molecules, and second, by induction of conformational changes in receptors that creates or exposes effector binding sites.
- receptor clustering which increases the avidity of molecular interactions thereby increasing the on-rate of binding of effector molecules
- induction of conformational changes in receptors that creates or exposes effector binding sites Within the ECM, integrins have the ability to bind fibronectin, laminins, collagens, tenascin, vitronectin and thrombospondin. Clusters of integrin/ECM interactions form focal adhesions, concentrating cytoskeletal components and signaling molecules within the cell.
- the cytoplasmic tail of integrins serve as a binding site for a-actinin and talin which then recruit vinculin, a protein involved in anchoring F-actin to the membrane.
- Talin is activated by kinases such as protein kinase C (PKCa).
- PKCa protein kinase C
- Integrins are activated by selectins.
- Feucocytes express F-selectin
- activated platelets express P- selectin
- activated endothelial cells express E- and P-selectin.
- P-selectin-mediated adhesion enables chemokine- or platelet-activating factor-triggered activation of b2 integrins, which stabilizes adhesion. It also facilitates release of chemokines from adherent leucocytes.
- the cytoplasmic domain of P-selectin glycoprotein ligand 1 formed a constitutive complex with Nef-associated factor 1.
- Src kinases After binding of P- selectin, Src kinases phosphorylated Nef-associated factor 1, which recruit the phosphoinositide-3-OH kinase p85-pl 105 heterodimer and result in activation of leukocyte integrins. E-selectin ligands transduce signals that also affect b2 integrin function. Selectins trigger activation of Src family kinases. SFKs activated by selectin engagement phosphorylate the immunoreceptor tyrosine-based activation motifs (IT AMs) in the cytoplasmic domains of DAP12 and FcRy. In some respects, CD44 is sufficient to transduce signals from E-selectin.
- IT AMs immunoreceptor tyrosine-based activation motifs
- CD44 triggers the inside-out signaling of integrins.
- a final common step in integrin activation is binding of talin to the cytoplasmic tail of the b subunit.
- Kindlins another group of cytoplasmic adaptors, bind to a different region of integrin b tails.
- Kindlins increase the clustering of talin-activated integrins.
- Kindlins are responsive to selectin signaling, however, kindlins are found mostly in hematopoietic cells, such as neutrophils.
- Selectin signaling as well as signaling upon integrin activation by chemokines components have shared components, including SFKs, Syk, and SLP-76.
- the intracellular domain of the recombinant PSR fusion protein comprises an integrin activation domain.
- the integrin activation domain comprises an intracellular domain of a selectin, for example, a P-selectin, L-selectin or E-selectin.
- the intracellular domain of the recombinant PSR fusion protein comprises an integrin activation domain of laminin.
- the intracellular domain of the recombinant PSR fusion protein comprises an integrin activation domain for activation of Talin.
- the intracellular domain of the recombinant PSR fusion protein comprises an integrin activation domain fused to the cytoplasmic end of the phagocytic receptor ICD domain.
- the recombinant nucleic acid encodes a domain capable of enabling cross presentation of antigens.
- MHC class I molecules present self- or pathogen-derived antigens that are synthesized within the cell, whereas exogenous antigens derived via endocytic uptake are loaded onto MHC class II molecules for presentation to CD4+ T cells.
- DC can process exogenous antigens into the MHC -I pathway for presentation to CD8+ T cells. This is referred to as cross presentation of antigens.
- Soluble or exogenous antigenic components may get degraded by lysosomal proteases in the vacuoles and cross presented by DCs, instead of following the endocytotic pathway.
- chaperones such as heat shock protein 90 (Hsp90) have shown to help cross present antigens by certain APCs.
- HSP-peptide complexes are known to be internalized by a distinct group of receptors compared to free polypeptides. These receptors are from the scavenger receptor families and included LOX-1, SREC-ESCARF-I, and FEELl/Stabilin-1.
- SREC-1 scavenger receptor expressed by endothelial cells
- SREC-1 has no significant homology to other types of scavenger receptors but has unique domain structures. It contains 10 repeats of EGF-like cysteine- rich motifs in the extracellular domain.
- SREC-I was shown to be similar to that of a transmembrane protein with 16 EGF-like repeats encoded by the Caenorhabdiiis elegans gene ced-I, which functions as a cell surface phagocytic receptor that recognizes apoptotic cells.
- the intracellular domain of the CFP comprises a SREC1 intracellular domain. In some embodiments, the intracellular domain of the CFP comprises a SRECII intracellular domain.
- the PSR subunit comprises: an intracellular domain comprising a PSR intracellular signaling domain from SRECl or SRECII.
- the PSR subunit comprises: (i) a transmembrane domain, and (ii) an intracellular domain comprising a PSR intracellular signaling domain from SRECl or SRECII.
- the PSR subunit comprises: (i) a transmembrane domain, (ii) an intracellular domain comprising a PSR intracellular signaling domain, and (iii) an extracellular domain from SRECl or SRECII.
- the TM encoded by the recombinant nucleic acid comprises a domain of a scavenger receptor (SR).
- the TM can be the TM domain of or derived from any one or more of: lectin, dectin 1, mannose receptor (CD206), SRA1, MARCO, CD36, CD163, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, CD68, OLR1, SCARF1, SCARF2, SRCRB4D, SSC5D, and CD169.
- the TM domains are about 20-30 amino acids long.
- TM domains of SRs are about 20-30 amino acids long.
- the TM domain or the ICD domain of the PSP is not derived from MegflO, Bail or MerTK.
- the ICD of the PSR does not comprise a CD3 zeta intracellular domain.
- the TM is derived from the same phagocytic receptor as the ICD.
- the TM region is derived from a plasma membrane protein.
- the TM can be selected from an Fc receptor (FcR).
- FcR Fc receptor
- nucleic acid sequence encoding domains from specific FcRs are used for cell-specific expression of a recombinant construct.
- An FCR-alpha region comprising the TM domain may be used for macrophage specific expression of the construct.
- FcRp recombinant protein expresses in mast cells.
- the CFP comprises the TM of an FCR-beta (FcRP).
- the CFP comprises both the FcRp TM and ICD domains.
- the TM domain is derived from CD8.
- the TM is derived from CD2.
- the TM is derived from FCR alpha.
- the extracellular domain comprises an antigen binding domain that binds to one or more target antigens on a target cell.
- the target binding domain is specific for the target.
- the extracellular domain can include an antibody or an antigen-binding domain selected from intrabodies, peptibodies, nanobodies, single domain antibodies. SMIPs, and multispecific antibodies.
- the extracellular domain includes a Fab binding domain. In yet other such embodiments, the extracellular domain includes a scFv.
- the chimeric antigen receptor comprises an extracellular antigen binding domain is derived from the group consisting of an antigen-binding fragment (Fab), a single-chain variable fragment (scFv), a nanobody, a VH domain, a VL domain, a single domain antibody (sdAb), a VNAR domain, and a VHH domain, a bispecific antibody, a diabody, or a functional fragment of any thereof.
- Fab antigen-binding fragment
- scFv single-chain variable fragment
- nanobody a VH domain, a VL domain, a single domain antibody (sdAb), a VNAR domain, and a VHH domain, a bispecific antibody, a diabody, or a functional fragment of any thereof.
- the antigen-binding fragment Fab
- a single-chain variable fragment scFv
- a nanobody a VH domain, a VL domain, a single domain antibody (sdAb), a VNAR domain, and a VHH domain, a bispecific antibody, a diabody, or a functional fragment of any thereof specifically bind to one or more antigens.
- the antigens are cancer antigens
- the target cell is a target cancer cell.
- the antigen for a target cancer cell is selected from the group consisting of CD3, CD4, CD5, CD7, CD19, CCR2, CCR4, CD30, CD37, TCRBl/2, TCR ⁇ ⁇ , TCR ⁇ ⁇ .
- cancer antigen targets can be selected from cancer antigens known to one of skill in the art. Depending on the cancer and the cell type involved cancer antigens are mutated native proteins. The antigen binding domains are screened for specificity towards mutated/cancer antigens and not the native antigens.
- the cancer antigen for a target cancer cell can be one or more of the mutated/cancer antigens: MUC16, CCAT2, CTAG1A, CTAG1B, MAGE Al, MAGEA2, MAGE A3, MAGE A4, MAGEA6, PRAME, PC A3, MAGE Cl, MAGEC2, MAGED2, AFP, MAGEA8, MAGE9, MAGEAll, MAGEA12, IL13RA2, PLAC1, SDCCAG8, LSP1, CT45A1, CT45A2, CT45A3, CT45A5, CT45A6, CT45A8, CT45A10, CT47A1, CT47A2, CT47A3, CT47A4, CT47A5, CT47A6, CT47A8, CT47A9, CT47A10, CT47A11, CT47A12, CT47B1, SAGE1, and CT55.
- the mutated/cancer antigens MUC16, CCAT2, CTAG1A, CTAG1B, MAGE Al, MAGEA2, MAGE A3, MAGE A4, MAGEA6,
- the cancer antigen for a target cancer cell can be one or more of the mutated/cancer antigens: CD2, CD3, CD4, CD5, CD7, CD8, CD20, CD30, CD45, CD56, where the cancer is a T cell lymphoma.
- the cancer antigen for a target cancer cell can be one or more of the mutated/cancer antigens: IDHl, ATRX, PRL3, or ETBR, where the cancer is a glioblastoma.
- the cancer antigen for a target cancer cell can be one or more of the mutated/cancer antigens: CA125, beta-hCG, urinary gonadotropin fragment, AFP, CEA, SCC, inhibin or extradiol, where the cancer is ovarian cancer.
- the cancer antigen for a target cancer cell may be HER2.
- the cancer antigen for a target cancer cell may be EGFR Variant PI.
- the cancer antigen for a target cancer cell may be CD 19.
- the SR subunit region comprises an extracellular domain (ECD) of the scavenger receptor.
- ECD of the scavenger receptor comprises an ECD domain of the SR comprising the ICD and the TM domains.
- the SR-ECD contributes to the binding of the phagocyte to the target cell, and in turn is activated, and activates the phagocytosis of the target cell.
- the PSR domain optionally comprises the ECD domain or portion thereof of the respective scavenger receptor the ICD and TM domains of which is incorporated in the PSR. Therefore, in some embodiments, the ECD encoded by the recombinant nucleic acid comprises a domain selected from the group consisting of lectin, dectin 1, mannose receptor (CD206), scavenger receptor A1 (SRA1), MARCO, CD36, CD163, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, CD68, OLR1, SCARF1, SCARF2, CXCL16, STAB1, STAB2, SRCRB4D, SSC5D, CD205, CD207, CD209, RAGE, CD14, CD64, F4/80, CCR2, CX3CR1, CSF1R, Tie2, HuCRIg(L), and CD169 receptor.
- lectin dectin 1, mannose receptor (CD206), scavenger receptor A1 (SRA1),
- the extracellular domains of most macrophage scavenger receptors contain scavenger receptors with a broad binding specificity that may be used to discriminate between self and non-self in the nonspecific antibody-independent recognition of foreign substances.
- the type I and II class A scavenger receptors (SR-AI1 and SR-AII) are trimeric membrane glycoproteins with a small NH2-terminal intracellular domain, and an extracellular portion containing a short spacer domain, an a-helical coiled-coil domain, and a triple-helical collagenous domain.
- the type I receptor additionally contains a cysteine-rich COOH-terminal (SRCR) domain.
- the SR ECD is designed to bind to pro-apoptotic cells.
- the scavenger receptor ECD comprises a binding domain for a cell surface molecule of a cancer cell or an infected cell.
- the extracellular domain of the PR subunit is linked by a linker to a target cell binding domain, such as an antibody or part thereof, specific for a cancer antigen.
- the extracellular antigen binding domain comprises one antigen binding domain. In some embodiments, the extracellular antigen binding domain comprises more than one binding domain. In some embodiments, the binding domain is an scFv. In some embodiments, the binding domain is an single domain antibody (sdAb). In some embodiments, the binding domain is fused to the recombinant PR at the extracellular domain. In some embodiments, the binding domain (e.g., scFv) and the extracellular domain of the PR are linked via a linker.
- the ECD antigen binding domain can bind to an intracellular antigen.
- the intracellular antigen is a cancer antigen.
- the extracellular antigen binding domain binds to the target ligand with an affinity of less than 1000 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 500 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 450 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 400 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 350 nM.
- the extracellular antigen binding domain binds to the target ligand with an affinity of less than 250 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 200 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity of less than 100 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity ranging between than 200 nM to 1000 nM. In some embodiments, the extracellular antigen binding domain binds to the target ligand with an affinity ranging between than 300 nM to 1.5 mM. In some embodiments, the antigen binding domain binds to the target ligand with an affinity > 200 nM, > 300 nM or >500 nM.
- the extracellular antigen binding domains, scfvs are linked to the TM domain or other extracellular domains by a linker. In some embodiments, where there are more than one scfv at the extracellular antigen binding domain the more than scfvs are linked with each other by linkers.
- the linkers are flexible. In some embodiments, the linkers comprise a hinge region. Linkers are usually short peptide sequences. In some embodiments, the linkers are stretches of Glycine and one or more Serine residues.
- amino acids preferred for short peptide linkers include but are not limited to threonine (Thr), serine (Ser), proline (Pro), glycine (Gly), aspartic acid (Asp), lysine (Lys), glutamine (Gin), asparagine (Asn), and alanine (Ala) arginine (Arg), phenylalanine (Phe), glutamic acid (Glu).
- Thr threonine
- Ser serine
- Pro proline
- Gly aspartic acid
- Als aspartic acid
- Lys glutamine
- Asparagine Asparagine
- Al alanine
- Arg arginine
- Phe phenylalanine
- glutamic acid glutamic acid
- Pro-rich sequences are used as interdomain linkers, including the linker between the lipoyl and E3 binding domain in pyruvate dehydrogenase (GA 2 PA 3 PAKQEA 3 PAPA 2 KAEAPA 3 PA 2 KA).
- the empirical linkers may be flexible linkers, rigid linkers, and cleavable linkers. Sequences such as (G4S)x (where x is multiple copies of the moiety, designated as 1, 2, 3, 4, and so on) comprise a flexible linker sequence. Other flexible sequences used herein include several repeats of glycine, e.g., (Gly)6 or (Gly)8.
- a rigid linker may be used, for example, a linker (EAAAK)x, where x is an integer, 1, 2, 3, 4 etc. gives rise to a rigid linker.
- the linker comprises at least 2, or at least 3 amino acids. In some embodiments, the linker comprises 4 amino acids. In some embodiments, the linker comprises 5 amino acids. In some embodiments, the linker comprises 6 amino acids. In some embodiments, the linker comprises 7 amino acids. In some embodiments, the linker comprises 8 amino acids. In some embodiments, the linker comprises 9 amino acids. In some embodiments, the linker comprises 8 amino acids. In some embodiments, the linker comprises 10 amino acids. In some embodiments, the linker comprises 11 amino acids. In some embodiments, the linker comprises 12 amino acids. In some embodiments, the linker comprises 13 amino acids. In some embodiments, the linker comprises 14 amino acids.
- the linker comprises 15 amino acids. In some embodiments, the linker comprises 16 amino acids. In some embodiments, the linker comprises 17 amino acids. In some embodiments, the linker comprises 18 amino acids. In some embodiments, the linker comprises 19 amino acids. In some embodiments, the linker comprises 20 amino acids.
- any suitable ECD, TM or ICD domain can be cloned interchangeably in the suitable portion of any one of the CARP receptors described in the disclosure to obtain a protein with enhanced phagocytosis compared to an endogenous receptor.
- the CFP can structurally incorporates into the cell membrane of the cell in which it is expressed.
- Specific leader sequences in the nucleic acid construct, such as the signal peptide can be used to direct plasma membrane expression of the encoded protein.
- the transmembrane domain encoded by the construct can incorporate the expressed protein in the plasma membrane of the cell.
- the transmembrane domain comprises a TM domain of an FcRalpha receptor, which dimerizes with endogenous FcR-gamma receptors in the macrophages, ensuring macrophage specific expression.
- the CFP can render the cell that expresses it as potently phagocytic.
- the recombinant nucleic acid encoding the CFP is expressed in a cell, the cell can exhibit an increased phagocytosis of a target cell having the antigen of a target cell, compared to a cell not expressing the recombinant nucleic acid.
- the recombinant nucleic acid is expressed in a cell, the cell can exhibit an increased phagocytosis of a target cell having the antigen of a target cell, compared to a cell not expressing the recombinant nucleic acid.
- the recombinant nucleic acid when expressed in a cell the cell exhibits at least 2-fold increased phagocytosis of a target cell having the antigen of a target cell, compared to a cell not expressing the recombinant nucleic acid.
- the recombinant nucleic acid when expressed in a cell the cell exhibits at least 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold 30-fold or at least 5-fold increased phagocytosis of a target cell having the antigen of a target cell, compared to a cell not expressing the recombinant nucleic acid.
- SIRP-AICD enhances phagocytosis of the cell expressing it by 1.1 fold or more, 1.2 fold or more, 1.3 fold or more, q.4 fold or more, 1.5 fold or more, by 1.6 fold or more, 1.7 fold or more, 1.8 fold or more, 1.9 fold or more, 2 fold or more, 3 fold or more, 4 fold or more, 5 fold or more, 8 fold or more, 10 fold or more, 15 fold or more, 20 fold or more, 30 fold or more, 40 fold or more, 50 fold or more, 60 fold or more, 70 fold or more 80 fold or more, 90 fold or more, 100 fold or more, compared to a cell not expressing SIRP-AICD.
- the cells co-expressing SIRP-AICD and a CFP encoding a phagocytic receptor as described herein exhibits an augmented phagocytosis compared to a cell that does not express either of the proteins.
- co-expressing SIRP-AICD and a CFP encoding a phagocytic receptor as described herein exhibits more than 2-fold, more than 3 -fold, more than 4-fold, more than 5- fold, more than 6-fold, more than 7-fold, more than 8-fold, more than 9-fold, more than 10-fold, more than 20-fold, more than 30-fold, more than 40-fold, more than 50-fold, more than 60-fold, more than 70-fold, more than 80-fold, more than 90-fold, more than 100-fold, or more than 150-fold or more than 200-fold increase in phagocytic potential (measured in fold change of phagocytic index) compared to a cell that does not express either the SIRP-AICD or the CFP encoding a phagocytic receptor.
- expression of the any one of a CFP expressing a CD47 blocking extracellular domain of SIRPa and an intracellular domain of a phagocytic receptor augments phagocytic activity of a cell expressing it by at least 1.5 fold or more, 1.6 fold or more, 1.7 fold or more, 1.8 fold or more, 1.9 fold or more, 2 fold or more, 3 fold or more, 4 fold or more, 5 fold or more, 8 fold or more, 10 fold or more, 15 fold or more, 20 fold or more, 30 fold or more, 40 fold or more, 50 fold or more, 60 fold or more, 70 fold or more 80 fold or more, 90 fold or more, 100 fold or more, compared to a cell not expressing the CFP, or compared to a cell expressing SIRP-AICD.
- the enhancement in phagocytosis of target cells by a cell expressing either SIRP-AICD is highly increased compared to a phagocytic cell not expressing SIRP-AICD.
- the enhancement in phagocytosis of target cells by a cell expressing a CFP comprising a CD47 blocking extracellular domain of SIRPa and an intracellular domain of a phagocytic receptor is highly increased compared to a control phagocytic cell not expressing the fusion protein or a control phagocytic cell expressing the SIRP-AICD.
- the cell when the recombinant nucleic acid described herein is expressed in a cell, the cell exhibits an increased cytokine production.
- the cytokine can comprise any one of: IL-1, IL-6, IL- 12, IL-23 , TNF, CXCL9, CXCL10, CXCL11, IL-18, IL-23, IL-27 and interferons.
- the cell when the recombinant nucleic acid described herein is expressed in a cell, the cell exhibits an increased cell migration.
- the cell when the recombinant nucleic acid described herein is expressed in a cell, the cell exhibits an increased immune activity. In some embodiments, when the recombinant nucleic acid is expressed in a cell, the cell exhibits an increased expression of MHC II. In some embodiments, when the recombinant nucleic acid is expressed in a cell, the cell exhibits an increased expression of CD80. In some embodiments, when the recombinant nucleic acid is expressed in a cell, the cell exhibits an increased expression of CD86. In some embodiments, when the recombinant nucleic acid is expressed in a cell, the cell exhibits an increased iNOS production.
- the cell when the recombinant nucleic acid is expressed in a cell, the cell exhibits decreased trogocytosis of a target cell expressing the antigen of a target cell compared to a cell not expressing the recombinant nucleic acid.
- the chimeric receptors may be glycosylated, pegylated, and/or otherwise post- translationally modified.
- glycosylation, pegylation, and/or other posttranslational modifications may occur in vivo or in vitro and/or may be performed using chemical techniques.
- any glycosylation, pegylation and/or other posttranslational modifications may be N-linked or O-linked.
- any one of the chimeric receptors may be enzymatically or functionally active such that, when the extracellular domain is bound by a ligand, a signal is transduced to polarize a macrophage.
- the chimeric fusion protein comprises an extracellular domain (ECD) targeted to bind to CD5 (CD5 binding domain), for example, comprising a heavy chain variable region (VH) having an amino acid sequence as set forth in SEQ ID NO: 1.
- the chimeric CFP comprises a CD5 binding heavy chain variable domain comprising an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 1.
- the extracellular domain (ECD) targeted to bind to CD5 (CD5 binding domain) comprises a light chain variable domain (V L ) having an amino acid sequence as set forth in SEQ ID NO: 2.
- the chimeric CFP comprises a CD5 binding light chain variable domain comprising an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 2.
- the CFP comprises an extracellular domain targeted to bind to HER2 (HER2 binding domain) having for example a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO: 8 and a light chain variable domain amino acid sequence as set forth in SEQ ID NO: 9.
- the CFP comprises a HER2 binding heavy chain variable domain comprising an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 8.
- the CFP comprises a HER2 binding light chain variable domain comprising an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 9.
- the CFP comprises a hinge connecting the ECD to the transmembrane (TM).
- the hinge comprises the amino acid sequence of the hinge region of a CD8 receptor.
- the CFP may comprise a hinge having the amino acid sequence set forth in SEQ ID NO: 7 (CD8a chain hinge domain).
- the PFP hinge region comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 7.
- the CFP comprises a CD8 transmembrane region, for example having an amino acid sequence set forth in SEQ ID NO: 6.
- the CFP TM region comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 6.
- the CFP comprises an intracellular domain having an FcR domain.
- the CFP comprises an FcR domain intracellular domain comprises an amino acid sequence set forth in SEQ ID NO: 3, or at least a sequence having 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 3.
- the CFP comprises an intracellular domain having a PI3K recruitment domain.
- the PI3K recruitment domain comprises an amino sequence set forth in SEQ ID NO: 4.
- the PI3K recruitment domain comprises an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 4.
- the CFP comprises an intracellular domain having a CD40 intracellular domain.
- the CD40 ICD comprises an amino sequence set forth in SEQ ID NO: 5.
- the CD40 ICD comprises an amino acid sequence that has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 5.
- the CD5 binding domain comprises an scFv comprising: (i) a variable heavy chain (V H ) sequence of SEQ ID NO: 1 or with at least 90% sequence identity to SEQ ID NO: 1; and (ii) a variable light chain (VL) sequence of SEQ ID NO: 2 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 2.
- V H variable heavy chain
- VL variable light chain
- the CD5 binding domain comprises an scFv comprising SEQ ID NO: 33 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 33.
- the HER2 binding domain comprises an scFv comprising: (i) a variable heavy chain (VH) sequence of SEQ ID NO: 8 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 8; and (ii) a variable light chain (VL) sequence of SEQ ID NO: 9 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 9.
- VH variable heavy chain
- VL variable light chain
- the CD5 binding domain comprises an scFv comprising SEQ ID NO: 32 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 32.
- the CFP further comprises an intracellular domain, wherein the intracellular domain comprises one or more intracellular signaling domains, and wherein a wild-type protein comprising the intracellular domain does not comprise the extracellular domain.
- the extracellular domain further comprises a hinge domain derived from CD8, wherein the hinge domain is operatively linked to the transmembrane domain and the anti-CD5 binding domain.
- the extracellular hinge domain comprises a sequence of SEQ ID NO: 7 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 7.
- the CFP comprises an extracellular domain fused to a transmembrane domain of SEQ ID NO: 30 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 30.
- the CFP comprises an extracellular domain fused to a transmembrane domain of SEQ ID NO: 31 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 31.
- the transmembrane domain comprises a CD8 transmembrane domain.
- the transmembrane domain comprises a sequence of SEQ ID NO: 6 or 29 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 6 or 29.
- the transmembrane domain comprises a sequence of SEQ ID NO: 18 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 18.
- the transmembrane domain comprises a sequence of SEQ ID NO: 34 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 34.
- the transmembrane domain comprises a sequence of SEQ ID NO: 19 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 19.
- the CFP comprises one or more intracellular signaling domains that comprise a phagocytic signaling domain.
- the phagocytosis signaling domain comprises an intracellular signaling domain derived from a receptor other than MegflO, MerTk, FcRa, and Bail.
- the phagocytosis signaling domain comprises an intracellular signaling domain derived from a receptor other than MegflO, MerTk, an FcR, and Bail.
- the phagocytosis signaling domain comprises an intracellular signaling domain derived from a receptor other than O ⁇ 3z.
- the phagocytosis signaling domain comprises an intracellular signaling domain derived from FcRy, FcRa or FcRs. In some embodiments, the phagocytosis signaling domain comprises an intracellular signaling domain derived from O ⁇ 3z. In some embodiments, the CFP comprises an intracellular signaling domain of any one of SEQ ID NOs: 3, 20, 27 and 28 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to any one of SEQ ID NOs: 3, 20, 27 and 28. In some embodiments, the one or more intracellular signaling domains further comprises a proinflammatory signaling domain.
- the proinflammatory signaling domain comprises a PI3 -kinase (PI3K) recruitment domain.
- the proinflammatory signaling domain comprises a sequence of SEQ ID NO: 4 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 4.
- the proinflammatory signaling domain is derived from an intracellular signaling domain of CD40.
- the proinflammatory signaling domain comprises a sequence of SEQ ID NO: 5 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 5.
- the CFP comprises an intracellular signaling domain of SEQ ID NO: 21 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 21.
- the CFP comprises an intracellular signaling domain of SEQ ID NO: 23 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 23.
- the CFP comprises a sequence of SEQ ID NO: 14 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 14.
- the CFP comprises a sequence of SEQ ID NO: 15 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 15.
- the CFP comprises a sequence of SEQ ID NO: 16 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 16.
- the CFP comprises a sequence of SEQ ID NO: 24 or with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 24.
- the CFP comprises a sequence of SEQ ID NO:25 or with at least 70%, 75%, 80%, 85%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO: 25.
- the CFP comprises: (a) an extracellular domain comprising: (i) a scFv that specifically binds CD5, and (ii) a hinge domain derived from CD8; a hinge domain derived from CD28 or at least a portion of an extracellular domain from CD68; (b) a CD8 transmembrane domain, a CD28 transmembrane domain, a CD2 transmembrane domain or a CD68 transmembrane domain; and (c) an intracellular domain comprising at least two intracellular signaling domains, wherein the at least two intracellular signaling domains comprise: (i) a first intracellular signaling domain derived from FcRa, FcRy or FcRs, and (ii) a second intracellular signaling domain: (A) comprising a PI3K recruitment domain, or (B) derived from CD40.
- an extracellular domain comprising: (i) a scFv that specifically binds CD5, and (ii) a hinge domain
- the CFP comprises as an alternative (c) to the above: an intracellular domain comprising at least two intracellular signaling domains, wherein the at least two intracellular signaling domains comprise: (i) a first intracellular signaling domain derived from a phagocytic receptor intracellular domain, and (ii) a second intracellular signaling domain derived from a scavenger receptor phagocytic receptor intracellular domain comprising: (A) comprising a PI3K recruitment domain, or (B) derived from CD40.
- Exemplary scavenger receptors from which an intracellular signaling domain may be derived may be found in Table 2.
- the CFP comprises and intracellular signaling domain derived from an intracellular signaling domain of an innate immune receptor.
- the recombinant polynucleic acid is an mRNA. In some embodiments, the recombinant polynucleic acid is a circRNA. In some embodiments, the recombinant polynucleic acid is a viral vector. In some embodiments, the recombinant polynucleic acid is delivered via a viral vector.
- the myeloid cell is a CD14+ cell, a CD14+/CD16- cell, a CD14+/CD16+ cell, a CD14-/CD16+ cell, CD14-/CD16- cell, a dendritic cell, an M0 macrophage, an M2 macrophage, an Ml macrophage or a mosaic myeloid cell/macrophage/dendritic cell.
- a method of treating cancer in a human subject in need thereof comprising administering a pharmaceutical composition to the human subject, the pharmaceutical composition comprising: (a) a myeloid cell comprising a recombinant polynucleic acid sequence, wherein the polynucleic acid sequence comprises a sequence encoding a chimeric fusion protein (CFP), the CFP comprising: (i) an extracellular domain comprising an anti-CD5 binding domain, and (ii) a transmembrane domain operatively linked to the extracellular domain; and (b) a pharmaceutically acceptable carrier; wherein the myeloid cell expresses the CFP.
- a myeloid cell comprising a recombinant polynucleic acid sequence
- the polynucleic acid sequence comprises a sequence encoding a chimeric fusion protein (CFP)
- the CFP comprising: (i) an extracellular domain comprising an anti-CD5 binding domain, and (ii) a transmembrane domain operatively linked
- a target cancer cell of the subject upon binding of the CFP to CD5 expressed by a target cancer cell of the subject killing or phagocytosis activity of the myeloid cell is increased by greater than 20% compared to a myeloid cell not expressing the CFP. In some embodiments, growth of a tumor is inhibited in the human subject.
- the cancer is a CD5+ cancer.
- the cancer is leukemia, T cell lymphoma, or B cell lymphoma.
- the CFP comprises one or more sequences shown in Table A and/or Table B below.
- Noncoding exogenous sequence for delivery and incorporation into the genome of a cell A noncoding sequence may be delivered into the cell and designed to be incorporated in the genome of the cell.
- the noncoding sequence as used herein is a sequence that does not result in a translated protein product, but may have regulatory elements, such as transcribed products, such as inhibitory RNA.
- such a sequence may be a miRNA sequence.
- the sequence may be a sequence for siRNA generation.
- the sequence may comprise an intronic sequence, or a binding site created, such that one or more DNA binding proteins can dock on the site and influence the nature and behavior of the adjoining regions.
- the sequence may be a transcription factor binding site.
- the sequence may comprise an enhancer binding site.
- the sequence may comprise a binding site for topoisomerase, gyrase, reverse transcriptase, polymerase, poly A binding protein, guanylyl cyclase, ligase, restriction enzymes, DNA methylase, HDAC enzymes, and many others.
- the noncoding sequence may be directed to manipulating heterochromatin.
- a noncoding insert sequence, as it may also be referred to here, may be a few nucleotides to 5 kB in length.
- the nucleic acid construct comprising one or more sequences encoding one or more proteins or polypeptides is incorporated in a plasmid for transcription and generating an mRNA.
- mRNA can be transcribed in an in vitro system using synthetic system of cell extracts. Alternatively, mRNA can be generated in a cell and harvested.
- the cell can be a prokaryotic cell, such as a bacterial cell. In some embodiments, the cell is a eukaryotic cell. In some embodiments, the transcription occurs in a synthetic system.
- a plasmid is designed for expression of the mRNA molecule comprising a heterologous sequence of interest that encodes a protein or a polypeptide.
- the plasmid comprises, inter alia, : the sequences for genomic integration elements for integration of the heterologous sequence of interest that encodes a protein or a polypeptide; the sequence comprising the transgene or fragment thereof, operably linked to its separate promoter and regulatory elements that are required for its expression in the host following integration in the host genome, (such as, the subject who is administered the mRNA); one or more regulatory elements for transcription and generation of the mRNA including a promoter for expression of the mRNA, e.g.
- a plasmid backbone can be an available vector, such as an in-house or commercially developed vector, that can be improved in various ways for best expression of the transcribed sequences, for example, (but not limited to), by introducing one or more desirable restriction digestion sites in the MCS (multiple cloning site), introducing a desired promoter for overall mRNA transcription, such as the T7 promoter, exchanging an existing sequence within the plasmid vector for one or more desired sequences, or introducing one or more desired segments, such as a selection marker sequence.
- the plasmid comprises transcription regulatory elements, such as a promoter at the 5’ region, and a 3 ’-stabilizing element.
- the promoter is chosen for enhanced mRNA transcription in the desired cell, such as an E coli bacterial cell.
- the promoter for transcription of the plasmid is selected from a T7 promoter, a Sp6 promoter, pL (lambda) promoter, T3 promoter, trp promoter, araBad promoter, lac promoter or a Ptac promoter.
- the promoter is a T7 promoter.
- T7 or Sp6 promoters are constitutive promoters and are useful for high level transcription or in vitro transcription.
- the 3’ stabilizing element is a sequence from BGH 3’ element, WPRE 3’ element, SV40 element, hGH element and other elements. The 3’ element comprises the necessary poly A and transcription termination sequences.
- Exemplary selection markers include antibiotic selection marker and/or expression detection marker.
- Antibiotic selection markers include but are not limited to ampicillin resistance gene sequence (beta lactamase gene or fragment thereof) conferring resistance to ampicillin, for example G418 selection marker, tetracycline resistance gene sequence conferring resistance to tetracycline, kanamycin resistance gene sequence conferring resistance to kanamycin, erythromycin resistance gene sequence conferring resistance to erythromycin, chloramphenicol resistance gene sequence conferring resistance to chloramphenicol, neomycin resistant gene sequence conferring resistance to neomycin, and others.
- Exemplary expression detection marker include FLAG, HA, GFP and others.
- the and other tags that can be fused to one or more coding sequences to function as a surrogate for the expression of the desired protein or peptide to which it is fused.
- the plasmid is less than 20 kb in length. In some embodiments, the plasmid is less than 19 kb in length. In some embodiments, the plasmid is less than 20 kb in length. In some embodiments, the plasmid is less than 18 kb in length. In some embodiments, the plasmid is less than 20 kb in length. In some embodiments, the plasmid is less than 17 kb in length. In some embodiments, the plasmid is less than 20 kb in length. In some embodiments, the plasmid is less than 16 kb in length. In some embodiments, the plasmid is less than 15 kb in length.
- the plasmid is less than 14 kb in length. In some embodiments, the plasmid is less than 13 kb in length. In some embodiments, the plasmid is less than 12 kb in length. In some embodiments, the plasmid is about 15 kb, about 14 kb, about 13 kb, about 12 kb or about 10 kb in length. [00429] In some embodiments, the codon is optimized for maximized transcription suitable for the transcription system.
- the recombinant nucleic comprises one or more regulatory elements within the noncoding regions that can be manipulated for desired expression profdes of the encoded proteins.
- the noncoding region may comprise suitable enhancer.
- the enhancer comprises a binding region for a regulator protein or peptide may be added to the cell or the system comprising the cell, for commencement of expression of the protein encoded under the influence of the enhancer.
- a regulatory element may comprise a protein binding domain that remains bound with the cognate protein and continue to inhibit transcription and/or translation of recombinant protein until an extracellular signal is provided for the protein to decouple from the bound position to allow commencement of the protein synthesis.
- Construct comprisins metabolic switch examples include but are not limited to Tetracycline-inducible (Tet-Inducible or Tet-on) and Tetracycline repressible (Tet-off) systems known to one of skill in the art.
- Construct comprisins metabolic switch In some embodiments, the 5’ and 3’ untranslated regions flanking the coding regions of the construct may be manipulated for regulation of expression of the recombinant protein encoded by the nucleic acid constructs described above.
- the 3 TJTR may comprise one or more elements that are inserted for stabilizing the mRNA.
- AU- Rich Elements (ARE) sequences are inserted in the 3’ UTR that result in binding of RNA binding proteins that stabilize or destabilize the mRNA, allowing control of the mRNA half-life.
- the 3’ UTR may comprise a conserved region for RNA binding proteins (e.g. GAPDH) binding to mature mRNA strand preventing translation.
- RNA binding proteins e.g. GAPDH
- glycolysis results in the uncoupling of the RNA binding proteins (e.g. GAPDH) allowing for mRNA strand translation.
- the principle of the metabolic switch is to trigger expression of target genes when a cell enters a certain metabolic state. In resting cells, for example, GAPDH is an RNA binding protein (RBP). It binds to ARE sequences in the 3 ’UTR, preventing translation of mRNA.
- RBP RNA binding protein
- the environment in which the cell comprising the recombinant nucleic acid is present provides the metabolic switch to the gene expression.
- hypoxic condition can trigger the metabolic switch inducing the disengaging of GAPDH from the mRNA.
- the expression of the mRNA therefore can be induced only when the macrophage leaves the circulation and enters into a tumor environment, which is hypoxic. This allows for systemic administration of the nucleic acid or a cell comprising the nucleic acid, but ensures a local expression, specifically targeting the tumor environment.
- the nucleic acid construct can be a split construct, for example, allowing a portion of the construct to be expressed under the control of a constitutive expression system whereas another portion of the nucleic acid is expressed under control of a metabolic switch, as described above.
- the nucleic acid may be under bicistronic control.
- the bicistronic vector comprises a first coding sequence under a first regulatory control, comprising the coding sequence of a target recognition moiety which may be under constitutive control; and a second coding sequence encoding an inflammatory gene expression which may be under the metabolic switch.
- the bicistronic vector may be unidirectional. In some embodiments, the bicistronic vector may be bidirectional.
- the ARE sequences comprise protein binding motifs for binding ARE sequence that bind to ADK, ALDH18A1, ALDH6A1, ALDOA, ASS1, CCBL2, CS, DUT, ENOl, FASN, FDPS, GOT2, HADHB, HK2, HSD17B10, MDH2, NME1, NQ01, PKM2, PPP1CC, SUCLG1, TP11, GAPDH, or LDH.
- a pharmaceutical composition comprising (i) the nucleic acid encoding the transgene is incorporated in a transpositioning or retrotranspositioning system comprising the transgene, the 5 ’ - and 3 ’ - flanking transposition or retrotranspositioning elements, the expression regulation elements, such as promoters, introns; and a nucleic acid encoding the transposase or retrotransposase, (ii) a nucleic acid delivery vehicle and a pharmaceutically acceptable salt or excipient.
- the pharmaceutical composition comprises cells comprising the nucleic acid encoding the transgene that is stably integrated in the genome of the cell and a pharmaceutically acceptable excipient.
- Nucleic acid constructs can be delivered with cationic lipids (Goddard, et al, Gene Therapy, 4:1231-1236, 1997; Gorman, et al, Gene Therapy 4:983-992, 1997; Chadwick, et al, Gene Therapy 4:937-942, 1997; Gokhale, et al, Gene Therapy 4:1289-1299, 1997; Gao, and Huang, Gene Therapy 2:710-722, 1995), using viral vectors (Monahan, et al, Gene Therapy 4:40-49, 1997; Onodera, et al, Blood 91:30-36, 1998), by uptake of "naked DNA", and the like.
- nucleic acid constructs can be used for the ex vivo administration of nucleic acid constructs.
- the exact formulation, route of administration and dosage can be chosen empirically. (See e.g. Fingl et al., 1975, in "The Pharmacological Basis of Therapeutics", Ch. 1 pi).
- the nucleic acid comprising the transgene and the transposable elements is introduced or incorporated in the cell by known methods of nucleic acid transfer inside a cell, such as using lipofectamine, or calcium phosphate, or via physical means such as electroporation or nucleofection.
- the nucleic acid is encapsulated in liposomes or lipid nanoparticles. LNPs are 100-300 nm in diameter provide efficient means of mRNA delivery to various cell types, including macrophages.
- the nucleic acid is transferred by other nanoparticles.
- the vector for expression of the CFP is of a viral origin, namely a lentiviral vector or an adenoviral vector.
- the nucleic acid encoding the recombinant nucleic acid is encoded by a lentiviral vector.
- the lentiviral vector is prepared in-house and manufactured in large scale for the purpose. In some embodiments, commercially available lentiviral vectors are utilized, as is known to one of skill in the art.
- the viral vector is an Adeno-Associated Virus (AAV) vector.
- AAV Adeno-Associated Virus
- the methods find use in a variety of applications in which it is desired to introduce an exogenous nucleic acid into a target cell and are particularly of interest where it is desired to express a protein encoded by an expression cassette in a target cell, where the target cell or cells are part of a multicellular organism.
- the transposase system may be administered to the organism or host in a manner such that the targeting construct is able to enter the target cell(s), e.g., via an in vivo or ex vivo protocol. Such cells or organs are typically returned to a living body.
- the transgene encoding a fusion protein related to immune function is stably integrated in a living cell of a subject ex vivo, following which the cell comprising the transgene is returned to the subject.
- the CFP transgene phagocytic receptor fusion protein
- an immune cell such as a myeloid cell, a phagocytic cell, a macrophage, a monocyte or a cell of dendritic cell lineage is contacted ex vivo with the recombinant nucleic acids for stable transfer of the transgene and re-introduced in the same subject for combating a disease of the subject.
- the diseases contemplated comprises infectious diseases, cancer and autoimmune diseases.
- the nucleic acid encoding the PSR subunit comprising fusion protein (CFP) described herein is used to generate engineered phagocytic cells for treating cancer.
- Cancers include, but are not limited to T cell lymphoma, cutaneous lymphoma, B cell cancer (e.g., multiple myeloma, Waldenstrom's macroglobulinemia), the heavy chain diseases (such as, for example, alpha chain disease, gamma chain disease, and mu chain disease), benign monoclonal gammopathy, and immunocytic amyloidosis, melanomas, breast cancer, lung cancer, bronchus cancer, colorectal cancer, prostate cancer (e.g., metastatic, hormone refractory prostate cancer), pancreatic cancer, stomach cancer, ovarian cancer, urinary bladder cancer, brain or central nervous system cancer, peripheral nervous system cancer, esophageal cancer, cervical cancer, uterine or endometrial cancer, cancer of the oral cavity or pharynx, liver cancer, kidney cancer, testicular cancer, biliary tract cancer, small bowel or appendix cancer, salivary gland cancer, thyroid gland cancer, adrenal gland cancer, osteosarcom
- cancers include human sarcomas and carcinomas, e.g., fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, colorectal cancer, pancreatic cancer, breast cancer, ovarian cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma
- human sarcomas and carcinomas e.g.,
- the cancer is an epithelial cancer such as, but not limited to, bladder cancer, breast cancer, cervical cancer, colon cancer, gynecologic cancers, renal cancer, laryngeal cancer, lung cancer, oral cancer, head and neck cancer, ovarian cancer, pancreatic cancer, prostate cancer, or skin cancer.
- the cancer is breast cancer, prostate cancer, lung cancer, or colon cancer.
- the epithelial cancer is non-small-cell lung cancer, nonpapillary renal cell carcinoma, cervical carcinoma, ovarian carcinoma (e.g., serous ovarian carcinoma), or breast carcinoma.
- the epithelial cancers can be characterized in various other ways including, but not limited to, serous, endometrioid, mucinous, clear cell, or undifferentiated.
- the present disclosure is used in the treatment, diagnosis, and/or prognosis of lymphoma or its subtypes, including, but not limited to, mantle cell lymphoma. Lymphoproliferative disorders are also considered to be proliferative diseases.
- cellular immunotherapy comprises providing the patient a medicament comprising live cells, which should be HLA matched for compatibility with the subject, and such that the cells do not lead to graft versus Host Disease, GVHD.
- a subject arriving at the clinic for personalized medicine and immunotherapy as described above, is routinely HLA typed for determining the HLA antigens expressed by the subject.
- FIG. IB and FIG. 1C illustrates various strategic designs for integrating an mRNA encoding transgene into the genome of a cell.
- GFP shown here in a box is an exemplary transgene.
- the mRNA encoding the transgene (e.g., GFP) can be co-expressed with a nucleic acid sequence encoding an ORF2p protein, in either sense or antisense orientation; the respective coding sequences may be in a monocistronic or bicistronic construct shown under exemplary Cis- strategies (FIG. IB and FIG. 1C).
- CMV/T7 are promoters.
- the trans- strategy can include a sequence encoding an ORF2p protein or both ORFlp and ORF2p proteins from a bicistronic sequence and an mRNA encoding a GFP in a sense or antisense direction in the 3’UTR of any gene.
- the transgene is flanked by a retrotransposing sequence comprising transposase binding sequences, an A-box and B-box, and a poly A tail.
- FIG. 2A illustrates three exemplary designs for expressing an exemplary transgene GFP by stably incorporating the sequence encoding GFP using the constructs.
- the first construct comprises a sequence encoding GFP, flanked by LI 5’-UTR; and a poly A sequence at the 3’ UTR, in absence of any transposase binding elements.
- the second and the third constructs comprise a sequence encoding GFP, a 3’UTR an A Box and a B-box, and a poly A sequence at the 3’ UTR.
- the third construct comprises an additional sequence encoding ORF2p. Expected GFP expression levels at 72 hours are shown on the right side.
- FIG. 2B illustrates three exemplary designs for expressing an exemplary transgene GFP in an mRNA that either encodes RFP or ORF2p by stably incorporating the sequence encoding GFP using the constructs.
- the first construct comprises a sequence encoding RFP, and a poly A sequence at the 3’ UTR, in absence of any LI elements.
- the second and the third constructs comprise a 3’UTR comprising an A Box and a B-box, and a poly A sequence at the 3’ UTR.
- the second construct comprises a sequence encoding RFP and the third construct comprises a sequence encoding ORF2p. Expected RFP and GFP expression levels at 72 hours are shown on the right side.
- RNA motifs having tertiary structures can be incorporated in the desired RNA having an exon and an intron in place of the 5 ’ and 3 ’ homology arms, thereby forming the terminal RNA scaffolds for circularization.
- TectoRNA RNA-RNA binding interfaces are constructed by combining pairs of GNRA loop/loop-receptor interaction motifs, yielding high affinity, high specificity tertiary structures. (FIG. 3B). Pairs of GNRA loop/loop-receptor interaction motifs are fused using the four- way junction from the hairpin ribozyme to create divalent, self-assembling scaffolding units (‘tectoRNA’) which help form a closed cooperatively assembling ring-shaped complexes. Using two orthogonal loop/loop-receptor interaction motifs, RNA monomers are designed that are capable of directional assembly in either the parallel (‘up-up’) or anti-parallel (‘up-down’) assembly modes.
- each incorporated monomer switches the directionality of the growing chain and thus compensates for its intrinsic bending, producing long, relatively straight multi-unit chains.
- sequences are checked by submitting them to the RNA folding program Mfold (bioinfo.math.rpi.edu/ ⁇ zukerm/ma/mfold) which predicts the thermodynamically favored secondary structure of a given RNA sequence.
- Mfold bioinfo.math.rpi.edu/ ⁇ zukerm/ma/mfold
- RNA molecule is prepared by conventional methods, such as in vitro run-off transcription using T7 RNA polymerase.
- FIG. 3B shows a RL-GAAA loop structure.
- a fluorescence-based chip-flow piece testing method is utilized.
- a library of potential variants of the structured RNA (chip piece) is synthesized as DNA templates and amplified to include sequencing adapters and regions for RNAP initiation. Each DNA variant is transcribed in situ into RNA, enabling display of sequence-identified clusters of RNA on the surface of the sequencing chip.
- the selected terminal RNA scaffold segments comprising the tertiary structures are incorporated using T7 transcription or ligated at the 5’ and 3’ ends of the desired RNA to be circularized; or are incorporated in the desired RNA by any known molecular biology techniques.
- Example 3 Exemplary retro transposon designs with enhanced specificity
- nucleic acid construct for LI -mediated retrotransposon for enhanced target specificity.
- An mRNA is designed comprising ORF2 encoding sequence and a sequence encoding a gene of interest, to incorporate the gene of interest into the genome of a cell using ORF2.
- the construct comprises an ORF2 that is further modified.
- ORF2 protein initiates retrotransposition by binding to its own poly A sequence.
- poly A is abundantly present in mRNAs, a non-specific binding and integration becomes a possibility.
- a recombinant ORF2 is designed comprising an mRNA-binding domain of a heterologous protein, and the cognate mRNA sequence for the heterologous mRNA-binding domain is inserted near the poly A sequence in the 3’-UTR and the ORF2 poly A binding site.
- a chimeric ORF2 is thereby generated as shown in (FIG. 4B), in which a high affinity RNA- binding domain of a heterologous protein encoding sequence is incorporated or fused to the ORF2 sequence and cognate RNA sequences corresponding to the high affinity RNA-binding protein is incorporated in the 3’UTR region of the mRNA, proximal to the poly A region.
- the heterologous high affinity RNA-binding domain is derived from MCP coat protein MS2 (shown as M in the figure), is incorporated within the ORF2 sequence and the cognate sequence, the MS2 hairpin, is included in the 3’ UTR sequence of the mRNA (FIG. 4B).
- the MS2 binds to the cognate sequence, increasing the specificity of the chimeric ORF2 to its own mRNA for reverse transcribing and incorporating the respective sequence associated with the ORF2 mRNA in the mammalian cell genome (FIG. 4B).
- Example 4 Exemplary plasmid design and developments for LINE-1 mediated retrotransposition of an exogenous nucleic acid sequence
- plasmid vectors are generated for delivery and incorporation of a recombinant LINE-1 construct comprising an ORF2 transposon element operably linked to a transgene transposable into a mammalian cell, and regulatory elements for mRNA transcription and stabilization.
- the mRNA can be transcribed in a bacterial host cell, which can be further processed and/or purified for introduction into a mammalian cell in vitro or administration in an organism, such as a mammal, a rodent, sheep, pig or a human.
- Any suitable vector backbone is used for incorporating the recombinant nucleic acid sequence as insert and transcribing in a bacterial system for mRNA generation; or in vitro transcription system may be utilized to generate an mRNA comprising the recombinant nucleic acid sequence.
- Several features are added to the plasmid. Upon successful scalable mRNA production, and purification, the mRNA may be introduced in a mammalian cell of interest, such as a myeloid cell.
- Plasmids traditionally used in the field of study for retrotransposition lack designer genes, gene blocks, and Gibson assembly methods were used regularly to insert different features.
- a new vector that takes features from the old vectors but has flexibility to insert new features can be beneficial both for the study and optimization of LINE-1 elements as a gene delivery system.
- FIG. 5(1) which contains the natural LINE-1 sequence with the original 5’UTR, 3’UTR and interORF sequence with no restriction sites to swap out any of these features.
- New optimized plasmid is shown graphically in FIG. 5(1), which contains the natural LINE-1 sequence with the original 5’UTR, 3’UTR and interORF sequence with no restriction sites to swap out any of these features.
- a nuclear localization sequence (NLS) is inserted at the N terminus of ORF2 to help with nuclear import (FIG. 5 (VI)).
- An IRES or another termination/promoter sequence is inserted to increase expression of ORF2 (FIG. 5 (VII)).
- MS2 hairpins are inserted in the 3’UTR and a MS2 coat protein sequence in the N terminus of the ORF2 protein (FIG. 5 (VIII)).
- an Alu element is inserted in the 3 ’UTR of the mRNA (FIG. 5 (IX)).
- the ORF2’s RT domain is replaced with the Group II intron’s reverse transcriptase domain (FIG. 5 (X)).
- the minke whale genome has the highest number and percentage of active LINE elements (-5,000 with 60% active compared to humans that have 480 with 3.6% active). The two sequences are 67% identical and the whale sequence has the active endonuclease and reverse-transcriptase residues.
- the respective minke whale domains can be used to replace native ORF2 endonuclease and/or RT domains or design a chimera domain.
- Example 5 mRNA design synthetic mRNA generation
- mRNA can be strategically designed for synthetic production by oligosynthesis and or ligation of oligonucleotides. Additionally, such designs are useful for in vitro transcription (IVT) mediated mRNA generation.
- the mRNA strategy can include the same variants as the plasmid strategy discussed in the previous example. The main differences are that the reporter GFP sequence does not include an intron (FIG. 6A) and that the constructs can be delivered without the ORF1 coding region (FIG. 6B).
- Example 6 Structural features for increased mRNA half-life
- the mRNA comprising the retrotransposition elements and/or the transgene for increasing the mRNA half-life.
- the goal is tojncrease the duration of protein expression from the mRNA in primary monocytes from three days to at least 5 days with an ultimate goal of 10 days.
- the mRNA comprising a sequence encoding the transgene when introduced into a CD14+ myeloid cell (monocyte), is translated and expresses a chimeric receptor (an ATAK construct) capable of binding to an antigen on a cancer cell.
- a number of mRNA designs are generated by synthesizing various gene blocks comprising singly, or combinations of one or more of: (i) a G-quadruplex, (ii) a viral pseudoknot structure in the 5’ UTR; and/or (iii) one or (iv) more xrRNA loop structures in the 3 ’ UTR (v) a triplex RNA structure as shown in FIG. 7A; and cloned into the transcription vector at the respective UTRs adjoining the coding sequence of the transgene.
- constructs are individually prepared by an off-site vendor and tested in-house for determining stability of the mRNA, as measured by the expression of the chimeric receptor (An exemplary receptor and its function is depicted graphically in FIG. 7B (left). The process flow chart is shown on FIG. 7B (right).
- constructs are cloned into plasmids, with encoded or modified poly A tails.
- the mRNA was transcribed at 100 ug scale and purified with ethanol precipitation (Aldevron). Meanwhile, frozen monocytes are thawed and harvested. Harvested cells were electroporated with the purified mRNA (5-10 ug), and cultured for 1, 2, 3, 5 days.
- Cells positive for the chimeric receptor are detected by means of their ability to bind to a target cell or a substrate coated with the target antigen.
- the expected results are shown in FIG. 7C.
- Bulk or purified mRNA expressing one or more of the structural features outlined in (i) - (v) (data denoted by solid squares) or a combination thereof outperforms the commercially available counterparts that do not contain any of the features outlined in (i) - (v) (data denoted by triangles).
- Example 7 LINE-1 Retro transposon plasmid mediated delivery of GFP gene
- genomic integration of a GFP cargo and expression the GFP protein using a LINE- 1 retrotransposon system was verified.
- the LINE- 1 -GFP construct (LINE-1 plasmid GFP) is exemplified in FIG.8A: A plasmid construct having a LINE-1 sequence encoding ORFlp (ORF1), a sequence encoding ORF2p (ORF2), and a CMV promoter driven split GFP gene situated in the 3 ’UTR of the LINE-1 in reverse orientation with respect to the ORFs.
- the split GFP is designed to have an intronic sequence inserted in between a splice donor and acceptor sites, which ensures that the GFP is expressed only after integration and splicing mediated removal of the noncoding sequence in the middle of the coding sequence.
- the cargo is 2.1 kb.
- HEK293T cells were transfected with the plasmid using Fugene reagent, and plasmid positive cells were selected by puromycin.
- the mRNA generated from a genome integrated GFP successfully translates and is measured by flow cytometry, as indicated as change in mean fluorescence intensity (MFI) (FIG. 8B) and fraction of cells with GFP fluorescence intensity compared to mock transfected cells (FIG. 8C).
- Example 8 LINE-1 Retro transposon plasmid mediated delivery of a chimeric receptor gene
- a recombinant gene can be successfully expressed using the LINE-1 sequence in a cell.
- HEK 293 cells were transfected with a plasmid having the LINE-1 elements, with a 3 kb cargo sequence encoding recombinant receptor protein CD5-intron-fcr-PI3K (ATAK) that is interrupted by an intron sequence in the CD5 binding domain.
- ATAK recombinant receptor protein
- the cargo is a chimeric receptor that has a CD5 binding extracellular domain, a FCRy transmembrane domain, and an intracellular domain having a PI3 -kinase recruitment domain.
- the schematic representation of the retrotransposon plasmid is shown in FIG. 9A.
- the ATAK receptor cannot express unless it is integrated in the genome and the intron is spliced off.
- the receptor expression is detected using labeled CD5 as bait for the CD5 binding extracellular domain.
- Results shown in FIG. 9B and 9C show successful integration and expression of the receptor. 36.5% cells were ATAK (CD5 binder) positive (FIG. 9C).
- a LINE-1 construct (LINE-lplasmid-cd5_fcr-pi3k_t2a_GFPintron) with a longer 3.7 kb cargo sequence encoding a non-interrupted recombinant receptor protein CD5-intron-fcr- PI3K and an interrupted GFP sequence with a T2A sequence between receptor and the GFP sequences (FIG. 10A).
- FIG. 10B Exemplary fluorescence identification of GFP and fluorescent tagged CD5 binding and gating quantitation for experimental runs are shown in FIG. IOC and FIG. 10D.
- Example 9 mRNA encoding LINE-1 Retrotransposon for delivery of a cargo gene [00465]
- capability of delivering and expressing a LINE-1 retrotransposable gene sequence as an mRNA was tested.
- An mRNA encoding an ORFl (ORFl-FLAG-mRNA), and an mRNA encoding ORF2 and GFP in the antisense direction with a CMV promoter sequence (ORF2-FLAG-GFPai) are designed as shown in FIG. 11A.
- the cargo size in this assay was 2.4 kb, and GFP is in antisense orientation with respect to ORF2 sequence.
- the mRNAs were electroporated in 293T cells and the reporter genes expression was demonstrated as shown in FIG. 11B.
- FIG. 11A shows a diagrammatic representation of ORFl and ORF2 mRNAs.
- 3x the amount of each and together is tested for increases in GFP+ cells and results are shown in FIG. 12A.
- Fold increase is relative to lx ORF2-GFP and lx ORFl mRNA.
- GFP expression was higher when 3x ORFl was used with lx ORF2, but not the reverse; whereas having both 3x ORF1 and 3x ORF2 showed the maximum level of GFP expression in the sets compared.
- the cargo size here is 2.4 kb.
- FIG. 12B shows fluorescent microscopy image of GFP+ cells following retrotransposon mRNA electroporation.
- LINE-1 mRNA encoding both ORF1 and ORF2 in a single mRNA molecule was tested for delivery and genomic integration in a cell.
- mRNA contains the bicistronic ORF1 and ORF2 sequence with a CMV-GFP sequence in the 3’UTR going from 3’-5’ (FIG. 13A).
- the cargo size is 2.4 kb.
- FIG. 13B upon retrotransposition of the delivered ORF2-cmv- GFP antisense (LINE-1 mRNA), third bar from left, cells expressed higher GFP compared to ORF1 and ORF2 being on separate mRNA molecules (graph bar 1, 2).
- Example 10 Modifications to the ORF2 protein sequence to enhance retrotransposition by mRNA
- Modification of the LINE-1 sequence to enhance retrotransposition via mRNA delivery were tested using GFP reporter as readout. The experiment was performed as follows. All modifications were in the context of the bicistronic ORF1 and ORF2 sequence (i) ORF2- NLS fusion was created by inserting C-terminal NLS sequence to the ORF2 sequence (ii) Human ORF2 was replaced with Minke whale ORF2; (Ivancevic et al., 2016).
- the inter-ORF region is further manipulated to determine if any of the changes improve GFP expression after transfection of the HEK cells.
- the inter-ORF region is manipulated as follows: (a) In one construct the inter-ORF region is replaced with an IRES from CVB3; (b) In another construct, the inter-ORF region is replaced with an IRES from EV71; (c) In three separate constructs, an E2A or P2A or T2A self-cleavage sequence is intercalated in the inter-ORF region. Result are as shown in FIG. 16.
- LINE-1 plasmid and mRNA were tested with the CMV- GFP antisense reporter cargo by electroporating into Jurkat cells, which is a T cell lymphoma line (FIG. 17A-FIG. 17B). Mock set were electroporated with a plasmid with no GFP sequence. GFP expression in the transfected cells was assessed, representative data at 4 days post electroporation is shown in FIG. 17B. Fold increase is reported relative to mock transfected cells. Both plasmid and mRNA delivery modes resulted in successful GFP expression.
- THP-1 cells (a myeloid, monocytic cell line) were electroporated with a plasmid having LINE-1 sequences and a 3.7 kb cargo encoding a chimeric HER-2 binding receptor, and a split GFP (LINE- 1 plasmid Her2-Cd3z-T2A-GFPintron) (FIG. 18A).
- the cargo is a chimeric receptor that comprises a HER2 binding extracellular domain, a CD3z transmembrane domain, and split GFP reporter.
- the plasmid was successfully integrated into the genome and showed prolonged expression, as demonstrated in FIG. 18B. Representative expression at day 6 post transfection is shown in the figure.
- LINE-1 mediated gene delivery can result in successful stable genomic integration in various cell types, including epithelial cell types (HEK-293T cells); T cells (e.g., Jurkat cells); and cells of myeloid lineage (e.g., THP-1 cells) and results in prolonged expression.
- HEK-293T cells epithelial cell types
- T cells e.g., Jurkat cells
- myeloid lineage e.g., THP-1 cells
- retrotransposition can result in integration of large genetic cargo, and, these can be delivered as a single nucleic acid construct.
- Cell cycle synchronization by selection of cells in a population that are in a certain stage of cell cycle or G1 arrest by a suitable agent can lead to higher nucleic acid uptake efficiency, e.g., plasmid vector transfection efficiency or electroporation efficiency.
- nucleic acid uptake efficiency e.g., plasmid vector transfection efficiency or electroporation efficiency.
- cells are pre-sorted and each group is separately electroporated to ensure uniform electroporation. The efficiencies of electroporation are compared between these groups and a cell cycle stage that results in highest efficiency as determined by the expression of the GFP test plasmid or mRNA is selected (FIG. 19).
- cells are synchronized with or without sorting by treating the cells, with a cell cycle arrest reagent for a few hours prior to electroporation.
- An exemplary list of cell cycle arrest reagents is provided in Table 1. The list is non-exhaustive, and is inclusive of reagents that can be proapoptotic, and hence careful selection suitable for the purpose and dose and time of incubation is optimized for use in the particular context.
- retrotransposition is enhanced by inducing DNA double stranded breaks (DSB) in a cell that expresses a retrotransposition machinery as described in any of the examples above by controlled irradiation, which create opportunities for the homologous recombination and priming for the reverse transcriptase (FIG. 20).
- DSB DNA double stranded breaks
- FIG. 20 cells transfected with LINE-1 plasmid GFP construct and subjected to an irradiation pulse. GFP expression is monitored. The intensity and time of irradiation is optimized for obtaining the maximum benefit, as indicated by higher GFP expression.
- cells transfected with FINE-1 plasmid GFP were divided into experimental sets that are treated as follows (i) irradiation in order to induce DSB (as described above); (ii) treat cells in this set with a small molecule, such as SCR7, that blocks DNA ligase and therefore inhibits the DNA damage repair machinery. Preventing protective repair mechanism from inhibiting the progress of the retrotransposition is expected to enhance GFP expression: (iii) irradiate the cells then treat the cells with SCR7, combination of the two is expected to show a more robust effect. GFP expression is monitored over a period of 6 days, and the set that shows maximum GFP fluorescence over the longest period indicates a condition that is adopted in further studies.
- Example 14 Enhancing efficiency of LINE- 1 mediated retrotransposition of the cargo sequences by further modification of the construct
- the 5’UTR is replaced with an UTR of a complement gene;
- the 3’ UTR is replaced with the UTR sequence of B-globin gene for increased stability;
- the inter-ORF region is replaced with an IRES from CVB3;
- the inter- ORF region is replaced with an IRES from EV71 (e)
- an E2A or P2A or T2A self-cleavage sequence is intercalated in the inter-ORF region as shown in a diagrammatic representation in FIG. 21.
- various combinations of (a)-(e) and additional combinations listed in Table 2 are tested using the same set-up as above. GFP expressions are monitored after transfection of the constructs in parallel test sets into HEK293T cells to see if any of these constructs increased GFP expression compared to the LINE-1 plasmid GFP alone. The combinations that show improvement are adopted.
- Table 2 Exemplary combinations of 5’ and 3’ UTR and inter-ORF insertion elements for inclusion in the LINE-1 construct for increase in retrotransposition efficiency.
- LINE-1 plasmid-GFP is further modified to test for increased GFP expression as follows: (a) the ORF2 encoding sequence is fused with a nuclear localization sequence (NLS) (graphically represented in FIG. 15A second construct from top) (b) the ORF1 encoding sequence is fused with a nuclear localization sequence (NLS), graphically represented in FIG. 22; and (c) An Alu binding sequence is inserted 3’ of the sequence encoding ORF2 reverse transcriptase (graphically represented in FIG.
- NLS nuclear localization sequence
- Table 3 Exemplary list of elements to enhance translation efficiency and stability of the LINE-1 proteins and increased expression of LINE- 1 proteins.
- the constructs are modified to test increase in GFP expression as follows.
- the LINE-1 plasmid GFP is cut at the 3 ’end of the endonuclease coding sequence of ORF2, and a sequence encoding the DNA binding domain (DBD) of a heterologous zinc finger protein (ZFP) is inserted.
- the endonuclease domain is fused with a CRISPR nuclease.
- nucleases can be tested by modifying the LINE-1 plasmid GFP ORF by creating a fusion protein using DNA binding domains and cleavage domain as shown in a non-exhaustive list in Table 4, In addition, two ORF-2 domains are encoded in one set to facilitate dimerization. The construct that has higher GFP expression than the ORF2 endonuclease can be further selected.
- the plasmid designs are graphically represented in FIG. 25. GFP expression is monitored after transfection of the plasmids into HEK293T cells, and the set that yielded best.
- Table 4 Exemplary non-exhaustive list of additional DNA cleavage domains/enzymes that can be fused to or inserted in place of LINE-1 endonuclease.
- the reverse transcriptase domain of ORF2 is modified for increasing its efficiency.
- the sequence encoding the human ORF2 in LINE-lplasmid GFP is excised and replaced with a sequence encoding MMLV or TGIRTII.
- the ORF2 reverse transcriptase domain is fused with a DNA binding domain of a heterologous protein.
- the reverse transcriptase domains and/or the DNA binding domains can be selected from a non-exhaustive list provided in Table 5A-Table 5B.
- the constructs are graphically exemplified in FIG. 26. GFP expression is monitored after transfection into HEK293T cells.
- Table 6 Exemplary LINE-1 elements from organism for use in replacement of the human LINE-1
- human LINE-1 is retained as in the GFP plasmid, but an inhibitor of human LINE-1 silencer is utilized to prevent recognition by endogenous proteins like HUSH complex TASOR protein.
- the TASOR inhibitor is an inhibitory RNA, such as a miRNA.
- Vni LINE-1 fusion proteins for target specificity.
- the LINE-1 plasmid GFP ORF2 is fused with a domain of a MegaTAL nuclease, a CRISPR-CAS nuclease, a TALEN, R2 retroelement binding zinc finger binding domain, or a DNA binding domain that can bind to repetitive elements such as Rep78 AAV.
- FIG. 28 exemplifies the deigns.
- Table 7 provides a list of the different elements that can be fused to increase sequence specific retrotransposition.
- Each plasmid is transfected into HEK293 cells and GFP expression is monitored.
- ORF1-FFAG- mRNA (Codon Optimized human ORFl coding sequence-FFAG) (SEQ ID NO: 35):
- ORF2-FLAG-GFPai mRNA (Codon Optimized human ORF2 coding sequence) (SEQ ID NO: 36)
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Immunology (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Mycology (AREA)
- Gastroenterology & Hepatology (AREA)
- Cell Biology (AREA)
- Oncology (AREA)
- Toxicology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
Description
Claims
Priority Applications (16)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020227010704A KR20220097875A (en) | 2019-09-03 | 2020-09-03 | Methods and compositions for genomic integration |
CA3149897A CA3149897A1 (en) | 2019-09-03 | 2020-09-03 | Methods and compositions for genomic integration |
AU2020341479A AU2020341479A1 (en) | 2019-09-03 | 2020-09-03 | Methods and compositions for genomic integration |
GB2203647.9A GB2605276B (en) | 2019-09-03 | 2020-09-03 | Methods and compositions for genomic integration |
BR112022003970A BR112022003970A2 (en) | 2019-09-03 | 2020-09-03 | Methods and compositions for genomic integration |
JP2022514694A JP2022546592A (en) | 2019-09-03 | 2020-09-03 | Methods and compositions for genomic integration |
EP20861388.5A EP4025686A4 (en) | 2019-09-03 | 2020-09-03 | GENOMIC INTEGRATION METHODS AND COMPOSITIONS |
CN202080077028.9A CN114981409A (en) | 2019-09-03 | 2020-09-03 | Methods and compositions for genomic integration |
MX2022002613A MX2022002613A (en) | 2019-09-03 | 2020-09-03 | Methods and compositions for genomic integration. |
US17/499,232 US11672874B2 (en) | 2019-09-03 | 2021-10-12 | Methods and compositions for genomic integration |
IL291048A IL291048A (en) | 2019-09-03 | 2022-03-02 | Methods and compositions for genomic integration |
US17/687,395 US20220184230A1 (en) | 2019-09-03 | 2022-03-04 | Methods and compositions for genomic integration |
US17/855,423 US20220411817A1 (en) | 2019-09-03 | 2022-06-30 | Methods and compositions for genomic integration |
US17/855,230 US20220364110A1 (en) | 2019-09-03 | 2022-06-30 | Methods and compositions for genomic integration |
US18/313,126 US20230364266A1 (en) | 2019-09-03 | 2023-05-05 | Methods and compositions for genomic integration |
US18/313,087 US20230364265A1 (en) | 2019-09-03 | 2023-05-05 | Methods and compositions for genomic integration |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201962895441P | 2019-09-03 | 2019-09-03 | |
US62/895,441 | 2019-09-03 | ||
US201962908800P | 2019-10-01 | 2019-10-01 | |
US62/908,800 | 2019-10-01 | ||
US202063039261P | 2020-06-15 | 2020-06-15 | |
US63/039,261 | 2020-06-15 |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/499,232 Continuation-In-Part US11672874B2 (en) | 2019-09-03 | 2021-10-12 | Methods and compositions for genomic integration |
US17/687,395 Continuation US20220184230A1 (en) | 2019-09-03 | 2022-03-04 | Methods and compositions for genomic integration |
Publications (3)
Publication Number | Publication Date |
---|---|
WO2021046243A2 true WO2021046243A2 (en) | 2021-03-11 |
WO2021046243A3 WO2021046243A3 (en) | 2021-06-03 |
WO2021046243A9 WO2021046243A9 (en) | 2022-06-23 |
Family
ID=74853338
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2020/049240 WO2021046243A2 (en) | 2019-09-03 | 2020-09-03 | Methods and compositions for genomic integration |
Country Status (12)
Country | Link |
---|---|
US (6) | US11672874B2 (en) |
EP (1) | EP4025686A4 (en) |
JP (1) | JP2022546592A (en) |
KR (1) | KR20220097875A (en) |
CN (1) | CN114981409A (en) |
AU (1) | AU2020341479A1 (en) |
BR (1) | BR112022003970A2 (en) |
CA (1) | CA3149897A1 (en) |
GB (2) | GB2605276B (en) |
IL (1) | IL291048A (en) |
MX (1) | MX2022002613A (en) |
WO (1) | WO2021046243A2 (en) |
Cited By (13)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022241029A1 (en) * | 2021-05-11 | 2022-11-17 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
US11572556B2 (en) | 2020-10-21 | 2023-02-07 | Massachusetts Institute Of Technology | Systems, methods, and compositions for site-specific genetic engineering using programmable addition via site-specific targeting elements (paste) |
US11628218B2 (en) | 2020-11-04 | 2023-04-18 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
US11672874B2 (en) | 2019-09-03 | 2023-06-13 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
WO2023182948A1 (en) * | 2022-03-21 | 2023-09-28 | Bio Adventure Co., Ltd. | Internal ribosome entry site (ires), plasmid vector and circular mrna for enhancing protein expression |
WO2023179132A1 (en) * | 2022-03-21 | 2023-09-28 | 隋云鹏 | Rna framework for gene editing and gene editing method |
WO2024020114A3 (en) * | 2022-07-20 | 2024-03-14 | Addition Therapeutics | Genome insertions in cells |
WO2024102703A3 (en) * | 2022-11-07 | 2024-06-27 | The Regents Of The University Of California | Zikv-based gene delivery system |
US12030938B2 (en) | 2021-03-17 | 2024-07-09 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
WO2024193739A1 (en) * | 2023-03-23 | 2024-09-26 | Ostravska Univerzita | Method for producing proteins in host cells |
WO2024220409A1 (en) * | 2023-04-17 | 2024-10-24 | Massachusetts Institute Of Technology | Genomic editing with site-specific retrotransposons |
EP4282968A4 (en) * | 2021-01-22 | 2024-12-04 | Peng, Shuanghong | GENE TRANSCRIPTION FRAMEWORK, VECTOR SYSTEM, GENOME SEQUENCE EDITING METHODS AND APPLICATION |
US12252545B2 (en) | 2019-12-11 | 2025-03-18 | Myeloid Therapeutics, Inc. | Therapeutic cell compositions and methods of manufacturing and use thereof |
Families Citing this family (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2024044767A2 (en) * | 2022-08-25 | 2024-02-29 | The Board Of Trustees Of The Leland Stanford Junior University | Recruitment of donor dna from in vivo assembled plasmids for saturation genome editing |
WO2024263202A2 (en) * | 2022-11-28 | 2024-12-26 | Yale University | Compositions and methods for enhancement of mrna vaccine performance and vaccination against mpox |
WO2024116156A1 (en) * | 2022-12-02 | 2024-06-06 | Exsilio Therapeutics Ltd | Recombinant proteins comprising non-ltr retrotransposon-derived polypeptides for gene delivery and insertion |
WO2024131786A1 (en) * | 2022-12-19 | 2024-06-27 | 北京干细胞与再生医学研究院 | System for inserting large fragment dna into genome |
WO2024137392A1 (en) * | 2022-12-22 | 2024-06-27 | Genscript Usa Inc. | Method of preparing self-circularized rna |
WO2024163805A1 (en) * | 2023-02-01 | 2024-08-08 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
WO2025064511A1 (en) * | 2023-09-19 | 2025-03-27 | Icahn School Of Medicine At Mont Sinai | Bat-associated reverse transcriptase and methods of use thereof |
WO2025074310A2 (en) * | 2023-10-06 | 2025-04-10 | Exsilio Therapeutics Ltd | Engineered retrotransposable element proteins for gene delivery and insertion |
CN117899207A (en) * | 2023-12-12 | 2024-04-19 | 中国医学科学院医学生物学研究所 | A rotavirus mRNA vaccine and its preparation method and application |
Family Cites Families (165)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5633234A (en) | 1993-01-22 | 1997-05-27 | The Johns Hopkins University | Lysosomal targeting of immunogens |
US5773244A (en) | 1993-05-19 | 1998-06-30 | Regents Of The University Of California | Methods of making circular RNA |
FR2709309B1 (en) | 1993-08-25 | 1995-11-10 | Centre Nat Rech Scient | Cellular compositions, preparation and therapeutic uses. |
US5631236A (en) | 1993-08-26 | 1997-05-20 | Baylor College Of Medicine | Gene therapy for solid tumors, using a DNA sequence encoding HSV-Tk or VZV-Tk |
US5641875A (en) | 1993-09-30 | 1997-06-24 | University Of Pennsylvania | DNA encoding chimeric IgG Fc receptor |
US20030121063A1 (en) * | 1995-11-16 | 2003-06-26 | The Trustees Of The University Of Pennsylvania | Compositions and methods of use of mammalian retrotransposons |
US6150160A (en) * | 1995-11-16 | 2000-11-21 | The John Hopkins University | Compositions and methods of use of mammalian retrotransposons |
US6576463B1 (en) | 1999-01-15 | 2003-06-10 | The Regents Of The University Of California | Hybrid vectors for gene therapy |
WO2001030965A2 (en) | 1999-10-28 | 2001-05-03 | The Board Of Trustees Of The Leland Stanford Junior University | Methods of in vivo gene transfer using a sleeping beauty transposon system |
JP5312721B2 (en) | 2000-11-07 | 2013-10-09 | シティ・オブ・ホープ | CD19-specific redirecting immune cells |
US8709412B2 (en) | 2001-06-29 | 2014-04-29 | The Board Of Trustees Of The Leland Stanford Junior University | Modulation of TIM receptor activity in combination with cytoreductive therapy |
WO2003064644A1 (en) * | 2002-01-31 | 2003-08-07 | Dnavec Research Inc. | Method of line retro-position |
EP1482974A4 (en) | 2002-02-15 | 2006-08-02 | Zycos Inc | ELECTROPORATION METHOD FOR INTRODUCING BIOLOGICALLY EFFECTIVE MEANS IN CELLS |
US20080254027A1 (en) | 2002-03-01 | 2008-10-16 | Bernett Matthew J | Optimized CD5 antibodies and methods of using the same |
US20050250207A1 (en) | 2002-06-05 | 2005-11-10 | Rozwadowski Kevin L | Retrons for gene targeting |
JP4662776B2 (en) | 2002-12-04 | 2011-03-30 | ベイラー リサーチ インスティテュート | A rapid one-step method for generating antigen-loaded dendritic cell vaccines from precursors |
US20070037759A1 (en) * | 2003-02-07 | 2007-02-15 | Administrators Of The Tulane Educational Fund, The | Mammalian retrotransposable elements |
US8007805B2 (en) | 2003-08-08 | 2011-08-30 | Paladin Labs, Inc. | Chimeric antigens for breaking host tolerance to foreign antigens |
WO2005019429A2 (en) | 2003-08-22 | 2005-03-03 | Potentia Pharmaceuticals, Inc. | Compositions and methods for enhancing phagocytosis or phagocyte activity |
EP1812555B1 (en) | 2004-10-25 | 2015-04-22 | Cellerant Therapeutics, Inc. | Methods of expanding myeloid cell populations and uses thereof |
US20060188891A1 (en) | 2005-02-23 | 2006-08-24 | Bickmore William D Jr | Methods and apparatus for controlling DNA amplification |
US20060257359A1 (en) | 2005-02-28 | 2006-11-16 | Cedric Francois | Modifying macrophage phenotype for treatment of disease |
US20090191202A1 (en) | 2005-09-29 | 2009-07-30 | Jamieson Catriona Helen M | Methods for manipulating phagocytosis mediated by CD47 |
EP2004237A1 (en) | 2006-04-03 | 2008-12-24 | Keele University | Targeted therapy |
US20110171729A1 (en) * | 2006-05-04 | 2011-07-14 | Ab Maxis Inc. | Method for Producing Stable Mammalian Cell Lines Producing High Levels of Recombinant Proteins |
US20080171002A1 (en) | 2006-07-20 | 2008-07-17 | Gourmetceuticals, Llc | Products For Receptor Mediated Activation And Maturation Of Monocyte-Derived Dendritic Cells By A Phosphorylated Glucomannane Polysaccharide |
US7833789B2 (en) | 2006-08-01 | 2010-11-16 | Fondazione Centro San Raffaele Del Monte Tabor | Monocyte cell |
CA2692501C (en) | 2007-07-04 | 2017-10-10 | Max-Delbrueck-Centrum Fuer Molekulare Medizin | Hyperactive variants of the transposase protein of the transposon system sleeping beauty |
EP2055784A1 (en) | 2007-10-31 | 2009-05-06 | Bundesrepublik Deutschland, letztvertreten durch den Präsidenten des Paul-Ehrlich-Instituts Prof. Dr. Johannes Löwer | Controlled activation of non-LTR retrotransposons in mammals |
CA2711938C (en) | 2008-01-15 | 2019-11-12 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for manipulating phagocytosis mediated by cd47 |
CA2731617A1 (en) | 2008-07-22 | 2010-01-28 | Maria Joao Saraiva | Amino acid sequences directed against multitarget scavenger receptors and polypeptides |
CN102137873A (en) | 2008-08-29 | 2011-07-27 | 西福根有限公司 | Anti-CD5 antibodies |
US9080211B2 (en) | 2008-10-24 | 2015-07-14 | Epicentre Technologies Corporation | Transposon end compositions and methods for modifying nucleic acids |
EP2248903A1 (en) * | 2009-04-29 | 2010-11-10 | Universitat Autònoma De Barcelona | Methods and reagents for efficient and targeted gene transfer to monocytes and macrophages |
AU2011239569B2 (en) | 2010-04-16 | 2014-07-24 | Baylor College Of Medicine | Method for treating solid tumors |
WO2012005763A1 (en) | 2010-07-06 | 2012-01-12 | The Scripps Research Institute | Use of myeloid-like progenitor cell populations to treat tumors |
WO2012043651A1 (en) | 2010-09-30 | 2012-04-05 | 国立大学法人 熊本大学 | Production method for myeloid blood cells |
WO2012109476A2 (en) | 2011-02-09 | 2012-08-16 | The University Of Rochester | Methods and compositions related to staufen 1 binding sites formed by duplexing alu elements |
WO2012133947A1 (en) | 2011-03-30 | 2012-10-04 | Riken | Functional nucleic acid molecule and use thereof |
CN104126009B (en) | 2011-10-07 | 2019-05-10 | 国立大学法人三重大学 | Chimeric Antigen Receptor |
US9149519B2 (en) | 2012-01-17 | 2015-10-06 | New York University | Chimeric human immunodeficiency virus type 1 (HIV-1) with enhanced dendritic cell and macrophage tropism comprising the simian immunodeficiency virus (SIV) minimal Vpx packaging domain |
US20140140989A1 (en) | 2012-02-06 | 2014-05-22 | Inhibrx Llc | Non-Platelet Depleting and Non-Red Blood Cell Depleting CD47 Antibodies and Methods of Use Thereof |
US9045541B2 (en) | 2012-02-06 | 2015-06-02 | Inhibrx Llc | CD47 antibodies and methods of use thereof |
US9447194B2 (en) | 2012-02-13 | 2016-09-20 | Seattle Children's Hospital | Bispecific chimeric antigen receptors and encoding polynucleotides thereof |
EP2753365B1 (en) | 2012-02-14 | 2017-03-22 | Loma Linda University | Agents for treating inflammation-related conditions and diseases |
EP2639313A1 (en) | 2012-03-14 | 2013-09-18 | Rheinische Friedrich-Wilhelms-Universität Bonn | High-resolution transcriptome of human macrophages |
AU2013266734B2 (en) | 2012-05-25 | 2018-11-22 | Cellectis | Use of pre T alpha or functional variant thereof for expanding TCR alpha deficient T cells |
ES2528892T3 (en) | 2012-07-30 | 2015-02-13 | Nbe-Therapeutics Llc | Identification mediated by transposition of specific binding or functional proteins |
BR112015013431A2 (en) | 2012-12-12 | 2017-11-14 | Vasculox Inc | monoclonal antibodies or antigen-binding fragments thereof, pharmaceutical composition, and uses of monoclonal antibody or antigen-binding fragment thereof |
US9221908B2 (en) | 2012-12-12 | 2015-12-29 | Vasculox, Inc. | Therapeutic CD47 antibodies |
SE537429C2 (en) | 2013-02-14 | 2015-04-28 | Scania Cv Ab | Simultaneous estimation of at least mass and rolling resistance of vehicles |
US9393257B2 (en) | 2013-03-01 | 2016-07-19 | Regents Of The University Of Minnesota | TALEN-based gene correction |
US20160145348A1 (en) | 2013-03-14 | 2016-05-26 | Fred Hutchinson Cancer Research Center | Compositions and methods to modify cells for therapeutic objectives |
WO2014145252A2 (en) | 2013-03-15 | 2014-09-18 | Milone Michael C | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
NZ758715A (en) | 2013-10-31 | 2023-01-27 | Seattle Children’S Hospital Dba Seattle Children’S Res Institute | Modified hematopoietic stem/progenitor and non-t effector cells, and uses thereof |
SG11201606664UA (en) | 2014-02-14 | 2016-09-29 | Univ Texas | Chimeric antigen receptors and methods of making |
CN106456749B (en) | 2014-03-11 | 2021-03-30 | 小利兰·斯坦福大学托管委员会 | Anti-sirpa antibodies and bispecific macrophage-enhancing antibodies |
WO2015164627A1 (en) | 2014-04-23 | 2015-10-29 | Discovery Genomics, Inc. | Chimeric antigen receptors specific to avb6 integrin and methods of use thereof to treat cancer |
CN104004095B (en) | 2014-06-04 | 2016-11-23 | 博生吉医药科技(苏州)有限公司 | A kind of CD7 nano antibody, its coded sequence and application |
CN106687483B (en) | 2014-07-21 | 2020-12-04 | 诺华股份有限公司 | Cancer treatment using humanized anti-BCMA chimeric antigen receptors |
JP2017522893A (en) | 2014-07-31 | 2017-08-17 | セレクティスCellectis | ROR1-specific multi-chain chimeric antigen receptor |
WO2016030501A1 (en) * | 2014-08-28 | 2016-03-03 | Centre National De La Recherche Scientifique - Cnrs - | Synthetic alu-retrotransposon vectors for gene therapy |
CA2959141A1 (en) | 2014-08-28 | 2016-03-03 | Bioatla, Llc | Conditionally active chimeric antigen receptors for modified t-cells |
BR112017004675A2 (en) | 2014-09-09 | 2017-12-05 | Unum Therapeutics | chimeric receptors and their use in immune therapy |
KR20240056629A (en) | 2014-09-28 | 2024-04-30 | 더 리전트 오브 더 유니버시티 오브 캘리포니아 | Modulation of stimulatory and non-stimulatory myeloid cells |
EP3204491A1 (en) | 2014-10-07 | 2017-08-16 | Cellectis | Method for modulating car-induced immune cells activity |
MA41538A (en) | 2014-10-17 | 2017-12-26 | Baylor College Medicine | BIPARTITE AND TRIPARTITE IMMUNE CELLS OF SIGNALING |
CA2964392A1 (en) | 2014-10-31 | 2016-05-06 | Massachussetts Institute Of Technology | Delivery of biomolecules to immune cells |
WO2016081423A1 (en) | 2014-11-18 | 2016-05-26 | Janssen Pharmaceutica Nv | Cd47 antibodies, methods, and uses |
US11041158B2 (en) | 2014-12-22 | 2021-06-22 | AgBiome, Inc. | Optimization methods for making a synthetic gene |
US11161907B2 (en) | 2015-02-02 | 2021-11-02 | Novartis Ag | Car-expressing cells against multiple tumor antigens and uses thereof |
US20170151281A1 (en) | 2015-02-19 | 2017-06-01 | Batu Biologics, Inc. | Chimeric antigen receptor dendritic cell (car-dc) for treatment of cancer |
AU2016222887B2 (en) | 2015-02-24 | 2022-07-14 | The Regents Of The University Of California | Binding-triggered transcriptional switches and methods of use thereof |
EP3261651B1 (en) | 2015-02-27 | 2022-05-04 | iCell Gene Therapeutics LLC | Chimeric antigen receptors (cars) targeting hematologic malignancies, compositions and methods of use thereof |
WO2016149254A1 (en) | 2015-03-17 | 2016-09-22 | Chimera Bioengineering, Inc. | Smart car devices, de car polypeptides, side cars and uses thereof |
EP3277309A1 (en) * | 2015-04-03 | 2018-02-07 | Alienor Farma | Monoclonal antibody to human line-1 orf2 protein and method for early detection of transforming cells in pre-neoplastic tissues of a human subject |
US10786549B2 (en) | 2015-04-23 | 2020-09-29 | Baylor College Of Medicine | CD5 chimeric antigen receptor for adoptive T cell therapy |
US9845345B2 (en) | 2015-05-18 | 2017-12-19 | Ab Initio Biotherapeutics, Inc. | SIRP polypeptide compositions and methods of use |
US10434153B1 (en) | 2015-05-20 | 2019-10-08 | Kim Leslie O'Neill | Use of car and bite technology coupled with an scFv from an antibody against human thymidine kinase 1 to specifically target tumors |
GB201509413D0 (en) | 2015-06-01 | 2015-07-15 | Ucl Business Plc | Fusion protein |
WO2016196612A1 (en) | 2015-06-01 | 2016-12-08 | The Rockefeller University | Anti-tumor agents and methods of use |
AU2016279062A1 (en) | 2015-06-18 | 2019-03-28 | Omar O. Abudayyeh | Novel CRISPR enzymes and systems |
KR20240132100A (en) | 2015-07-28 | 2024-09-02 | 더 트러스티스 오브 더 유니버시티 오브 펜실베니아 | Modified monocytes/macrophage expressing chimeric antigen receptors and uses thereof |
GB2557123B (en) | 2015-07-31 | 2021-11-03 | Univ Minnesota | Modified cells and methods of therapy |
AU2016303497A1 (en) | 2015-07-31 | 2018-03-01 | Tarveda Therapeutics, Inc. | Compositions and methods for immuno-oncology therapies |
GEP20227447B (en) | 2015-08-07 | 2022-12-12 | Alx Oncology Inc | Constructs having sirp-alpha domain or variant thereof |
US11352439B2 (en) | 2015-08-13 | 2022-06-07 | Kim Leslie O'Neill | Macrophage CAR (MOTO-CAR) in immunotherapy |
WO2017044487A1 (en) | 2015-09-09 | 2017-03-16 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Genetic engineering of macrophages for immunotherapy |
WO2017046259A1 (en) | 2015-09-16 | 2017-03-23 | Ethris Gmbh | Improved transposon system for gene delivery |
CA2999608A1 (en) | 2015-09-22 | 2017-03-30 | Julius-Maximilians-Universitat Wurzburg | A method for high level and stable gene transfer in lymphocytes |
CN105154473B (en) | 2015-09-30 | 2019-03-01 | 上海细胞治疗研究院 | A kind of transposon integration system of highly effective and safe and application thereof |
KR20180054600A (en) | 2015-10-13 | 2018-05-24 | 브라이엄 영 유니버시티 | The macrophage chimeric antigen receptor (MOTO-CAR) |
EP3373941A4 (en) | 2015-11-09 | 2019-03-27 | Aperisys, Inc. | MODIFIED IMMUNE CELLS AND USES THEREOF |
US10946042B2 (en) | 2015-12-01 | 2021-03-16 | The Trustees Of The University Of Pennsylvania | Compositions and methods for selective phagocytosis of human cancer cells |
EP3202783A1 (en) | 2016-02-02 | 2017-08-09 | Ecole Polytechnique Fédérale de Lausanne (EPFL) | Engineered antigen presenting cells and uses thereof |
WO2017133175A1 (en) | 2016-02-04 | 2017-08-10 | Nanjing Legend Biotech Co., Ltd. | Engineered mammalian cells for cancer therapy |
WO2017136633A1 (en) | 2016-02-04 | 2017-08-10 | Duke University | Cell-based vaccine compositions and methods of use |
GB201602473D0 (en) | 2016-02-11 | 2016-03-30 | Horizon Discovery Ltd | Replicative transposon system |
US20170275665A1 (en) | 2016-02-24 | 2017-09-28 | Board Of Regents, The University Of Texas System | Direct crispr spacer acquisition from rna by a reverse-transcriptase-cas1 fusion protein |
US20200063157A9 (en) | 2016-02-26 | 2020-02-27 | Poseida Therapeutics, Inc. | Transposon system and methods of use |
EP3219803A1 (en) | 2016-03-15 | 2017-09-20 | Max-Delbrück-Centrum für Molekulare Medizin | Enhanced sleeping beauty transposons, kits and methods of transposition |
US20180186855A1 (en) | 2016-03-23 | 2018-07-05 | Alector Llc | Chimeric receptors and methods of use thereof |
EP3436070A4 (en) | 2016-03-29 | 2019-11-27 | University of Southern California | CHIMERIC ANTIGENIC RECEPTORS TARGETING CANCER |
US11649284B2 (en) | 2016-04-18 | 2023-05-16 | Baylor College Of Medicine | Cancer gene therapy targeting CD47 |
US10875919B2 (en) | 2016-04-26 | 2020-12-29 | Alector Llc | Chimeric receptors and methods of use thereof |
US11390658B2 (en) | 2016-06-06 | 2022-07-19 | St. Jude Children's Research Hospital | Anti-CD7 chimeric antigen receptor and method of use thereof |
US11130951B2 (en) | 2016-06-09 | 2021-09-28 | The General Hospital Corporation | Modulating the cellular stress response |
CA3028158A1 (en) | 2016-06-17 | 2017-12-21 | The Broad Institute, Inc. | Type vi crispr orthologs and systems |
CN107523545A (en) | 2016-06-20 | 2017-12-29 | 上海细胞治疗研究院 | A kind of lethal cell of high efficiency stable expression antibody and application thereof |
SG10201913858WA (en) | 2016-08-26 | 2020-03-30 | Agency Science Tech & Res | Macrophage stimulating protein receptor (or ron - recepteur d' origine nantais) antibodies and uses thereof |
JOP20190009A1 (en) | 2016-09-21 | 2019-01-27 | Alx Oncology Inc | Antibodies against signal-regulatory protein alpha and methods of use |
ES2912269T3 (en) | 2016-09-27 | 2022-05-25 | Cero Therapeutics Inc | Chimeric engulfment receptor molecules |
EP3518944A4 (en) | 2016-09-30 | 2020-06-17 | Baylor College of Medicine | Adaptive chimeric antigen receptor t-cell design |
WO2018071058A1 (en) | 2016-10-15 | 2018-04-19 | Baylor College Of Medicine | Platform for enhanced targeted cell delivery |
WO2018073394A1 (en) | 2016-10-19 | 2018-04-26 | Cellectis | Cell death inducing chimeric antigen receptors |
EP3529276A4 (en) | 2016-10-21 | 2020-06-17 | Arch Oncology, Inc. | Therapeutic cd47 antibodies |
CN110461868A (en) | 2016-11-01 | 2019-11-15 | 根马布私人有限公司 | Polypeptide variants and their uses |
CN110312800B (en) | 2016-11-11 | 2025-01-10 | 生物辐射实验室股份有限公司 | Methods for processing nucleic acid samples |
PT3551753T (en) | 2016-12-09 | 2022-09-02 | Harvard College | Crispr effector system based diagnostics |
AU2017371070B2 (en) | 2016-12-09 | 2025-01-02 | Alector Llc | Anti-SIRP-alpha antibodies and methods of use thereof |
CA3049791A1 (en) | 2017-01-27 | 2018-08-02 | Silverback Therapeutics, Inc. | Tumor targeting conjugates and methods of use thereof |
WO2018169948A1 (en) | 2017-03-13 | 2018-09-20 | Poseida Therapeutics, Inc. | Compositions and methods for selective elimination and replacement of hematopoietic stem cells |
US12203145B2 (en) | 2017-03-15 | 2025-01-21 | The Broad Institute, Inc. | CRISPR effector system based diagnostics for virus detection |
US10934336B2 (en) | 2017-04-13 | 2021-03-02 | The Trustees Of The University Of Pennsylvania | Use of gene editing to generate universal TCR re-directed T cells for adoptive immunotherapy |
US10415017B2 (en) | 2017-05-17 | 2019-09-17 | Thunder Biotech, Inc. | Transgenic macrophages, chimeric antigen receptors, and associated methods |
US20200179450A1 (en) | 2017-06-12 | 2020-06-11 | Emory University | T-cell antigen targeted chimeric antigen receptor (car) and uses in cell therapies |
WO2019005641A1 (en) | 2017-06-25 | 2019-01-03 | Systimmune, Inc. | Guidance and navigation control proteins and method of making and using thereof |
WO2019010551A1 (en) | 2017-07-10 | 2019-01-17 | Instituto De Biologia Molecular Do Paraná - Ibmp | Genetic platform for heterologous overexpression in combination with the selection of cells that produce high levels of proteins |
MX2020000957A (en) | 2017-07-26 | 2020-07-22 | Forty Seven Inc | Anti-sirp-alpha antibodies and related methods. |
CN109306340B (en) | 2017-07-27 | 2023-06-06 | 上海细胞治疗研究院 | Artificial antigen presenting cell for efficiently amplifying whole T cells and application thereof |
CN109337872B (en) | 2017-07-27 | 2023-06-23 | 上海细胞治疗研究院 | Artificial antigen-presenting cells for efficiently expanding CAR-T cells and uses thereof |
US20200247889A1 (en) | 2017-08-08 | 2020-08-06 | Pionyr Immunotherapeutics, Inc. | Compositions and methods for disabling myeloid cells expressing trem1 |
US20200216860A1 (en) | 2017-09-05 | 2020-07-09 | Regeneron Pharmaceuticals, Inc. | Delivery of a gene-editing system with a single retroviral particle and methods of generation and use |
US20210130845A1 (en) | 2017-09-08 | 2021-05-06 | Poseida Therapeutics, Inc. | Compositions and methods for chimeric ligand receptor (clr)-mediated conditional gene expression |
EP3735460A4 (en) | 2017-09-18 | 2021-08-11 | Exuma Biotech Corp. | METHODS AND COMPOSITIONS FOR GENETIC MODIFICATION AND EXPANSION OF LYMPHOCYTES AND REGULATION OF THE ACTIVITY THEREOF |
AU2018341244A1 (en) | 2017-09-26 | 2020-03-05 | Cero Therapeutics, Inc. | Chimeric engulfment receptor molecules and methods of use |
US20200299686A1 (en) | 2017-10-02 | 2020-09-24 | Georgia Tech Research Corporation | Methods and Compositions for Engineering Synthetic Bioswitches for Remote Control of Biological Activity |
US11352611B2 (en) | 2017-10-03 | 2022-06-07 | Board Of Regents, The University Of Texas System | Non-LTR-retroelement reverse transcriptase and uses thereof |
GB201717974D0 (en) | 2017-10-31 | 2017-12-13 | Univ Court Of The Univ Of Aberdeen | Modified receptors |
CA3081346A1 (en) | 2017-11-02 | 2019-05-09 | Arbor Biotechnologies, Inc. | Novel crispr-associated transposon systems and components |
CN109971716B (en) | 2017-12-28 | 2023-08-01 | 上海细胞治疗研究院 | EGFR-specific CAR-T cells with autocrine CD47 antibody and uses thereof |
EP3759226A4 (en) * | 2018-03-02 | 2022-06-15 | Generation Bio Co. | IDENTIFICATION AND CHARACTERIZATION OF GENOMIC SAFE HARBOR (GSH) IN HUMAN AND MURINE GENOMES AND VIRAL AND NON-VIRAL VECTOR COMPOSITIONS FOR TARGETED INTEGRATION AT IDENTIFIED GSH LOCI |
GB2572005A (en) | 2018-03-16 | 2019-09-18 | Univ Court Univ Of Edinburgh | Macrophage-based therapy |
EP3774864A1 (en) | 2018-03-28 | 2021-02-17 | Cero Therapeutics, Inc. | Chimeric engulfment receptors and uses thereof for neurodegenerative diseases |
EP3774906A1 (en) | 2018-03-28 | 2021-02-17 | Cero Therapeutics, Inc. | Chimeric tim4 receptors and uses thereof |
CA3093973A1 (en) | 2018-03-28 | 2019-10-03 | Cero Therapeutics, Inc. | Cellular immunotherapy compositions and uses thereof |
WO2020006049A1 (en) | 2018-06-26 | 2020-01-02 | The Broad Institute, Inc. | Crispr/cas and transposase based amplification compositions, systems and methods |
EP3821011B1 (en) | 2018-07-11 | 2023-04-26 | Cygnus Biosciences (Beijing) Co., Ltd. | Transposome enabled dna/rna-sequencing (ted rna-seq) |
WO2020014528A1 (en) | 2018-07-13 | 2020-01-16 | The Regents Of The University Of California | Retrotransposon-based delivery vehicle and methods of use thereof |
EP3844272A1 (en) | 2018-08-28 | 2021-07-07 | Flagship Pioneering Innovations VI, LLC | Methods and compositions for modulating a genome |
WO2020097193A1 (en) | 2018-11-06 | 2020-05-14 | The Regents Of The University Of California | Chimeric antigen receptors for phagocytosis |
GB201818110D0 (en) | 2018-11-06 | 2018-12-19 | Macrophox Ltd | Monocytes for cancer targeting |
US20220133790A1 (en) * | 2019-01-16 | 2022-05-05 | Beam Therapeutics Inc. | Modified immune cells having enhanced anti-neoplasia activity and immunosuppression resistance |
US11013764B2 (en) | 2019-04-30 | 2021-05-25 | Myeloid Therapeutics, Inc. | Engineered phagocytic receptor compositions and methods of use thereof |
WO2020223550A1 (en) | 2019-04-30 | 2020-11-05 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
AU2020292339A1 (en) | 2019-06-11 | 2022-01-20 | Myeloid Therapeutics, Inc. | Macrophage specific engager compositions and methods of use thereof |
WO2020257727A1 (en) | 2019-06-19 | 2020-12-24 | Flagship Pioneering Innovations Vi, Llc | Methods of dosing circular polyribonucleotides |
JP2022542839A (en) | 2019-07-19 | 2022-10-07 | フラッグシップ パイオニアリング イノベーションズ シックス,エルエルシー | Recombinase compositions and methods of use |
BR112022003970A2 (en) | 2019-09-03 | 2022-06-21 | Myeloid Therapeutics Inc | Methods and compositions for genomic integration |
US20230040216A1 (en) | 2019-11-19 | 2023-02-09 | The Broad Institute, Inc. | Retrotransposons and use thereof |
AU2020403155A1 (en) | 2019-12-11 | 2022-06-30 | Myeloid Therapeutics, Inc. | Therapeutic cell compositions and methods for manufacture and uses thereof |
EP4114941A4 (en) | 2020-03-04 | 2024-10-16 | Flagship Pioneering Innovations VI, LLC | Improved methods and compositions for modulating a genome |
JP2023516692A (en) | 2020-03-04 | 2023-04-20 | フラッグシップ パイオニアリング イノベーションズ シックス,エルエルシー | Methods and compositions for modulating the genome |
MX2022010991A (en) | 2020-03-04 | 2023-02-09 | Flagship Pioneering Innovations Vi Llc | Methods and compositions for modulating a genome. |
CA3174553A1 (en) | 2020-03-05 | 2021-09-10 | Flagship Pioneering Innovations Vi, Llc | Host defense suppressing methods and compositions for modulating a genome |
-
2020
- 2020-09-03 BR BR112022003970A patent/BR112022003970A2/en unknown
- 2020-09-03 JP JP2022514694A patent/JP2022546592A/en active Pending
- 2020-09-03 KR KR1020227010704A patent/KR20220097875A/en active Pending
- 2020-09-03 EP EP20861388.5A patent/EP4025686A4/en active Pending
- 2020-09-03 GB GB2203647.9A patent/GB2605276B/en active Active
- 2020-09-03 WO PCT/US2020/049240 patent/WO2021046243A2/en unknown
- 2020-09-03 MX MX2022002613A patent/MX2022002613A/en unknown
- 2020-09-03 CN CN202080077028.9A patent/CN114981409A/en active Pending
- 2020-09-03 GB GB2409022.7A patent/GB2628935B/en active Active
- 2020-09-03 AU AU2020341479A patent/AU2020341479A1/en active Pending
- 2020-09-03 CA CA3149897A patent/CA3149897A1/en active Pending
-
2021
- 2021-10-12 US US17/499,232 patent/US11672874B2/en active Active
-
2022
- 2022-03-02 IL IL291048A patent/IL291048A/en unknown
- 2022-03-04 US US17/687,395 patent/US20220184230A1/en active Pending
- 2022-06-30 US US17/855,230 patent/US20220364110A1/en not_active Abandoned
- 2022-06-30 US US17/855,423 patent/US20220411817A1/en not_active Abandoned
-
2023
- 2023-05-05 US US18/313,126 patent/US20230364266A1/en active Pending
- 2023-05-05 US US18/313,087 patent/US20230364265A1/en active Pending
Cited By (19)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11672874B2 (en) | 2019-09-03 | 2023-06-13 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
US12252545B2 (en) | 2019-12-11 | 2025-03-18 | Myeloid Therapeutics, Inc. | Therapeutic cell compositions and methods of manufacturing and use thereof |
US11827881B2 (en) | 2020-10-21 | 2023-11-28 | Massachusetts Institute Of Technology | Systems, methods, and compositions for site-specific genetic engineering using programmable addition via site-specific targeting elements (paste) |
US11952571B2 (en) | 2020-10-21 | 2024-04-09 | Massachusetts Institute Of Technology | Systems, methods, and compositions for site-specific genetic engineering using programmable addition via site-specific targeting elements (paste) |
US11572556B2 (en) | 2020-10-21 | 2023-02-07 | Massachusetts Institute Of Technology | Systems, methods, and compositions for site-specific genetic engineering using programmable addition via site-specific targeting elements (paste) |
US12195733B2 (en) | 2020-10-21 | 2025-01-14 | Massachusetts Institute Of Technology | Systems, methods, and compositions for site-specific genetic engineering using programmable addition via site-specific targeting elements (paste) |
US11628218B2 (en) | 2020-11-04 | 2023-04-18 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
EP4282968A4 (en) * | 2021-01-22 | 2024-12-04 | Peng, Shuanghong | GENE TRANSCRIPTION FRAMEWORK, VECTOR SYSTEM, GENOME SEQUENCE EDITING METHODS AND APPLICATION |
US12030938B2 (en) | 2021-03-17 | 2024-07-09 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
WO2022241029A1 (en) * | 2021-05-11 | 2022-11-17 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
EP4337268A4 (en) * | 2021-05-11 | 2025-06-04 | Myeloid Therapeutics Inc | METHODS AND COMPOSITIONS FOR GENOMIC INTEGRATION |
US12319925B2 (en) | 2021-05-11 | 2025-06-03 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
GB2623653A (en) * | 2021-05-11 | 2024-04-24 | Myeloid Therapeutics Inc | Methods and compositions for genomic integration |
WO2023182948A1 (en) * | 2022-03-21 | 2023-09-28 | Bio Adventure Co., Ltd. | Internal ribosome entry site (ires), plasmid vector and circular mrna for enhancing protein expression |
WO2023179132A1 (en) * | 2022-03-21 | 2023-09-28 | 隋云鹏 | Rna framework for gene editing and gene editing method |
WO2024020114A3 (en) * | 2022-07-20 | 2024-03-14 | Addition Therapeutics | Genome insertions in cells |
WO2024102703A3 (en) * | 2022-11-07 | 2024-06-27 | The Regents Of The University Of California | Zikv-based gene delivery system |
WO2024193739A1 (en) * | 2023-03-23 | 2024-09-26 | Ostravska Univerzita | Method for producing proteins in host cells |
WO2024220409A1 (en) * | 2023-04-17 | 2024-10-24 | Massachusetts Institute Of Technology | Genomic editing with site-specific retrotransposons |
Also Published As
Publication number | Publication date |
---|---|
US20220364110A1 (en) | 2022-11-17 |
MX2022002613A (en) | 2022-06-02 |
CA3149897A1 (en) | 2021-03-11 |
EP4025686A2 (en) | 2022-07-13 |
US20230067484A1 (en) | 2023-03-02 |
CN114981409A (en) | 2022-08-30 |
US20220411817A1 (en) | 2022-12-29 |
AU2020341479A1 (en) | 2022-03-31 |
GB2628935A (en) | 2024-10-09 |
WO2021046243A3 (en) | 2021-06-03 |
US11672874B2 (en) | 2023-06-13 |
GB202409022D0 (en) | 2024-08-07 |
GB202203647D0 (en) | 2022-04-27 |
JP2022546592A (en) | 2022-11-04 |
WO2021046243A9 (en) | 2022-06-23 |
US20230364265A1 (en) | 2023-11-16 |
GB2605276A (en) | 2022-09-28 |
US20220184230A1 (en) | 2022-06-16 |
US20230364266A1 (en) | 2023-11-16 |
IL291048A (en) | 2022-05-01 |
KR20220097875A (en) | 2022-07-08 |
EP4025686A4 (en) | 2023-09-13 |
GB2605276B (en) | 2024-08-07 |
GB2628935B (en) | 2025-03-05 |
BR112022003970A2 (en) | 2022-06-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11672874B2 (en) | Methods and compositions for genomic integration | |
KR102729768B1 (en) | Transgenic selection methods and compositions | |
JP7601916B2 (en) | Materials and methods for delivering nucleic acids to cochlear and vestibular cells | |
AU774643B2 (en) | Compositions and methods for use in recombinational cloning of nucleic acids | |
RU2718536C2 (en) | Methods of producing and using populations of multipotent and pluripotent cells resistant to diseases and capable of differentiation | |
CA2304642C (en) | Expression of endogenous genes by non-homologous recombination of a vector construct with cellular dna | |
CN112262214A (en) | Viral vectors and packaging cell lines | |
CN115323000B (en) | Tools and methods for controlling cell proliferation using cell division loci | |
JP2020535805A (en) | Non-integrated DNA vector for gene modification of cells | |
KR20240037192A (en) | Methods and compositions for genome integration | |
KR20160102024A (en) | A method of making adenovirus and corresponding plasmids | |
KR20240022575A (en) | Armored chimeric receptors and methods of using the same | |
KR20240004253A (en) | Method for treating sensorineural hearing loss using the Autoperlin Dual Vector System | |
CN115666722A (en) | Encapsulated RNA replicons and methods of use | |
KR20200085812A (en) | Compositions and methods for inhibiting viral vector-induced inflammatory response | |
KR20210151785A (en) | Non-viral DNA vectors and their use for expression of FVIII therapeutics | |
KR20240004433A (en) | ERT2 mutants and their uses | |
CN116323942A (en) | Compositions for genome editing and methods of use thereof | |
WO2024163805A1 (en) | Methods and compositions for genomic integration | |
RU2812852C2 (en) | Non-viral dna vectors and options for their use for expression of therapeutic agent based on factor viii (fviii) | |
NL2027815B1 (en) | Genomic integration | |
HK40082332A (en) | Tools and methods for using cell division loci to control proliferation of cells |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20861388 Country of ref document: EP Kind code of ref document: A2 |
|
ENP | Entry into the national phase |
Ref document number: 3149897 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 2022514694 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022003970 Country of ref document: BR |
|
ENP | Entry into the national phase |
Ref document number: 202203647 Country of ref document: GB Kind code of ref document: A Free format text: PCT FILING DATE = 20200903 |
|
ENP | Entry into the national phase |
Ref document number: 2020341479 Country of ref document: AU Date of ref document: 20200903 Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2020861388 Country of ref document: EP Effective date: 20220404 |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20861388 Country of ref document: EP Kind code of ref document: A2 |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112022003970 Country of ref document: BR Free format text: APRESENTAR COMPLEMENTACAO DO PEDIDO (RELATORIO DESCRITIVO TRADUZIDO E DESENHOS, SE HOUVER), CONFORME PUBLICACAO INTERNACIONAL. |
|
ENP | Entry into the national phase |
Ref document number: 112022003970 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220303 |