WO2021042000A1 - Antibody compositions and methods for treating hepatitis b virus infection - Google Patents

Antibody compositions and methods for treating hepatitis b virus infection Download PDF

Info

Publication number
WO2021042000A1
WO2021042000A1 PCT/US2020/048649 US2020048649W WO2021042000A1 WO 2021042000 A1 WO2021042000 A1 WO 2021042000A1 US 2020048649 W US2020048649 W US 2020048649W WO 2021042000 A1 WO2021042000 A1 WO 2021042000A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
pharmaceutical composition
amino acid
hbsag
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/048649
Other languages
English (en)
French (fr)
Inventor
Phillip S. Pang
Erik MOGALIAN
Lynn E. CONNOLLY
Jonathan GALL
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Vir Biotechnology Inc
Original Assignee
Vir Biotechnology Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020227010266A priority Critical patent/KR20220063188A/ko
Priority to AU2020336980A priority patent/AU2020336980B2/en
Priority to EP20771699.4A priority patent/EP4021578A1/en
Priority to CN202080075610.1A priority patent/CN114630680B/zh
Priority to JP2022513208A priority patent/JP2022545920A/ja
Priority to CA3152511A priority patent/CA3152511A1/en
Priority to US17/637,605 priority patent/US20220380441A1/en
Priority to BR112022003698A priority patent/BR112022003698A2/pt
Application filed by Vir Biotechnology Inc filed Critical Vir Biotechnology Inc
Priority to NZ785788A priority patent/NZ785788B2/en
Priority to MX2022002231A priority patent/MX2022002231A/es
Publication of WO2021042000A1 publication Critical patent/WO2021042000A1/en
Priority to IL290923A priority patent/IL290923A/en
Anticipated expiration legal-status Critical
Priority to JP2025129247A priority patent/JP2025185263A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/081DNA viruses
    • C07K16/082Hepadnaviridae (F), e.g. hepatitis B virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/16Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
    • A61K47/18Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
    • A61K47/183Amino acids, e.g. glycine, EDTA or aspartame
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39591Stabilisation, fragmentation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/10Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/72Increased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the present disclosure relates to pharmaceutical antibody compositions and methods for prophylaxis and treatment of Hepatitis B Virus infection.
  • HBV consists of (i) an envelope containing three related surface proteins (hepatitis B surface antigen, HBsAg) and lipid and (ii) an icosahedral nucleocapsid enclosing the viral DNA genome and DNA polymerase.
  • the HBV capsid is formed in the cytosol of the infected cell during packaging of an RNA pregenome replication complex and gains the ability to bud during synthesis of the viral DNA genome by reverse transcription of the pregenome in the lumen of the particle.
  • the three HBV envelope proteins S-HBsAg, M-HBsAg, and L-HBsAg shape a complex transmembrane fold at the endoplasmic reticulum, and form disulfide-linked homo- and heterodimers.
  • a short linear domain in the cytosolic preS region interacts with binding sites on the capsid surface.
  • the virions are subsequently secreted into the blood.
  • the surface proteins can bud in the absence of capsids and form subviral particles (SVPs) which are also secreted in 3-4 log excess over virions.
  • SVPs subviral particles
  • High level of HBsAg can exhaust HBsAg-specific T-cell response, and is proposed as an important factor for viral immunotolerance in patients with chronic hepatitis B (CHB) (Chisari FV, Isogawa M, Wieland SF, Pathologie Biologie, 2010;58:258-66).
  • CHB chronic hepatitis B
  • Hepatitis B virus causes potentially life-threatening acute and chronic liver infections.
  • Acute hepatitis B is characterized by viremia, with or without symptoms, with the risk of fulminant hepatitis occurrence (Liang TJ, Block TM, McMahon BJ, Ghany MG, , Guo JT, Locamini S, Zoulim F, Chang KM, Lok AS.
  • Present and future therapies of hepatitis B From discovery to cure. Hepatology. 2015 Aug 3. doi: 10.1002/hep.28025. [Epub ahead of print]).
  • HDV hepatitis D infects about 15 million people worldwide.
  • HDV is considered a subviral satellite because it can propagate only in the presence of HBV.
  • HDV is one of the smallest known animal viruses (40 nm), whereby its genome is only 1.6 kb and encodes for S and L HDAg. All other proteins needed for genome replication of HDV, including the RNA polymerase, are provided by the host cell, and the HDV envelope is provided by HBV.
  • the HDV RNA genome When introduced into permissive cells, the HDV RNA genome replicates and associates with multiple copies of the HDV-encoded proteins to assemble a ribonucleoprotein (RNP) complex.
  • the RNP is exported from the cell by the HBV envelope proteins, which are able to assemble lipoprotein vesicles that bud into the lumen of a pre-Golgi compartment before being secreted.
  • the HBV envelope proteins also provide a mechanism for the targeting of HDV to an uninfected cell, thereby ensuring the spread of HDV.
  • Complications caused by HDV include a greater likelihood of experiencing liver failure in acute infections and a rapid progression to liver cirrhosis, with an increased chance of developing liver cancer in chronic infections.
  • hepatitis D In combination with hepatitis B virus, hepatitis D has the highest fatality rate of all the hepatitis infections, at 20% (Fattovich G, Giustina G, Christensen E, Pantalena M, Zagni I, Realdi G, Schalm SW. Influence of hepatitis delta virus infection on morbidity and mortality in compensated cirrhosis type B. Gut. 2000 Mar;46(3):420-6). The only approved therapy for chronic HDV infection is interferon-alpha.
  • exemplary antibody HBC34v35 (with or without Fc mutations such as MLNS and GAALIE) is also referred-to as HBC34-v35 and HBC34-V35. Accordingly, it will be understood that HBC34v35, HBC34-v35, and HBC34-V35 have the same meaning.
  • exemplary antibody HBC34v34 is also referred-to as HBC34-v34 and HBC34-V34
  • exemplary antibody HBC34v7 is also referred-to as HBC34-v7 and HBC34-V7.
  • MLNS-GAALIE has the same meaning as “MLNS_GAALIE” (i.e. M428L + N434S + G236A + A330L + I332E mutations (EU numbering) in a Fc moiety).
  • FIGS 1A-1B show binding of HBC34-v7 and two engineered antibodies of the present disclosure ("HBC34-v34"; "HBC34-v35”) at the indicated concentrations to HBsAg adw (1A) and HBsAg adr (IB), as determined in direct antigen-based ELISA assays. All antibodies were produced as IgGl (glml7, 1 allotype).
  • Figures 2A-2K show binding of HBC34-v7, HBC34-v34, and HBC34-v35 to all known HBsAg genotypes ((A)-(J), respectively) and to mock control (K).
  • Figures 3A and 3B show binding of HBC34-v7 and HBC34-v35 with wild type or variant Fc regions to HBsAg adw in a direct antigen-based ELISA assay (2 experiments; data from “Experiment 1" is shown in Figure 3 A, and data from “Experiment 2" is shown in Figure 3B).
  • Antigen-binding curves are shown in the top panel of each Figure.
  • EC50 values (determined by fitting the curves using Graphpad prism) are shown in the middle panel of each Figure.
  • Binding to uncoated plates (control) is shown in the bottom panel of each Figure.
  • HBC34-v35-MLNS-GAALIE M428L/N434S.
  • HBC34-v35-MLNS-GAALIE M428L/N434S/G236A/A330L/I332E.
  • Three lots of HBC34-v35 were tested.
  • Two lots of HBC34-v35-MLNS and two lots of HBC34-v35- MLNS-GAALIE were tested.
  • One lot of HBC34-v7 was used.
  • Figures 4-7 show the effect of HBC34-v35 on serum HBAg levels in an in vivo mouse model of HBV infection.
  • AAV/HBV-infected SCID mice were transplanted with primary human hepatocytes and administered HBC34-v35 at 1, 5, or 15 mg/kg, or PBS (control), as described in Example 5.
  • Figure 4 shows serum HBV DNA concentration before and after treatment.
  • Figure 5 shows serum HBsAg concentration before and after treatment.
  • Figure 6 shows serum HBeAg concentration before and after treatment.
  • Figure 7 shows serum HBcrAg concentration before and after treatment.
  • Figures 8A-8E show binding of HBC34-v35-MLNS and HBC34-v35-MLNS-
  • FIGS 10A and 10B show in vitro activation of human FcyRIIIa using receptor-linked activation of a NFAT-mediated Luciferase reporter in engineered Jurkat cells.
  • FcyRIIIa activation was tested using a validated, commercially available bioreporter assay in which recombinant HBsAg (Engerix B) is used as target antigen.
  • Serial dilutions of HBC34v35- MLNS and HBC34-v35-MLNS-GAALIE and a control (Ctr) mAh were incubated with 0.2 pg/ml of HBsAg at 37 °C for 25 min.
  • Jurkat effector cells Promega expressing either FcyRIIIa low affinity allele F158 (A) or FcyRIIIa high affinity allele V158 (B) were resuspended in assay buffer and then added to assay plates. After incubation at 37 °C for 24 hours, Bio-Glo-TM Luciferase Assay Reagent (Promega) was added, and luminescence was quantified using luminometer (Bio-Tek).
  • Figures 11A and 1 IB show in vitro activation of human FcyRIIa using receptor-linked activation of a NFAT-mediated luciferase reporter in engineered Jurkat cells.
  • Activation of human FcyRIIa using a validated, commercially available bioreporter assay in which recombinant HBsAg (Engerix B) is used as target antigen.
  • Serial dilutions of HBC34-v35-MLNS and HBC34-v35-MLNS-GAALIE and a control mAh (Ctr) were incubated with 2 (A) or 0.2 pg/ml (B) of HBsAg at 37 °C for 25 min.
  • Jurkat effector cells Promega expressing FcyRIIa high affinity allele H131 were resuspended in assay buffer and then added to assay plates. After incubation at 37 °C for 23 hours, Bio-Glo-TM Luciferase Assay Reagent (Promega) was added, and luminescence was quantified using luminometer (Bio-Tek).
  • Figure 12 shows in vitro activation of human FcyRIIb using receptor-linked activation of a NFAT-mediated luciferase reporter in engineered Jurkat cells.
  • Activation of human FcyRIIb was tested using a validated, commercially available bioreporter assay in which recombinant HBsAg (Engerix B) is used as target antigen.
  • Serial dilutions of HBC34-v35- MLNS and HBC34-v35-MLNS-GAALIE and a control mAb (Ctr) were incubated with 1 mg/ml of HBsAg at 37 °C for 15 min.
  • Jurkat effector cells Promega expressing FcyRIIb were resuspended in assay buffer and then added to assay plates. After incubation at 37 °C for 20 hours, Bio-Glo-TM Luciferase Assay Reagent (Promega) was added, and luminescence was quantified using luminometer (Bio-Tek).
  • FIGS 13A and 13B show in vitro killing of PLC/PRF/5 human hepatoma cells by human primary NK cells in the presence of HBC34-v35-MLNS and HBC34- v35-MLNS-GAALIE.
  • A ADCC was tested using freshly isolated NK cells from one donor previously genotyped for expressing heterozygous high (VI 58) and low (FI 58) affinity FcyRIIIa (F/V).
  • Figures 14A and 14B show in vitro activation of primary human NK cells in the presence of HBC34v35-MLNS and HBC34-v35-MLNS-GAALIE and HBsAg.
  • Activation of NK cells was tested using freshly isolated cells from two donors previously genotyped for expressing (A) homozygous high (VI 58) or (B) low (FI 58) affinity FcyRIIIa.
  • Serial dilutions of HBC34-V35, HBC34-v35-MLNS-GAALIE, and HBC34-v35-LALA mAbs were incubated with NK cells for 4 hours.
  • Activation of NK cells was measured by flow cytometry by staining NK cells with anti- CD 107a mAh, as a functional marker for the identification of NK cell activity.
  • CD 107a also known as LAMP-1, is a marker for degranulation of NK cells.
  • Figures 15A-15C show a Schedule of Assessments for healthy adult subjects in an exemplary single ascending dose (SAD) clinical study of an exemplary a pharmaceutical composition comprising antibody HBC34-v35- MLNS-GAALIE, as described in Example 9.
  • SAD single ascending dose
  • Figures 16A-16E show a Schedule of Assessments for subjects with chronic HBV infection without cirrhosis and on nucleoside reverse transcriptase inhibitor (NRTI) therapy, in the exemplary clinical study described in Example 9.
  • NRTI nucleoside reverse transcriptase inhibitor
  • Figures 17A-17C show timepoints for taking pharmacokinetic measurements of subjects according to the exemplary clinical study described in Example 9.
  • Figure 18 shows a dosing schedule according to the exemplary clinical study decribed in Example 9.
  • Figure 19 shows clinical laboratory assessments according to the exemplary clinical study described in Example 9.
  • Figure 20 shows upregulation of activation and co-stimulatory markers on monocyte-derived dendritic cells (moDCs) stimulated via immune complexes of: HBC34-v35-MLNS + HBsAg; or HBC34-v35-MLNS- GAALIE + HBsAg, as described in Example 10.
  • moDCs monocyte-derived dendritic cells
  • Figure 21 shows secretion of cytokines by moDCs stimulated via immune complexes of: HBC34-v35-MLNS + HBsAg; or HBC34-v35-MLNS- GAALIE + HBsAg, as described in Example 10.
  • Figures 22A and 22B show release of IFN-g in whole blood cultures stimulated via immune complexes with: HBC34-v35-MLNS and HBsAg; or HBC34-v35- MLNS-GAALIE and HBsAg, as described in Example 10.
  • Figures 23A and 23B show release of IL-2 in whole blood cultures stimulated via immune complexes with: HBC34-v35-MLNS and HBsAg; or HBC34-v35- MLNS-GAALIE and HBsAg, as described in Example 10.
  • Figures 24A and 24B show IFN-g and IL-2 in whole blood cultures stimulated via immune complexes with: HBC34-v35-MLNS and HBsAg; or HBC34-v35- MLNS-GAALIE and HBsAg, as described in Example 10.
  • compositions including antibodies that neutralize a Hepatitis B virus (HBV) infection and methods of using those compositions.
  • the antibodies bind an HBsAg of a genotype selected from A, B, C, D, E, F, G, H, I, and J, or any combination thereof.
  • the antibodies include mutations in the heavy chain that extend in vivo half-life of the antibodies (e.g., in a human) and mutations in the heavy chain that increase binding affinity to a FcyR (e.g., a human FcyRIIa, a human FcyRIIIa, or both).
  • the antibody and the pharmaceutical composition are well-tolerated by the subject when administered in amounts that are therapeutically effective.
  • the methods described herein include administering an antibody or pharmaceutical composition according to the present description to a subject infected by HBV.
  • a protein domain, region, or module e.g., a binding domain
  • a protein "consists essentially of' a particular amino acid sequence when the amino acid sequence of a domain, region, module, or protein includes extensions, deletions, mutations, or a combination thereof (e.g., amino acids at the amino- or carboxy-terminus or between domains) that, in combination, contribute to at most 20% (e.g., at most 15%, 10%, 8%, 6%, 5%, 4%, 3%, 2% or 1%) of the length of a domain, region, module, or protein and do not substantially affect (i.e., do not reduce the activity by more than 50%, such as no more than 40%, 30%, 25%, 20%, 15%, 10%, 5%, or 1%) the activity of the domain(s), region(
  • substantially does not exclude “completely”; e.g., a composition which is “substantially free” from Y may be completely free from Y.
  • “substantially” refers to a given amount, effect, or activity of a composition, method, or use of the present disclosure as compared to that of a reference composition, method, or use, and describes a reduction in the amount, effect, or activity of no more than 50%, such as no more than 40%, 30%, 25%, 20%, 15%, 10%, 5%, or 1%, or less, of the amount, effect, or activity of the reference composition, method, or use.
  • x in relation to a numerical value x means x ⁇ 10%, for example, x ⁇ 5%, or x ⁇ 7%, or x ⁇ 10%, or x ⁇ 12%, or x ⁇ 15%, or x ⁇ 20%.
  • "about” means ⁇ 20% of the indicated range, value, or structure.
  • “Optional” or “optionally” means that the subsequently described element, component, event, or circumstance may or may not occur, and that the description includes instances in which the element, component, event, or circumstance occurs and instances in which they do not.
  • disease as used herein is intended to be generally synonymous, and is used interchangeably with, the terms “disorder” and “condition” (as in medical condition), in that all reflect an abnormal condition of the human or animal body or of one of its parts that impairs normal functioning, is typically manifested by distinguishing signs and symptoms, and causes the affected human or animal to have a reduced duration or quality of life.
  • the term "therapeutically effective” refers to the nature or amount of a pharmaceutical composition or antibody as described herein that is sufficient to provide a benefit to the subject.
  • the benefit provided to the subject is treatment of Hepatitis B virus infection.
  • reference to "treatment” of a subject or patient is intended to include prevention, prophylaxis, attenuation, amelioration and therapy.
  • Benefits of treatment include improved clinical outcome; lessening or alleviation of symptoms associated with a disease; decreased occurrence of symptoms; improved quality of life; longer disease-free status; diminishment of extent of disease; stabilization of disease state; delay of disease progression; remission; survival; prolonged survival; or any combination thereof.
  • the terms "subject” or “patient” are used interchangeably herein to mean humans that are susceptible to infection by HBV or have already been infected by HBV.
  • a dose which is expressed as [g, mg, or other unit]/kg (or g, mg etc.) can refer to [g, mg, or other unit] "per kg (or g, mg etc.) bodyweight", even if the term "bodyweight” is not explicitly mentioned.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, g-carboxyglutamate, and O-phosphoserine.
  • Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a-carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function in a manner similar to a naturally occurring amino acid.
  • peptide refers to a molecule that comprises at least two amino acids joined to each other by a (normal or modified) peptide bond.
  • a peptide, polypeptide or protein may be composed of a plurality of amino acids selected from the 20 amino acids defined by the genetic code, each being linked to at least one other by a peptide bond.
  • a peptide, polypeptide or protein can be composed of L-amino acids and/or D-amino acids.
  • peptide also include “peptidomimetics” which are defined as peptide analogs containing non- peptidic structural elements, which peptides are capable of mimicking or antagonizing the biological action(s) of a natural parent peptide.
  • a peptidomimetic lacks characteristics such as enzymatically scissile peptide bonds.
  • a peptide, polypeptide or protein may comprise amino acids other than the 20 amino acids defined by the genetic code in addition to these amino acids, or it can be composed of amino acids other than the 20 amino acids defined by the genetic code.
  • a peptide, polypeptide or protein in the context of the present disclosure can comprise amino acids that are modified by natural processes, such as post-translational maturation processes, or by chemical processes (e.g., synthetic processes), which are known in the art and include those described herein. Such modifications can appear anywhere in the polypeptide; e,g., in the peptide skeleton; in the amino acid chain; or at the carboxy- or amino-terminal ends.
  • a peptide or polypeptide can be branched, such as following an ubiquitination, or may be cyclic, with or without branching.
  • the terms “peptide”, “polypeptide”, “protein” also include modified peptides, polypeptides and proteins.
  • peptide, polypeptide or protein modifications can include acetylation, acylation, ADP-ribosylation, amidation, covalent fixation of a nucleotide or of a nucleotide derivative, covalent fixation of a lipid or of a lipidic derivative, the covalent fixation of a phosphatidylinositol, covalent or non-covalent cross-linking, cyclization, disulfide bond formation, demethylation, glycosylation including pegylation, hydroxylation, iodization, methylation, myristoylation, oxidation, proteolytic processes, phosphorylation, prenylation, racemization, seneloylation, sulfatation, amino acid addition such as arginylation or ubiquitination.
  • variant proteins, peptides, and polypeptides of this disclosure comprise or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identical to an amino acid sequence of a defined or reference amino acid sequence as described herein.
  • polypeptide and “protein” may be used interchangeably in reference to a polymer of amino acid residues, such as a plurality of amino acid monomers linked by peptide bonds.
  • Nucleic acid molecule or “polynucleotide” or “nucleic acid” refers to a polymeric compound including covalently linked nucleotides, which can be made up of natural subunits (e.g., purine or pyrimidine bases) or non-natural subunits (e.g., morpholine ring).
  • Purine bases include adenine, guanine, hypoxanthine, and xanthine
  • pyrimidine bases include uracil, thymine, and cytosine.
  • Nucleic acid monomers can be linked by phosphodiester bonds or analogs of such linkages.
  • Analogs of phosphodiester linkages include phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phosphoranilidate, phosphoramidate, or the like.
  • Nucleic acid molecules include polyribonucleic acid (RNA), polydeoxyribonucleic acid (DNA), which includes cDNA, genomic DNA, and synthetic DNA, any of which may be single or double-stranded. If single -stranded, the nucleic acid molecule may be the coding strand or non-coding (anti-sense strand). Polynucleotides (including oligonucleotides), and fragments thereof may be generated, for example, by polymerase chain reaction (PCR) or by in vitro translation, or generated by any of ligation, scission, endonuclease action, or exonuclease action.
  • PCR polymerase chain reaction
  • a nucleic acid molecule encoding an amino acid sequence includes all nucleotide sequences that encode the same amino acid sequence. Some versions of the nucleotide sequences may also include intron(s) to the extent that the intron(s) may be removed through co- or post- transcriptional mechanisms. In other words, different nucleotide sequences may encode the same amino acid sequence as the result of the redundancy or degeneracy of the genetic code, or by splicing, or both.
  • Variants of nucleic acid molecules of this disclosure are also contemplated. Variant nucleic acid molecules are at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.9% identical a nucleic acid molecule of a defined or reference polynucleotide as described herein, or that hybridize to a polynucleotide under stringent hybridization conditions of 0.015M sodium chloride, 0.0015M sodium citrate at about 65-68°C or 0.015M sodium chloride, 0.0015M sodium citrate, and 50% formamide at about 42°C. Nucleic acid molecule variants retain the capacity to encode a fusion protein or a binding domain thereof having a functionality described herein, such as specifically binding a target molecule.
  • sequence variant refers to any sequence having one or more alterations in comparison to a reference sequence, whereby a reference sequence is any published sequence and/or of the sequences listed in the "Table of Sequences and SEQ ID Numbers" (sequence listing), i.e. SEQ ID NO: 1 to SEQ ID NO: 120.
  • sequence variant includes nucleotide sequence variants and amino acid sequence variants.
  • a sequence variant in the context of a nucleotide sequence the reference sequence is also a nucleotide sequence
  • the reference sequence is also an amino acid sequence.
  • sequence variant as used herein can be at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the reference sequence.
  • Percent sequence identity refers to a relationship between two or more sequences, as determined by comparing the sequences. Methods to determine sequence identity can be designed to give the best match between the sequences being compared. For example, the sequences may be aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment). Further, non-homologous sequences may be disregarded for comparison purposes. The percent sequence identity referenced herein is calculated over the length of the reference sequence, unless indicated otherwise. Methods to determine sequence identity and similarity can be found in publicly available computer programs.
  • Sequence alignments and percent identity calculations may be performed using a BLAST program (e.g., BLAST 2.0, BLASTP, BLASTN, or BLASTX).
  • BLAST program e.g., BLAST 2.0, BLASTP, BLASTN, or BLASTX.
  • the mathematical algorithm used in the BLAST programs can be found in Altschul et al., Nucleic Acids Res. 25:3389-3402, 1997.
  • sequence analysis software is used for analysis, the results of the analysis are based on the "default values" of the program referenced. "Default values" mean any set of values or parameters which originally load with the software when first initialized.
  • a "sequence variant" in the context of a nucleic acid (nucleotide) sequence has an altered sequence in which one or more of the nucleotides in the reference sequence is deleted, or substituted, or one or more nucleotides are inserted into the sequence of the reference nucleotide sequence. Nucleotides are referred to herein by the standard one-letter designation (A, C, G, or T). Due to the degeneracy of the genetic code, a "sequence variant" of a nucleotide sequence can either result in a change in the respective reference amino acid sequence, i.e. in an amino acid "sequence variant" or not.
  • a nucleotide sequence variant does not result in an amino acid sequence variant (e.g ., a silent mutation).
  • a nucleotide sequence variant that results in a to "non-silent" mutations is contemplated.
  • a nucleotide sequence variant of the present disclosure encodes an amino acid sequence that is at least 80%, at least 85 %, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a reference amino acid sequence.
  • Nucleotide and amino sequences as disclosed herein refer also to codon-optimized versions of a reference or wild-type nucleotide or amino acid sequence.
  • a polynucleotide of the present disclosure may be codon-optimized for a host cell containing the polynucleotide (see, e.g, Scholten et al., Clin. Immunol. 119:135-145 (2006).
  • a "sequence variant" in the context of an amino acid sequence has an altered sequence in which one or more of the amino acids is deleted, substituted, or inserted in comparison to a reference amino acid sequence.
  • a sequence variant has an amino acid sequence which is at least 80%, at least 85 %, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the reference amino acid sequence.
  • a variant sequence that has no more than 10 alterations i.e. any combination of deletions, insertions or substitutions, is "at least 90% identical" to the reference sequence.
  • a “conservative substitution” refers to amino acid substitutions that do not significantly affect or alter binding characteristics of a particular protein. Generally, conservative substitutions are ones in which a substituted amino acid residue is replaced with an amino acid residue having a similar side chain. Conservative substitutions include a substitution found in one of the following groups: Group 1: Alanine (Ala or A), Glycine (Gly or G), Serine (Ser or S), Threonine (Thr or T); Group 2: Aspartic acid (Asp or D), Glutamic acid (Glu or Z); Group 3: Asparagine (Asn or N), Glutamine (Gin or Q); Group 4: Arginine (Arg or R), Lysine (Lys or K), Histidine (His or H); Group 5: Isoleucine (lie or I), Leucine (Leu or L), Methionine (Met or M), Valine (Val or V); and Group 6: Phenylalanine (Phe or F), Tyrosine (Tyr or Y),
  • amino acids can be grouped into conservative substitution groups by similar function, chemical structure, or composition (e.g., acidic, basic, aliphatic, aromatic, or sulfur-containing).
  • an aliphatic grouping may include, for purposes of substitution, Gly, Ala, Val, Leu, and lie.
  • Other conservative substitutions groups include: sulfur-containing: Met and Cysteine (Cys or C); acidic: Asp, Glu, Asn, and Gin; small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro, and Gly; polar, negatively charged residues and their amides: Asp, Asn, Glu, and Gin; polar, positively charged residues: His, Arg, and Lys; large aliphatic, nonpolar residues: Met, Leu, lie, Val, and Cys; and large aromatic residues: Phe, Tyr, and Trp. Additional information can be found in Creighton (1984) Proteins. W.H. Freeman and Company.
  • Amino acid sequence insertions can include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include the fusion to the N- or C-terminus of an amino acid sequence to a reporter molecule or an enzyme.
  • alterations in the sequence variants do not abolish or significantly reduce a desired functionality of the respective reference sequence.
  • a variant sequence of the present disclosure does not significantly reduce or completely abrogate the functionality of a sequence of an antibody, or antigen binding fragment thereof, to bind to the same epitope and/or to sufficiently neutralize infection of HBV and HDV as compared to antibody or antigein binding fragment having (or encoded by) the reference sequence.
  • Guidance in determining which nucleotides and amino acid residues, respectively, may be substituted, inserted or deleted without abolishing a desired structure or functionality can be found by using known computer programs.
  • nucleic acid sequence or an amino acid sequence "derived from” a designated nucleic acid, peptide, polypeptide or protein refers to the origin of the nucleic acid, peptide, polypeptide or protein.
  • a nucleic acid sequence or amino acid sequence which is derived from a particular sequence may have an amino acid sequence that is essentially identical to that sequence or a portion thereof, from which it is derived, whereby "essentially identical” includes sequence variants as defined above.
  • a nucleic acid sequence or amino acid sequence which is derived from a particular peptide or protein may be derived from the corresponding domain in the particular peptide or protein.
  • "corresponding" refers to possession of a same functionality or characteristic of interest.
  • an "extracellular domain” corresponds to another “extracellular domain” (of another protein), or a “transmembrane domain” corresponds to another “transmembrane domain” (of another protein).
  • “Corresponding" parts of peptides, proteins and nucleic acids are thus easily identifiable to one of ordinary skill in the art.
  • a sequence “derived from” another (e.g., “source”) sequence can be identified by one of ordinary skill in the art as having its origin in the source sequence.
  • a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may be identical to the starting nucleic acid, peptide, polypeptide or protein (from which it is derived). However, a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may also have one or more mutations relative to the starting nucleic acid, peptide, polypeptide or protein (from which it is derived), in particular a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may be a functional sequence variant as described above of the starting nucleic acid, peptide, polypeptide or protein (from which it is derived). For example, in a peptide/protein, one or more amino acid residues may be substituted with other amino acid residues, or one or more amino acid residue insertions or deletions may occur.
  • mutation relates to a change in a nucleic acid sequence and/or in an amino acid sequence in comparison to a reference sequence, e.g. a corresponding genomic, wild type, or reference sequence.
  • a mutation e.g. in comparison to a reference genomic sequence, may be, for example, a (naturally occurring) somatic mutation, a spontaneous mutation, an induced mutation, e.g. induced by enzymes, chemicals or radiation, or a mutation obtained by site-directed mutagenesis (molecular biology methods for making specific and intentional changes in the nucleic acid sequence and/or in the amino acid sequence).
  • mutation or “mutating” shall be understood to also include physically making a mutation, e.g.
  • a mutation includes substitution, deletion and insertion of one or more nucleotides or amino acids as well as inversion of several successive nucleotides or amino acids.
  • a mutation may be introduced into the nucleotide sequence encoding said amino acid sequence in order to express a (recombinant) mutated polypeptide.
  • a mutation may be achieved, for example, by altering (e.g., by site-directed mutagenesis) a codon (e.g., by alteming one, two, or three nucleotide bases therein) of a nucleic acid molecule encoding one amino acid to provide a codon that encodes a different amino acid, or that encodes a same amino acid, or by synthesizing a sequence variant.
  • a codon e.g., by alteming one, two, or three nucleotide bases therein
  • the term "introduced” in the context of inserting a nucleic acid molecule into a cell means “transfection", or “transformation” or “transduction” and includes reference to the incorporation of a nucleic acid molecule into a eukaryotic or prokaryotic cell wherein the nucleic acid molecule may be incorporated into the genome of a cell (e.g., chromosome, plasmid, plastid, or mitochondrial DNA), converted into an autonomous replicon, or transiently expressed (e.g., transfected mRNA).
  • a cell e.g., chromosome, plasmid, plastid, or mitochondrial DNA
  • transiently expressed e.g., transfected mRNA
  • recombinant refers to any molecule (antibody, protein, nucleic acid, or the like) which is prepared, expressed, created or isolated by recombinant means, and which is not naturally occurring.
  • Recombinant can be used synonymously with “engineered” or “non-natural” and can refer to to an organism, microorganism, cell, nucleic acid molecule, or vector that includes at least one genetic alteration or has been modified by introduction of an exogenous nucleic acid molecule, wherein such alterations or modifications are introduced by genetic engineering (i.e., human intervention).
  • Genetic alterations include, for example, modifications introducing expressible nucleic acid molecules encoding proteins, fusion proteins or enzymes, or other nucleic acid molecule additions, deletions, substitutions or other functional disruption of a cell’s genetic material. Additional modifications include, for example, non coding regulatory regions in which the modifications alter expression of a polynucleotide, gene or operon.
  • heterologous or non-endogenous or exogenous refers to any gene, protein, compound, nucleic acid molecule, or activity that is not native to a host cell or a subject, or any gene, protein, compound, nucleic acid molecule, or activity native to a host cell or a subject that has been altered.
  • Heterologous, non-endogenous, or exogenous includes genes, proteins, compounds, or nucleic acid molecules that have been mutated or otherwise altered such that the structure, activity, or both is different as between the native and altered genes, proteins, compounds, or nucleic acid molecules.
  • heterologous, non- endogenous, or exogenous genes, proteins, or nucleic acid molecules may not be endogenous to a host cell or a subject, but instead nucleic acids encoding such genes, proteins, or nucleic acid molecules may have been added to a host cell by conjugation, transformation, transfection, electroporation, or the like, wherein the added nucleic acid molecule may integrate into a host cell genome or can exist as extra-chromosomal genetic material (e.g., as a plasmid or other self-replicating vector).
  • homologous or homolog refers to a gene, protein, compound, nucleic acid molecule, or activity found in or derived from a host cell, species, or strain.
  • a heterologous or exogenous polynucleotide or gene encoding a polypeptide may be homologous to a native polynucleotide or gene and encode a homologous polypeptide or activity, but the polynucleotide or polypeptide may have an altered structure, sequence, expression level, or any combination thereof.
  • a non- endogenous polynucleotide or gene, as well as the encoded polypeptide or activity may be from the same species, a different species, or a combination thereof.
  • endogenous or “native” refers to a polynucleotide, gene, protein, compound, molecule, or activity that is normally present in a host cell or a subject.
  • the terms “cell,” “cell line, “ and “cell culture” are used interchangeably and all such designations include progeny.
  • the words “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that all progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Variant progeny that have the same or substantially the same function, phenotype, or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.
  • the present disclosure is based, in part, on the design of antibodies and antigen binding fragments that are capable of neutralizing hepatitis B and hepatitis delta viruses.
  • Embodiments of the antibodies and antigen binding fragments, according to the present description may be used in methods of preventing, treating, or attenuating HBV and HDV.
  • the antibodies and antigen binding fragments described herein bind to two or more different genotypes of hepatitis B virus surface antigen and to two or more different infectious mutants of hepatitis B virus surface antigen.
  • the antibodies and antigen binding fragments described herein bind to currently all known genotypes of hepatitis B virus surface antigen and to all currently known infectious mutants of hepatitis B virus surface antigen.
  • the present disclosure provides an isolated antibody, or an antigen binding fragment thereof, for use in a pharmaceutical composition and method as disclosed herein, that binds to the antigenic loop region of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
  • antibody refers to an intact antibody comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds (though it will be understood that heavy chain antibodies, which lack light chains, are still encompassed by the term “antibody”), as well as any antigen-binding portion or fragment of an intact antibody that has or retains the ability to bind to the antigen target molecule recognized by the intact antibody, such as, for example, a scFv, Fab, or F(ab')2 fragment.
  • antibody herein is used in the broadest sense and includes polyclonal and monoclonal antibodies, including intact antibodies and functional (antigen binding) antibody fragments thereof, including fragment antigen-binding (Fab) fragments, F(ab')2 fragments, Fab' fragments, Fv fragments, recombinant IgG (rlgG) fragments, single chain antibody fragments, including single chain variable fragments (scFv), and single domain antibodies (e.g., sdAb, sdFv, nanobody) fragments.
  • Fab fragment antigen-binding
  • rlgG fragment antigen-binding
  • rlgG fragment antigen-binding fragments
  • single chain antibody fragments including single chain variable fragments (scFv), and single domain antibodies (e.g., sdAb, sdFv, nanobody) fragments.
  • the term encompasses genetically engineered and/or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, fully human antibodies, humanized antibodies, and heteroconjugate antibodies, multispecific, e.g., bispecific, antibodies, diabodies, triabodies, and tetrabodies, tandem di-scFv, tandem tri-scFv.
  • antibody should be understood to encompass functional antibody fragments thereof.
  • the term also encompasses intact or full-length antibodies, including antibodies of any class or sub-class thereof, including IgG and sub-classes thereof, IgM, IgE, IgA, and IgD.
  • antibodies of the disclosure can be of any isotype (e.g., IgA, IgG, IgM, also referred to as a, g and m heavy chain, respectively).
  • antibody is of the IgG type.
  • antibodies may be IgGl, IgG2, IgG3 or IgG4 subclass, for example IgGl.
  • an antibody comprises an amino acid sequence from two different isotypes (e.g., exchange of constant domain amino acid sequence), such as, for example, an antibody comprising a constant region that comprises amino acid sequence from an IgA antibody and amino acid sequence from an IgG antibody.
  • Antibodies of the disclosure may comprise a k or a l light chain.
  • the antibody is of IgGl type and comprises a k light chain.
  • antibody fragment As used herein, the terms “antigen binding fragment,” “fragment, “ and “antibody fragment” are used interchangeably to refer to any fragment of an antibody of the disclosure that retains the antigen-binding activity of the antibody. Examples of antibody fragments include, but are not limited to, a single chain antibody, Fab, Fab’, F(ab')2, Fv or scFv. Further, the term “antibody” as used herein, includes both antibodies and antigen binding fragments thereof. Antibodies and antigen binding fragments are discussed further herein.
  • Human antibodies are known (van Dijk, M. A., and van de Winkel, J. G., Curr. Opin. Chem. Biol. 5 (2001) 368-374). Human antibodies can be produced in transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire or a selection of human antibodies in the absence of endogenous immunoglobulin production. Transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge (see, e.g., Jakobovits, A., et al, Proc. Natl. Acad. Sci.
  • Human monoclonal antibodies may be prepared by using improved EBV-B cell immortalization as described in Traggiai E, Becker S, Subbarao K, Kolesnikova F, Uematsu Y, Gismondo MR, Murphy BR, Rappuoli R, Fanzavecchia A. (2004): An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus. Nat Med. 10(8):871-5.
  • variable region denotes each of the pair of light and heavy chains which is involved directly in binding the antibody to the antigen.
  • variable region e.g., variable region of a light chain (VL), variable region of a heavy chain (VH)
  • variable region refers to the variable region of an antibody light chain or an antibody heavy chain, which is involved directly in binding the antibody to the antigen.
  • VL variable region of a light chain
  • VH variable region of a heavy chain
  • VH variable binding region from an antibody light chain and an antibody heavy chain, respectively.
  • variable binding regions are made up of discrete, well-defined sub-regions known as “complementarity determining regions” (CDRs) and “framework regions” (FRs).
  • CDRs complementarity determining regions
  • FRs framework regions
  • HVR hypervariable region
  • each variable region of anantibody there are three CDRs in each variable region of anantibody; the VH and VL regions together comprise six CDRs HCDR1, HCDR2, HCDR3; LCDR1, LCDR2, LCDR3; also referred to herein as CDRHl, CDRH2, CDRH3,CDRL1, CDRL2, and CDRL3, respectively).
  • the CDRs on the heavy and/or light chain may be separated in primary amino acid sequence by framework regions, whereby a framework region (FR) is a region in the variable domain which is less variable (i.e., from one antibody to another (e.g., from one antibody to another encoded by a same allele or alleles)) than the CDR.
  • FR framework region
  • a chain (or each chain, respectively) may be composed of four framework regions, separated by three CDRs.
  • an antibody VH comprises four FRs and three CDRs arranged as follows: FR1- CDRH1-FR2-CDRH2-FR3-CDRH3-FR4; and an antibody VL comprises four FRs and three CDRs as follows: FR1 -CDRL 1 -FR2-CDRL2-FR3 -CDRL3 -FR4.
  • the VH and the VL together form the antigen-binding site through their respective CDRs, though it will be understood that in some cases, a binding site can be formed by or comprise one, two, three, four, or five of the CDRs.
  • a "variant" of a CDR refers to a functional variant of a CDR sequence having up to 1-3 amino acid substitutions, deletions, or combinations thereof.
  • Immunoglobulin sequences can be aligned to a numbering scheme (e.g., Rabat, EU, International Immunogenetics Information System (IMGT) and Aho), which can allow equivalent residue positions to be annotated and for different molecules to be compared using Antigen receptor Numbering And Receptor Classification (ANARCI) software tool (2016, Bioinformatics 15:298-300).
  • a numbering scheme e.g., Rabat, EU, International Immunogenetics Information System (IMGT) and Aho
  • ANARCI Antigen receptor Numbering And Receptor Classification
  • an antibody or antigen binding fragment of the present disclosure can comprise all or part of a heavy chain (HC), a light chain (LC), or both.
  • a full-length intact IgG antibody monomer typically includes a VH, a CHI, a CH2, a CH3, a VL, and a CL.
  • Fc components are described further herein.
  • the position of the CDR amino acids are defined according to the IMGT numbering system (IMGT: www.imgt.org/; cf. Lefranc, M.-P. et al. (2009) Nucleic Acids Res. 37, D1006-D1012).
  • Table 1 shows the amino acid sequences of heavy chain variable regions (VH), light chain variable regions (VL), CDRs, heavy chains (HC), and light chains (LC) of certain exemplary antibodies according to the present disclosure.
  • Fragments of the antibodies described herein can be obtained from the antibodies by methods that include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by chemical reduction. Alternatively, fragments of the antibodies can be obtained by cloning and expression of part of the sequences of the heavy or light chains.
  • Antibody "fragments” include Fab, Fab’, F(ab')2 and Fv fragments.
  • the present disclosure also encompasses single-chain Fv fragments (scFv) derived from the heavy and light chains of an antibody as described herein, including, for example, an scFv comprising the CDRs from an antibody according to the present description, heavy or light chain monomers and dimers, single domain heavy chain antibodies, single domain light chain antibodies, as well as single chain antibodies, in which the heavy and light chain variable domains are joined by a peptide linker.
  • scFv single-chain Fv fragments
  • an antibody according to the present disclosure comprises a purified antibody, a single chain antibody, Fab, Fab’, F(ab')2, Fv or scFv.
  • Antibodies and antigen binding fragments of the present disclosure may, in embodiments, be multispecific (e.g., bispecific, trispecific, tetraspecific, or the like), and may be provided in any multispecific format, as disclosed herein.
  • an antibody or antigen binding fragment of the present disclosure is a multispecific antibody, such as a bispecific or trispecific antibody. Formats for bispecific antibodies are disclosed in, for example, Spiess et ah, Mol. Immunol.
  • bispecific formats and methods of making the same are incorporated herein by reference and include, for example, Bispecific T cell Engagers (BiTEs), DARTs, Knobs-Into- Holes (KIH) assemblies, scFv-CH3-KIH assemblies, KIH Common Light-Chain antibodies, TandAbs, Triple Bodies, TriBi Minibodies, Fab-scFv, scFv-CH-CL-scFv, F(ab')2-scFv2, tetravalent HCabs, Intrabodies, CrossMabs, Dual Action Fabs (DAFs) (two-in-one or four-in- one), DutaMabs, DT-IgG, Charge Pairs, Fab-arm Exchange, SEEDbodies, Triomabs, LUZ-Y assemblies, Fcabs, kl-bodies, orthogonal Fabs
  • a bispecific or multispecific antibody may comprise a HBV- and/or HDV-specific binding domain of the instant disclosure in combination with another HBV- and/or HDV-specific binding domain of the instant disclosure, or in combination with a different binding domain that specifically binds to HBV and/or HDV (e.g., at a same or a different epitope), or with a binding domain that specifically binds to a different antigen.
  • Antibody fragments of the disclosure may impart monovalent or multivalent interactions and be contained in a variety of structures as described above.
  • scFv molecules may be synthesized to create a trivalent "triabody” or a tetravalent "tetrabody".
  • the scFv molecules may include a domain of the Fc region resulting in bivalent minibodies.
  • the sequences of the disclosure may be a component of multispecific molecules in which the sequences of the disclosure target the epitopes of the disclosure and other regions of the molecule bind to other targets.
  • Exemplary molecules include, but are not limited to, bispecific Fab2, trispecific Fab3, bispecific scFv, and diabodies (Holliger and Hudson, 2005, Nature Biotechnology 9: 1126-1136).
  • an antibody may be present in a pharmaceutical composition that is substantially free of other polypeptides e.g., where less than 90% (by weight), usually less than 60% and more usually less than 50% of the pharmaceutical composition is made up of other polypeptides.
  • Antibodies according to the present disclosure may be immunogenic in human and/or in non human (or heterologous) hosts; e.g., in mice.
  • an antibody may have an idiotope that is immunogenic in non-human hosts, but not in a human host.
  • Antibodies of the disclosure for human use include those that are not typically isolated from hosts such as mice, goats, rabbits, rats, non-primate mammals, or the like, and in some instances are not obtained by humanization or from xeno-mice.
  • an antibody according to the present disclosure is non-immunogenic or is substantially non-immunogenic in a human.
  • a neutralizing antibody is one that can neutralize, i.e., prevent, inhibit, reduce, impede or interfere with, the ability of a pathogen to initiate and/or perpetuate an infection in a host (e.g., host organism or host cell).
  • the terms "neutralizing antibody” and “an antibody that neutralizes” or “antibodies that neutralize” are used interchangeably herein.
  • These antibodies can be used alone, or in combination (e.g., two or more of the presently disclosed antibodies in a combination, or an antibody of the present disclosure in combination with another agent, which may or may not be an antibody agent, including an antibody that is capable of neutralizing an HBV B and/or D infection), as prophylactic or therapeutic agents upon appropriate formulation, in association with active vaccination.
  • binding protein e.g., an antibody or antigen binding fragment thereof
  • binding domain a binding domain to a target molecule with an affinity or Ka (i.e.. an equilibrium association constant of a particular binding interaction with units of 1/M) equal to or greater than 10 5 M 1 (which equals the ratio of the on-rate [K on ] to the off rate [Kofi] for this association reaction), while not significantly associating or uniting with any other molecules or components in a sample.
  • binding domains may be classified as "high-affinity" binding proteins or binding domains or as "low-affinity” binding proteins or binding domains.
  • High-affinity binding proteins or binding domains refer to those binding proteins or binding domains having a Ka of at least 10 7 M 1 , at least 10 8 M 1 , at least 10 9 M 1 , at least 10 10 M 1 , at least 10 11 M 1 , at least 10 12 M 1 , or at least 10 13 M 1 .
  • Low -affinity binding proteins or binding domains refer to those binding proteins or binding domains having a Ka of up to 10 7 M 1 , up to 10 6 M 1 , or up to 10 5 M 1 .
  • affinity may be defined as an equilibrium dissociation constant (Kd) of a particular binding interaction with units of M (e.g., 10 5 M to 10 13 M).
  • Kd equilibrium dissociation constant
  • antibodies according to the present disclosure can bind to the antigenic loop region of HBsAg.
  • the envelope of the hepatitis B virus generally contains three "HBV envelope proteins" (also known as "HBsAg", “hepatitis B surface antigen"): S protein (for "small”, also referred to as S-HBsAg), M protein (for “middle”, also referred to as M-HBsAg) and L protein (for "large”, also referred to as L-HBsAg).
  • S-HBsAg, M-HBsAg and L-HBsAg share the same C-terminal extremity (also referred to as "S domain", 226 amino acids), which corresponds to the S protein (S-HBsAg) and which is crucial for virus assembly and infectivity.
  • S-HBsAg, M-HBsAg and L-HBsAg are synthesized in the endoplasmic reticulum (ER), assembled, and secreted as particles through the Golgi apparatus.
  • the S domain comprises four predicted transmembrane (TM) domains, whereby both the N-terminus as well as the C- terminus of the S domain are exposed to the lumen.
  • the transmembrane domains TM1 and TM2 are both believed necessary for cotranslational protein integration into the ER membrane and the transmembrane domains TM3 and TM4 are located in the C-terminal third of the S domain.
  • the "antigenic loop region" of HBsAg is located between the predicted TM3 and TM4 transmembrane domains of the S domain of HBsAg, whereby the antigenic loop region comprises amino acids 101 - 172 of the S domain, which contains 226 amino acids in total (Salisse J. and Sureau C., 2009, Journal of Virology 83: 9321-9328).
  • a determinant of infectivity resides in the antigenic loop region of HBV envelope proteins.
  • residues between 119 and 125 of the HBsAg contain a CXXC motif, which is considered to be important for the infectivity of HBV and HDV (Jaoude GA, Sureau C, Journal of Virology, 2005;79: 10460-6).
  • positions in the amino acid sequence of the S domain of HbsAg are referred to herein, such positions are made with reference to the amino acid sequence as set forth in SEQ ID NO: 3 (shown below) or to natural or artificial sequence variants thereof.
  • MENITSGFLGPLLVLQ AGFFLLTRILTIPQ SLD S WWTSLNFLGGTTV CLGQN S Q SPTSNH SPTSCPPTCPGYRWMCFRRFIIFFFIFFFCFIFFFVFFDY OGMFPV CPFIPGS STTSTGPCR TCMTTAOGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFFWEWASARFSWFSFFVPFV QWFVGFSPTVWFSVIWMMWYWGPSFYSIFSPFFPFFPIFFCFWVYI (SEQ ID NO: 3; amino acids 101 - 172 are shown underlined)
  • amino acids 101 - 172 of the S domain refers to the amino acid residues from positions 101 - 172 of the polypeptide according to SEQ ID NO: 3.
  • mutations or variations including, but not limited to, substitution, deletion and/or addition, for example, HBsAg of a different genotype or a different HBsAg mutant as described herein may occur naturally in the amino acid sequence of the S domain of HBsAg or be introduced artificially into the amino acid sequence of the S domain of HBsAg without affecting its biological properties.
  • S domain of HBsAg encompasses all such polypeptides including, for example, the polypeptide according to SEQ ID NO: 3 and its natural or artificial mutants.
  • sequence fragments of the S domain of HBsAg are described herein (e.g. amino acids 101 - 172 or amino acids 120 -130 of the S domain of HBsAg), they include not only the corresponding sequence fragments of SEQ ID NO: 3, but also the corresponding sequence fragments of its natural or artificial mutants.
  • amino acid residues from positions 101 - 172 of the S domain of HBsAg encompasses amino acid residues from positions 101 - 172 of SEQ ID NO: 3 and the corresponding fragments of its mutants (natural or artificial mutants).
  • corresponding sequence fragments and corresponding fragments referto fragments that are located in equal positions of sequences when the sequences are subjected to optimized alignment, namely, the sequences are aligned to obtain a highest percentage of identity.
  • the M protein corresponds to the S protein extended by an N-terminal domain of 55 amino acids called "pre-S2".
  • the L protein (L-HBsAg) corresponds to the M protein extended by an N-terminal domain of 108 amino acids called "pre-Sl” (genotype D).
  • pre-S1 and pre-S2 domains of the L protein can be present either at the inner face of viral particles (on the cytoplasmic side of the ER), and is believed to play a crucial role in virus assembly, or on the outer face (on the luminal side of the ER), available for the interaction with target cells and important for viral infectivity.
  • HBV surface proteins are not only incorporated into virion envelopes but also can spontaneously bud from ER-Golgi intermediate compartment membranes to form empty "subviral particles” (SVPs) that are released from the cell by secretion.
  • an antibody or antigen binding fragment binds to the antigenic loop region ofHBsAg, and is capable of binding to all of S-HBsAg, M-HBsAg and L-HBsAg.
  • an antibody or antigen binding fragment neutralizes infection with hepatitis B virus and hepatitis delta virus. In some embodiments, the antibody or antigen binding fragment, reduces viral infectivity of hepatitis B virus and hepatitis delta virus.
  • neutralization assays animal viruses are typically propagated in cells and/or cell lines.
  • a neutralization assay wherein cultured cells are incubated with a fixed amount of HBV or HDV in the presence (or absence) of the antibody (or antigen binding fragment) to be tested may be used.
  • the levels of hepatitis B surface antigen (HBsAg) or hepatitis B e antigen (HBeAg) secreted into the cell culture supernatant may be used and/or HBeAg staining may be assessed to provide a readout.
  • HBeAg staining may be assessed for HDV.
  • cultured cells for example HepaRG cells, such as differentiated HepaRG cells
  • incubation may be carried out, for example, for 16 hours at 37°C. That incubation may be performed in a medium (e.g. supplemented with 4% PEG 8000). After incubation, cells may be washed and further cultivated.
  • HBsAg hepatitis B surface antigen
  • HBeAg hepatitis B e antigen
  • HBeAg staining may be assessed in an immunofluorescence assay.
  • a HDV neutralization assay essentially the same assay as for HBV may be used, with the difference that sera from HDV carriers may be used as HDV infection inoculum on differentiated HepaRg cells (instead of HBV). For detection, delta antigen immunofluorescence staining may be used as a readout.
  • Embodiments of the antibodies of the disclosure have high neutralizing potency (e.g., in vitro).
  • the concentration of an antibody as described herein required for 50% neutralization of hepatitis B virus (HBV) and hepatitis delta virus (HDV) is, for example, about 10 pg/ml or less.
  • the concentration of an antibodyrequired for 50% neutralization of HBV and HDV is about 5 pg/ml.
  • the concentration of an antibody as described herein required for 50% neutralization of HBV and HDV is about 1 pg/ml.
  • the concentration of an antibody required for 50% neutralization of HBV and HDV is about 750 ng/ml.
  • the concentration of an antibody as described herein required for 50% neutralization of HBV and HDV is 500 ng/ml or less.
  • the concentration of an antibody as described herein required for 50% neutralization of HBV and HDV may be selected from 450 ng/ml or less, 400 ng/ml or less, 350 ng/ml or less, 300 ng/ml or less, 250 ng/ml or less, 200 ng/ml or less, 175 ng/ml or less, 150 ng/ml or less, 125 ng/ml or less, 100 ng/ml or less, 90 ng/ml or less, 80 ng/ml or less, 70 ng/ml or less, 60 ng/ml or less or 50 ng/ml or less.
  • Antibodies or antigen binding fragments according to the present disclosure are useful in the prevention and treatment of hepatitis B and hepatitis D.
  • Infection with HDV typically occurs simultaneously with or subsequent to infection by HBV (e.g., inoculation with HDV in the absence of HBV does not cause hepatitis D since HDV requires the support of HBV for its own replication) and hepatitis D is typically observed in chronic HBV carriers.
  • Embodiments of the disclosed antibodies promote clearance of HBsAg and HBV.
  • antibodies promote clearance of both HBV and subviral particles of hepatitis B virus (SVPs).
  • Clearance of HBsAg or of subviral particles may be assessed by measuring the level of HBsAg for example in a blood sample, e.g. from a hepatitis B patient.
  • clearance of HBV may be assessed by measuring the level of HBV for example in a blood sample, e.g. from a hepatitis B patient.
  • hepatitis B surface antigen (HBsAg) loss is considered in some instances to be an endpoint of treatment and the closest outcome to cure chronic hepatitis B (CHB).
  • Embodiments of antibodies of the present disclosure may promote clearance of HbsAg.
  • the antibodies promote clearance of subviral particles of hepatitis B virus.
  • the antibodies e.g., in a presently disclosed pharmaceutical composition
  • an antibody or the antigen binding fragment binds an HBsAg of a genotype selected from the HBsAg genotypes A, B, C, D, E, F, G, H, I, and J, or any combination thereof.
  • an antibody or antigen binding fragment of the present disclosure binds to 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 of the HBsAg genotypes A, B, C, D, E, F, G, H, I, and J.
  • HBsAg genotypes include the following: GenBank accession number J02203 (HBV-D, ayw3); GenBank accession number FJ899792.1 (HBV-D, adw2); GenBank accession number AM282986 (HBV-A); GenBank accession number D23678 (HBV-B1 Japan); GenBank accession number AB117758 (HBV-C1 Cambodia); GenBank accession number AB205192 (HBV-E Ghana); GenBank accession number X69798 (HBV-F4 Brazil); GenBank accession number AF160501 (HBV-G USA); GenBank accession number AY090454 (HBV-H Portugal); GenBank accession number AF241409 (HBV-I Vietnam);
  • an antibody or antigen binding fragment binds to at least 6 of the 10 HBsAg genotypes A, B, C, D, E, F, G, H, I, and J. In certain embodiments, an antibody or antigen binding fragment binds to at least 8 of the 10 HBsAg genotypes A, B, C, D, E, F, G, H, I, and J. In some embodiments, an antibody or antigen binding fragment binds to all 10 of the 10 HBsAg genotypes A, B, C, D, E, F, G, H, I, and J. HBV is differentiated into several genotypes, according to genome sequence. To date, eight well-known genotypes (A-H) of the HBV genome have been defined.
  • genotypes I and J have also been identified (Sunbul M., 2014, World J Gastroenterol 20(18): 5427-5434). The genotype is known to affect the progression of the disease and differences between genotypes in response to antiviral treatment have been determined.
  • an antibody or antigen binding fragment according to the present disclosure binds to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 or 18 of the HBsAg mutants having mutations in the antigenic loop region, with such mutant(s) being selected from one ore more of HBsAg Y100C/P120T, HBsAg P120T, HBsAg P120T/S143L, HBsAg C121S, HBsAg R122D, HBsAg R122I, HBsAg T123N, HBsAg Q129H, HBsAg Q129L, HBsAg M133H, HBsAg M133L, HBsAg M133T, HBsAg K141E, HBsAg P142S, HBsAg S143K, HBsAg D144A, HBsAg G145R and HBsAg N146A.
  • mutants are naturally occurring mutants based on the S domain of HBsAg Genotype D, Genbank accession no. FJ899792 (SEQ ID NO: 4).
  • the mutated amino acid residue(s) in each of the mutants noted herein are indicated in the name.
  • the antigenic loop region i.e. amino acids 101 - 172, is shown underlined.
  • Amino acid sequences of the antigenic loop region of the S domain of HBsAg of different mutants are shown in SEQ ID NOs: 16 - 33.
  • an antibody or antigen binding fragment binds to at least 12 infectious HBsAg mutants selected from HBsAg Y100C/P120T, HBsAg P120T, HBsAg P120T/S143L, HBsAg C121S, HBsAg R122D, HBsAg R122I, HBsAg T123N, HBsAg Q129H, HBsAg Q129L, HBsAg M133H, HBsAg M133L, HBsAg M133T, HBsAg K141E, HBsAg P142S, HBsAg S143K, HBsAg D144A, HBsAg G145R and HBsAg N146A.
  • an antibody according to the present disclosure binds to at least 15 infectious HBsAg mutants selected from HBsAg Y100C/P120T, HBsAg P120T, HBsAg P120T/S143L, HBsAg C121S, HBsAg R122D, HBsAg R122I, HBsAg T123N, HBsAg Q129H, HBsAg Q129L, HBsAg M133H, HBsAg M133L, HBsAg M133T, HBsAg K141E, HBsAg P142S, HBsAg S143K, HBsAg D144A, HBsAg G145R and HBsAg N146A.
  • an antibody or antigen binding fragment binds to each of the following infectious HBsAg mutants: HBsAg Y100C/P120T; HBsAg P120T; HBsAg P120T/S143L; HBsAg C121S; HBsAg R122D; HBsAg R122I; HBsAg T123N; HBsAg Q129H; HBsAg Q129L; HBsAg M133H; HBsAg M133L; HBsAg M133T; HBsAg K141E; HBsAg P142S; HBsAg S143K; HBsAg D144A; HBsAg G145R; and HBsAg N146A.
  • the antibody or pharmaceutical composition comprising the same reduces a serum concentration of HBV DNA in a mammal having an HBV infection. In certain embodiments, the antibody or pharmaceutical composition comprising the same reduces a serum concentration of HBsAg in a mammal having an HBV infection. In certain embodiments, the antibody pharmaceutical composition comprising the same reduces a serum concentration of HBeAg in a mammal having an HBV infection. In certain embodiments, the antibody or pharmaceutical composition comprising the same reduces a serum concentration of HBcrAg in a mammal having an HBV infection.
  • epitope includes any molecule, structure, amino acid sequence, or protein determinant that is recognized and specifically bound by a cognate binding molecule, such as an immunoglobulin, chimeric antigen receptor, or other binding molecule, domain or protein.
  • Epitopic determinants generally contain chemically active surface groupings of molecules, such as amino acids or sugar side chains, and can have specific three dimensional structural characteristics, as well as specific charge characteristics.
  • an antibody or antigen binding fragment binds to an epitope comprising at least one, at least two, at least three, or at least four amino acids of the antigenic loop region of HbsAg.
  • an antibody or antigen binding fragment binds at least two amino acids selected from amino acids 115 - 133 of the S domain of HbsAg, amino acids 120 - 133 of the S domain of HbsAg, or amino acids 120 - 130 of the S domain of HbsAg. In certain embodiments, an antibody or antigen binding fragment binds at least three amino acids selected from amino acids 115 - 133 of the S domain of HbsAg, amino acids 120 - 133 of the S domain of HbsAg, or amino acids 120 - 130 of the S domain of HbsAg.
  • an antibody or antigen binding fragment binds at least four amino acids selected from amino acids 115 - 133 of the S domain of HbsAg, amino acids 120 - 133 of the S domain of HbsAg, or amino acids 120 - 130 of the S domain of HbsAg.
  • the position of the amino acids refers to the S domain of HBsAg as described above, which is present in all three HBV envelope proteins S-HBsAg, M-HBsAg, and L- HBsAg, whereby S-HBsAg typically corresponds to the S domain of HBsAg.
  • epitope formed by means that the epitope to which an antibody, or an antigen binding fragment thereof, binds to may be linear (continuous) or conformational (discontinuous).
  • a linear or a sequential epitope is an epitope that is recognized by an antibody according to its linear sequence of amino acids, or primary structure.
  • a conformational epitope may be recognized according to a three-dimensional shape and protein structure.
  • the epitope is a linear epitope and comprises more than one amino acid located at positions selected from amino acid positions 115 -133 or from amino acid positions 120 -133 of the S domain of HBsAg
  • the amino acids comprised by the epitope may be located in adjacent positions of the primary structure (e.g., are consecutive amino acids in the amino acid sequence).
  • the amino acid sequence typically forms a 3D structure as epitope and, thus, the amino acids forming the epitope may be or may be not located in adjacent positions of the primary structure (i.e. maybe or may be not consecutive amino acids in the amino acid sequence).
  • an epitope to which an antibody or antigen binding fragment binds to a conformational epitope binds to an epitope comprising at least two amino acids of the antigenic loop region of HBsAg, wherein the at least two amino acids are selected from amino acids 120 - 133 or from from amino acids 120 - 130, of the S domain of HbsAg, and wherein the at least two amino acids are not located in adjacent positions (of the primary structure).
  • an antibody or antigen binding fragment binds to an epitope comprising at least three amino acids of the antigenic loop region of HBsAg, wherein the at least three amino acids are selected from amino acids 120 - 133 or from from amino acids 120 - 130, of the S domain of HbsAg, and wherein at least two of the three amino acids are not located in adjacent positions (of the primary structure).
  • a binding protein binds to an epitope comprising at least four amino acids of the antigenic loop region of HBsAg, wherein the at least four amino acids are selected from amino acids 120 - 133 or from from amino acids 120 - 130, of the S domain of HbsAg, and wherein at least two of the four amino acids are not located in adjacent positions (of the primary structure).
  • Amino acids to which a presently disclosed antibody or antigen binding fragment binds i.e. the amino acids forming the epitope
  • Amino acids to which a presently disclosed antibody or antigen binding fragment binds are in some cases spaced apart by one or more amino acids, to which the antibody or antigen binding fragment does not bind.
  • at least one, at least two, at least three, at least four, or at least five amino acids may be located between two of the amino acids not located in adjacent positions comprised by the epitope.
  • an antibody or antigen binding fragment binds to an epitope comprising at least amino acids P120, C121, R122 and C124 of the S domain of HBsAg. In other embodiments, an antibody or antigen binding fragment of the present disclosure binds to an epitope comprising an amino acid sequence according to SEQ ID NO: 88:
  • PCRXC wherein X is any amino acid or no amino acid; X is any amino acid; X is any amino acid; X is T, Y, R, S, or F; X is T, Y or R; or X is T or R.
  • an antibody or antigen binding fragment of the present disclosure binds to an epitope comprising an amino acid sequence according to SEQ ID NO: 80:
  • TGPCRTC or to an amino acid sequence sharing at least 80%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 80.
  • an antibody or antigen binding fragment of the present disclosure binds to an epitope comprising an amino acid sequence according to SEQ ID NO: 85: STTSTGPCRTC or to an amino acid sequence sharing at least 80%, at least 90% or at least 95% sequence identity with SEQ ID NO: 85.
  • an antibody or antigen binding fragment of the present disclosure binds to an epitope comprising an amino acid sequence comprising at least amino acids 145 - 151 of the S domain of HBsAg:
  • GNCTCIP (SEQ ID NO: 81).
  • an antibody or antigen binding fragment of the present disclosure binds to an epitope comprising an amino acid sequence according to SEQ ID NO: 80 and an amino acid sequence according to SEQ ID NO: 81.
  • an antibody or antigen binding fragment of the present disclosure binds to an epitope comprising an amino acid sequence according to SEQ ID NO: 85 and/or an amino acid sequence according to SEQ ID NO: 87.
  • an epitope to which an antibody or antigen binding fragment of the present disclosure binds may be linear (continuous) or conformational (discontinuous).
  • an antibody or antigen binding fragment of the disclosure binds to a conformational epitope, and in certain such embodiments, the conformational epitope is present only under non-reducing conditions.
  • an antibody or antigen binding fragment of the present disclosure binds to a linear epitope.
  • the the linear epitope is present under both, non-reducing conditions and reducing conditions.
  • an antibody or antigen binding fragment of the present disclosure binds to an epitope in the antigenic loop of HBsAg formed by an amino acid sequence according to SEQ ID NO: 1:
  • Xi, X2, X3, X4, X5, Xe and X7 are amino acids, which are conservatively substituted in comparison to amino acids 120 - 130 of SEQ ID NO: 3.
  • Xi, X2, X3, X4, X5, Xe and X7 are amino acids, which are conservatively substituted in comparison to amino acids 20 - 30 of any of SEQ ID NOs 5 - 33.
  • Xi of SEQ ID NO: 1 Xi is a small amino acid.
  • a "small" amino acid refers to any amino acid selected from the group consisting of alanine, aspartic acid, asparagine, cysteine, glycine, proline, serine, threonine and valine. In certain such embodiments, Xi is proline, serine or threonine.
  • X2 of SEQ ID NO: 1 X2 is a small amino acid.
  • X2 may be selected from cystein or threonine.
  • X3of SEQ ID NO: 1 is a charged amino acid or an aliphatic amino acid.
  • a "charged” amino acid, as used herein, refers to any amino acid selected from the group consisting of arginine, lysine, aspartic acid, glutamic acid and histidine.
  • a "aliphatic” amino acid, as used herein, refers to any amino acid selected from the group consisting of alanine, glycine, isoleucine, leucine, and valine.
  • X3 is selected from arginine, lysine, aspartic acid or isoleucine.
  • X4 of SEQ ID NO: 1 is a small amino acid and/or a hydrophobic amino acid.
  • a "hydrophobic" amino acid refers to any amino acid selected from the group consisting of alanine, isoleucine, leucine, phenylalanine, valine, tryptophan, tyrosine, methionine, proline and glycine.
  • X4 is selected from methionine or threonine.
  • X5 of SEQ ID NO: 1 X5 is a small amino acid and/or a hydrophobic amino acid. In certain embodiments, X5 is selected from threonine, alanine or isoleucine.
  • Xe of SEQ ID NO: 1 Xe is a small amino acid and/or a hydrophobic amino acid.
  • Cb is selected from threonine, proline or leucine.
  • X7 of SEQ ID NO: 1 is a polar amino acid or an aliphatic amino acid.
  • a "polar" amino acid refers to any amino acid selected from the group consisting of aspartic acid, asparagine, arginine, glutamic acid, histidine, lysine, glutamine, tryptophan, tyrosine, serine, and threonine.
  • X 7 is glutamine, histidine or leucine.
  • abinding protein according to the present disclosure binds to an epitope in the antigenic loop of HBsAg formed by an amino acid sequence according to SEQ ID NO: 2:
  • X 2 is C or S
  • X 3 is R, K, D or I
  • X 4 is M or T
  • x 5 is T, A or I
  • Xe is T, P or L
  • Xv is Q, H or L
  • a binding protein may bind only to some of the amino acids of SEQ ID NO: 1 or 2, whereby other amino acid residues may act as "spacers".
  • an antibody or antigen binding fragment according to the present disclosure binds to an epitope in the antigenic loop of HBsAg formed by one or more, two or more, three or more, or four or more amino acids of an amino acid sequence selected from SEQ ID NOs 5 - 33 shown below in Table 3.
  • an antibody or antigen binding fragment according to the present disclosure binds to an antigenic loop region of HBsAg having an amino acid sequence according to any one or more of SEQ ID NOs 5 - 33 shown below in Table 3, or to a sequence variant thereof. In certain embodiments, an antibody or antigen binding fragment according to the present disclosure binds to all of the antigenic loop variants of HBsAg having an amino acid sequence according to any of SEQ ID NOs 5 - 33 shown below in Table 3.
  • Table 3 Exemplary amino acid sequences of the antigenic loop region of the S domain of HBsAg (residues 101-172 of the S domain of HBsAg - except for SEQ ID NO: 16, which refers to residues 100-172 of the S domain of HBsAg in order to include the relevant mutation) of the different genotypes and mutants as used herein.
  • the present disclosure provides an isolated antibody, or an antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure, which comprises: (i) a heavy chain variable region (VH) comprising at least 90% identity to the amino acid sequence according to SEQ ID NO:41 or 67; and (ii) a light chain variable region (VL) comprising at least 90% identity to the amino acid sequence according to any one of SEQ ID NOs:42; 59; 65; 89, 90, or 110-120, provided that the amino acid at position 40 of the VL according to IMGT numbering is not a cysteine, wherein the antibody or antigen binding fragment thereof binds to the antigenic loop region of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
  • VH heavy chain variable region
  • VL light chain variable region
  • the V H comprises at least 95% identity to the amino acid sequence according to SEQ ID NO:41 or 67; and/or (ii) the V L comprises at least 95% identity to the amino acid sequence according to any one of SEQ ID NOs:42, 59, 65, 89, 90, or 110-120.
  • the amino acid at position 40 of the V L is alanine. In other embodiments, the amino acid at position 40 of the V L is serine. In still other embodiments, the amino acid at position 40 of the V L is glycine.
  • the antibody or antigen binding fragment suitable for use in the pharmaceutical compositions and methods of the present disclosure can comprise CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 sequences according to SEQ ID NOs: (i) 34-36, 37, 38, and 40, respectively; (ii) 34, 66, 36, 37, 38, and 40, respectively; (iii) 34-36, 37, 39, and 40, respectively; (iv) 34, 66, 36, 37, 39, and 40, respectively; (v) 34-36, 37, 38, and 58, respectively; (vi) 34, 66, 36, 37, 38, and 58, respectively; (vii) 34-36, 37, 39, and 58, respectively; or (vii) 34, 66, 36, 37, 39, and 58, respectively.
  • the V L of the antibody or antigen binding fragment suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises or consists of the amino acid sequence according to SEQ ID NO: 89. In some embodiments, the V L of the antibody or antigen binding fragment suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises or consists of the amino acid sequence according to SEQ ID NO: 90. In other embodiments, the V L of the antibody or antigen binding fragment suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises or consists of the amino acid sequence according to any one of SEQ ID NOs: 109- 120. In certain embodiments, the V H comprises or consists of the amino acid sequence according to SEQ ID NO:41. In other embodiments, the V H comprises or consists of the amino acid sequence according to SEQ ID NO:67.
  • the V H comprises or consists of the amino acid sequence according to SEQ ID NO:41 and the V L comprises or consists of the amino acid sequence according to SEQ ID NO:89. In other embodiments, the V H comprises or consists of the amino acid sequence according to SEQ ID NO:41 and the V L comprises or consists of the amino acid sequence according to SEQ ID NO:90. In certain embodiments, the the V H comprises or consists of the amino acid sequence according to SEQ ID NO:41 and the V L comprises or consists of the amino acid sequence according to any one of SEQ ID NOs: 109-120. In other embodiments, the the V H comprises or consists of the amino acid sequence according to SEQ ID NO:67 and the V L comprises or consists of the amino acid sequence according to any one of SEQ ID NOs: 109-120.
  • the present disclosure provides an isolated antibody, or an antigen binding fragment thereof, suitable for use in the pharmaceutical compositions and methods of the present disclosure, which comprises: (i) a heavy chain variable region (V H ) comprising at least 90% identity to the amino acid sequence according to SEQ ID NO:95; and (ii) a light chain variable region (V L ) comprising at least 90% identity to the amino acid sequence according to SEQ ID NO:96, wherein the antibody or antigen binding fragment thereof binds to the antigenic loop region of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
  • V H heavy chain variable region
  • V L light chain variable region
  • the VH comprises at least 95% identity to the amino acid sequence according to SEQ ID NO:95; and/or (ii) the VL comprises at least 95% identity to the amino acid sequence according to SEQ ID NO:96.
  • the antibody or antigen binding fragment comprises CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 sequences according to SEQ ID NOs:97-102, respectively.
  • the VH comprises or consists of the amino acid sequence according to SEQ ID NO:95; and the VL comprises or consists of the amino acid sequence according to SEQ ID NO: 96
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises an Fc moiety.
  • the Fc moiety may be derived from human origin, e.g., from human IgGl, IgG2, IgG3, and/or IgG4.
  • an antibody or antigen binding fragment can comprise an Fc moiety derived from human IgGl.
  • an Fc moiety refers to a sequence comprising or derived from a portion of an immunoglobulin heavy chain beginning in the hinge region just upstream of the papain cleavage site (e.g., residue 216 in native IgG, taking the first residue of heavy chain constant region to be 114) and ending at the C-terminus of the immunoglobulin heavy chain.
  • an Fc moiety may be a complete Fc moiety or a portion (e.g., a domain) thereof.
  • a complete Fc moiety comprises a hinge domain, a CH2 domain, and a CH3 domain (e.g., EU amino acid positions 216-446).
  • An additional lysine residue (K) is sometimes present at the extreme C-terminus of the Fc moiety, but is often cleaved from a mature antibody.
  • Amino acid positions within an Fc moiety herein are numbered according to the EU numbering system of Kabat, see e.g., Kabat etal., "Sequences of Proteins of Immunological Interest", U.S. Dept. Health and Human Services, 1983 and 1987. Amino acid positions of an Fc moirty can also be numbered according to the IMGT numbering system (including unique numbering for the C-domain and exon numbering) and the Kabat numbering system.
  • an Fc moiety comprises at least one of: a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant, portion, or fragment thereof.
  • a hinge e.g., upper, middle, and/or lower hinge region
  • an Fc moiety comprises at least a hinge domain, a CH2 domain or a CH3 domain.
  • the Fc moiety is a complete Fc moiety.
  • the amino acid sequence of an exemplary Fc moiety of human IgGl isotype is provided in SEQ ID NO: 137.
  • the Fc moiety may also comprise one or more amino acid insertions, deletions, or substitutions relative to a naturally occurring Fc moiety.
  • an Fc moiety may comprise or consist of: (i) hinge domain (or a portion thereof) fused to a CH2 domain (or a portion thereof), (ii) a hinge domain (or a portion thereof) fused to a CH3 domain (or a portion thereof), (iii) a CH2 domain (or a portion thereof) fused to a CH3 domain (or a portion thereof), (iv) a hinge domain (or a portion thereof), (v) a CH2 domain (or a portion thereof), or (vi) a CH3 domain or a portion thereof.
  • An Fc moiety of the present disclosure may be modified such that it varies in amino acid sequence from the complete Fc moiety of a naturally occurring immunoglobulin molecule, while retaining or enhancing at least one desirable function conferred by the naturally occurring Fc moiety.
  • Such functions include, for example, Fc receptor (FcR) binding, antibody half-life modulation (e.g., by binding to FcRn), ADCC function, protein A binding, protein G binding, and complement binding.
  • FcR Fc receptor
  • the Clq protein complex can bind to at least two molecules of IgGl or one molecule of IgM when the immunoglobulin molecule(s) is attached to the antigenic target (Ward, E. S., and Ghetie, V., Ther. Immunol. 2 (1995) 77-94).
  • Burton, D. R. described ⁇ Mol. Immunol. 22 (1985) 161-206) that the heavy chain region comprising amino acid residues 318 to 337 is involved in complement fixation.
  • Duncan, A. R., and Winter, G. ( Nature 332 (1988) 738-740), using site directed mutagenesis, reported that Glu318, Lys320 and Lys322 form the binding site to Clq.
  • the role of Glu318, Lys320 and Lys 322 residues in the binding of Clq was confirmed by the ability of a short synthetic peptide containing these residues to inhibit complement mediated lysis.
  • FcR binding can be mediated by the interaction of the Fc moiety (of an antibody) with Fc receptors (FcRs), which are specialized cell surface receptors on cells including hematopoietic cells.
  • Fc receptors belong to the immunoglobulin superfamily, and shown to mediate both the removal of antibody-coated pathogens by phagocytosis of immune complexes, and the lysis of erythrocytes and various other cellular targets (e.g. tumor cells) coated with the corresponding antibody, via antibody dependent cell mediated cytotoxicity (ADCC; Van de Winkel, J. G., and Anderson, C. L., J. Leukoc. Biol. 49 (1991) 511-524).
  • ADCC antibody dependent cell mediated cytotoxicity
  • FcRs are defined by their specificity for immunoglobulin classes; Fc receptors for IgG antibodies are referred to as FcyR. for IgE as FceR, for IgA as FcaR and so on and neonatal Fc receptors are referred to as FcRn.
  • Fc receptor binding is described for example in Ravetch, J. V., and Kinet, J. P., Anna. Rev. Immunol. 9 (1991) 457-492; Capel, P. J., et al., Immunomethods 4 (1994) 25-34; de Haas, M., et al., J Lab. Clin. Med. 126 (1995) 330-341; and Gessner, J. E., et al., Ann. Hematol. 76 (1998) 231-248.
  • FcyR Fc domain of native IgG antibodies
  • FcyR In humans, three classes of FcyR have been characterized to-date, which are: (i) FcyRI (CD64), which binds monomeric IgG with high affinity and is expressed on macrophages, monocytes, neutrophils and eosinophils; (ii) FcyRII (CD32), which binds complexed IgG with medium to low affinity, is widely expressed, in particular on leukocytes, is believed to be a central player in antibody-mediated immunity, and which can be divided into FcyRIIA, FcyRIIB and FcyRIIC, which perform different functions in the immune system, but bind with similar low affinity to the IgG-Fc, and the ectodomains of these receptors are highly homologuous; and (iii) FcyRIII (CD 16), which binds IgG with medium to low affinity and has been found in two forms: FcyRIIIA. which has been found on NK cells, macrophages,
  • FcyRIIA is found on many cells involved in killing (e.g. macrophages, monocytes, neutrophils) and seems able to activate the killing process.
  • FcyRIIB seems to play a role in inhibitory processes and is found on B-cells, macrophages and on mast cells and eosinophils. Importantly, it has been shown that 75% of all FcyRIIB is found in the liver (Ganesan, L. P. et ah, 2012: FcyRIIb on liver sinusoidal endothelium clears small immune complexes,” Journal of Immunology 189: 4981-4988).
  • FcyRIIB is abundantly expressed on Liver Sinusoidal Endothelium, called LSEC, and in Kupffer cells in the liver and LSEC are the major site of small immune complexes clearance (Ganesan, L. P. et ah, 2012: FcyRIIb on liver sinusoidal endothelium clears small immune complexes. Journal of Immunology 189: 4981-4988).
  • the antibodies disclosed herein and the antigent binding fragments thereof comprise an Fc moiety for binding to FcyRIIb, in particular an Fc region, such as, for example IgG-type antibodies.
  • Fc region such as, for example IgG-type antibodies.
  • the antibodies of the present disclosure comprise an engineered Fc moiety with the mutations S267E and L328F, in particular as described by Chu, S. Y. et ah, 2008: Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD 19 and FcgammaRIIb with Fc-engineered antibodies.
  • FcyRIIB seems to function to suppress further immunoglobulin production and isotype switching to, for example, the IgE class.
  • FcyRIIB is thought to inhibit phagocytosis as mediated through FcyRIIA.
  • the b form may help to suppress activation of these cells through IgE binding to its separate receptor.
  • modification in native IgG of at least one of E233-G236, P238, D265, N297, A327 and P329 reduces binding to FcyRI.
  • IgG2 residues at positions 233-236, substituted into corresponding positions IgGl and IgG4, reduces binding of IgGl and IgG4 to FcyRI by 10 3 -fold and eliminated the human monocyte response to antibody-sensitized red blood cells (Armour, K. L., et al. Eur. J. Immunol. 29 (1999) 2613-2624).
  • FcyRIIA reduced binding for FcyRIIA is found, e.g., for IgG mutation of at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, R292 and K414.
  • FcyRIII binding reduced binding to FcyRIIIA is found, e.g., for mutation of at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, S239, E269, E293, Y296, V303, A327, K338 and D376. Mapping of the binding sites on human IgGl for Fc receptors, the above-mentioned mutation sites, and methods for measuring binding to FcyRI and FcyRIIA, are described in Shields, R. L., et al., J. Biol. Chem. 276 (2001) 6591-6604.
  • F158 Two allelic forms of human FcyRIIIA are the "F158" variant, which binds to IgGl Fc with low affinity, and the "V158” variant, which binds to IgGl Fc with high affinity. See. e.g., Bruhns et al, Blood 773:3716-3725 (2009).
  • two regions of native IgG Fc appear to be involved in interactions between FcyRIIs and IgGs, namely (i) the lower hinge site of IgG Fc, in particular amino acid residues L, L, G, G (234 - 237, EU numbering), and (ii) the adjacent region of the CH2 domain of IgG Fc, in particular a loop and strands in the upper CH2 domain adjacent to the lower hinge region, e.g. in a region of P331 (Wines, B.D., et al., J. Immunol. 2000; 164: 5313 - 5318).
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises an Fc moiety comprising mutations that increase binding affinity of the Fc moiety to a (i.e..
  • Fey receptor such as a human FcyRIIa, a human FcyRIIIa, or both (e.g., as compared to a reference Fc moiety or antibody containing the same that does not comprise the mutation(s)). See, e.g., Delillo and Ravetch, Cell 161(5): 1035-1045 (2015) and Ahmed et al., J. Struc. Biol. 194(1):78 (2016), the Fc mutations and techniques of which are incorporated herein by reference.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises a Fc moiety comprising a mutation selected from G236A; S239D; A330L; and I332E; or a combination comprising the same; e.g., S239D/I332E; S239D/A330L/I332E; G236A/S239D/I332E; G236 A/A330L/I332E (also referred to herein as "GAALIE"); or G236A/S239D/A330L/I332E.
  • the Fc moiety may comprise or consist of at least a portion of an Fc moiety that is involved in binding to FcRn (e.g., to a human FcRn).
  • the Fc moiety comprises one or more amino acid modifications that improve binding affinity for FcRn and, in some embodiments, thereby extend in vivo half-life of a molecule comprising the Fc moiety (e.g., as compared to a reference Fc moiety or antibody that does not comprise the modification(s)).
  • the Fc moiety comprises or is derived from a IgG Fc and a half-life-extending mutation comprises any one or more of: M428L; N434S; N434H; N434A; N434S; M252Y; S254T; T256E; T250Q; P257I Q311I; D376V; T307A; E380A (EU numbering).
  • a half-life-extending mutation comprises M428L/N434S (also referred to herein as "MLNS").
  • a half-life -extending mutation comprises M252Y/S254T/T256E.
  • a half-life-extending mutation comprises T250Q/M428L. In certain embodiments, a half-life-extending mutation comprises P257I/Q311I. In certain embodiments, a half-life -extending mutation comprises P257I/N434H. In certain embodiments, a half-life-extending mutation comprises D376V/N434H. In certain embodiments, a half-life -extending mutation comprises T307A/E380A/N434A.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure includes a Fc moiety that comprises the substitution mtuations M428L/N434S.
  • a binding protein includes a Fc moiety that comprises the substitution mtuations G236A/A330L/I332E.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure includes a Fc moiety that comprises a G236A mutation, an A330L mutation, and a I332E mutation (GAALIE), and does not comprise a S239D mutation.
  • the Fc moiety comprises a Ser at position 239.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure includes an Fc moiety that comprises the substitution mutations: M428L/N434S and G236A/A330L/I332E.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure includes a Fc moiety that comprises the substitution mutations: M428F/N434S and G236A/S239D/A330F/I332E.
  • the Fc moiety does not comprise any substitution mutations except for M428F/N434S and G236A/S239D/A330F/I332E.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises: CDRs and/or a variable domain and/or a heavy chain and/or a light chain according to any one of the exemplary anti-HBV antibodies disclosed herein and/or in PCT Publication No.
  • WO 2017/060504 (including antibodies HBC34, HBC34v7, HBC34v23, HBC34v31, HBC34v32, HBC34v33, HBC34v34, HBC34v35, (including herein disclosed variants of HBC antibodies which comprise a substitution mutation at position 40 in the light chain (e.g., a substitution of a native cysteine with an alanine, a serine, or the like)); and a Fc moiety comprising a G236A mutation, an A330F mutation, and a I332E (GAAFIE) mutation, wherein the Fc moiety optionally further comprises a M428F/N434S (MENS) mutation.
  • the Fc moiety does not comprise S239D.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises: a CDRH1 amino acid sequence according to SEQ ID NO:34, a CDRH2 amino acid sequence according to SEQ ID NO:35 or 66, a CDRH3 amino acid sequence according to SEQ ID NO:36, a CDRL1 acid sequence according to SEQ ID NO:37, a CDRL2 acid sequence according to SEQ ID NO:38 or 39, and CDRL3 amino acid sequence according to SEQ ID NO:58 or 40; and a Fc moiety comprising a GAALIE mutation.
  • the Fc moiety further comprises a MLNS mutation.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises: a heavy chain variable domain (VH) amino acid sequence according to any one of SEQ ID NOs:41 or 67 and a light chain variable domain (VL) amino acid sequence according to any one of SEQ ID NOs:42, 59, 65, 89, 90, and 111-120; and a Fc moiety comprising a GAALIE mutation.
  • the Fc moiety further comprises a MLNS mutation.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises a heavy chain amino acid sequence according to SEQ ID NO: 138 or 91.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises: a CDRH1 amino acid sequence according to SEQ ID NO:97, a CDRH2 amino acid sequence according to SEQ ID NO:98, a CDRH3 amino acid sequence according to SEQ ID NO:99, a CDRL1 acid sequence according to SEQ ID NO: 100, a CDRL2 acid sequence according to SEQ ID NO: 100, and CDRL3 amino acid sequence according to SEQ ID NO: 102; and a Fc moiety comprising a GAALIE mutation.
  • the Fc moiety further comprises a MLNS mutation.
  • a binding protein of the present disclosure includes a Fc moiety comprising a GAALIE mutation and has enhanced binding to a human FcyRIIa and/or a human FcyRIIIa, as compared to a reference polypeptide (/. e. , a polypeptide, which may be a binding protein, that includes a Fc moiety that does not comprise the GAALIE mutation).
  • the reference polypeptide includes a Fc moiety that is a wild-type Fc moiety or is a Fc moiety that comprises one or more substitution mutation (or insertion or deletion), provided that the substitution mutation is not GAALIE.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure comprises HBC34v35 antibody with a GAALIE and MLNS mutations, and a reference polypeptide is HBC34v35 (including a wild- type Fc moiety of a same isotype as the Fc moiety of the antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure).
  • the reference polypeptide does not comprise a substitution mutation that is known or believed to affect binding to a human FcyRIIa and/or a human FcyRIIIa.
  • Binding between polypeptides such as binding between a Fc moiety (or a binding protein comprising the same) and a human Fey Receptor, such as human FcyRIIA, human FcyRIIIA, or human Fc FcyRIIB, or a complement protein, such as Clq, can be determined or detected using methods known in the art.
  • a biolayer interferometry (BLI) assay can be performed using an Octet® RED96 (ForteBio, Fremont, California USA) instrument according to manufacturer’s instructions to determine real-time association and dissociation between a first polypeptide of interest (e.g., HBC34v35 comprising a GAALIE mutation) and a second polypeptide of interest (e.g, a FcyRIIA (H131), a FcyRIIA (R131), a FcyRIIIA (F158), a FcyRIIIA (VI 58), or a FcyRIIb) that is captured on a sensor substrate.
  • a first polypeptide of interest e.g., HBC34v35 comprising a GAALIE mutation
  • a second polypeptide of interest e.g, a FcyRIIA (H131), a FcyRIIA (R131), a FcyRIIIA (F158), a FcyRIIIA
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure includes a Fc moiety comprising a GAALIE mutation and has enhanced binding to a human FcyRIIA (H131), a human FcyRIIA (R131), a human FcyRIIIA (F158), a human FcyRIIIA (V158), or any combination thereof, as compared to a reference polypeptide that includes a Fc moiety that does not comprise the GAALIE mutation.
  • enhanced binding is determined by an increase (e.g., one or more of: a higher peak signal; a greater rate of association; a slower rate of dissociation; or a greater area under the curve) in signal shift versus the reference binding protein in a BLI assay.
  • the BLI assay comprises use of Octet (R) RED96 (ForteBio, Fremont, California USA) instrument.
  • the BLI assay comprises a tagged human FcyR captured onto an anti-penta-tag sensor and exposed to the binding protein.
  • the binding protein comprises a IgG Fab and the BLI assay further comprises exposing the captured human FcyR to the antibody or antigen binding fragment in the presence of an anti-IgG Fab binding fragment to cross-link the binding proteins through the Fab fragment.
  • an an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure includes a Fc moiety comprising a GAALIE mutation and has enhanced binding to a human FcyRIIA (H131), a human FcyRIIA (R131), a human FcyRIIIA (FI 58), and/or a human FcyRIIIA (VI 58) as compared to a reference polypeptide, wherein the enhanced binding comprises to a signal shift (nanometers) in a BLI assay of 1.5, 2, 2.5, 3, or more times greater than the signal shift observed using the reference antibody.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure includes a Fc moiety comprising a GAALIE mutation and has enhanced binding to a human FcyRIIA (H131), a human FcyRIIA (R131), a human FcyRIIIA (F158), and a human FcyRIIIA (V158), as compared to a reference polypeptide.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure includes a Fc moiety comprising a GAALIE mutation and has reduced binding to a human FcyRIIB, as compared to a reference polypeptide.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure includes a Fc moiety comprising a GAALIE mutation and does not bind to a human FcyRIIB, as determined, for example, by the absence of a statistically significant signal shift versus baseline in a BLI assay.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure includes a Fc moiety comprising a GAALIE mutation and has reduced binding to a human Clq (complement protein), as compared to a reference polypeptide.
  • a binding protein includes a Fc moiety comprising a GAALIE mutation and does not bind to a human Clq, as determined by the absence of a statistically significant signal shift versus baseline in a BLI assay.
  • an antibody or antigen binding fragment thereof suitable for use in the pharmaceutical compositions and methods of the present disclosure includes a Fc moiety comprising a GAALIE mutation and activates a human FcyRIIA, a human FcyRIIIA, or both, to a greater degree than does a reference polypeptide (i.e.. a polypeptide, which may be an antibody or antigen binding fragment thereof, that includes a Fc moiety that does not comprise the GAALIE mutation).
  • the reference polypeptide includes a Fc moiety that is a wild-type Fc moiety or that comprises one or more substitution mutation, provided that the substitution mutation is not GAALIE.
  • an antibody or antigen binding fragment thereof comprises HBC34v35 antibody with a GAALIE mutation (and optionally other substitution mutations, such as, for example, MLNS), and a reference polypeptide is HBC34v35 with a wild-type Fc moiety.
  • Activation of a human FcyR can be determined or detected using methods known in the art. For example, a well-validated, commercially available bioreporter assay involves incubating a HBsAg-specific binding protein with a recombinant HBsAg (Engerix B, GlaxoSmithKline) in the presence of Jurkat effector cells (Promega; Cat.
  • an antibody or antigen binding fragment thereof includes a Fc moiety comprising a GAALIE mutation activates a human FcyRIIA (H131), a human FcyRIIIA (F158), and/or a human FcyRIIIA (VI 58) to a greater degree than does a reference polypeptide.
  • a greater degree of activation refers to a higher peak luminescence and/or a greater luminescence area under the curve, as determined using a luminescence bioreporter assay as described herein.
  • an antibody or antigen binding fragment thereof includes a Fc moiety comprising a GAALIE mutation and activates a human FcyRIIA (H131), a human FcyRIIA (R131), and a human FcyRIIIA (F158) to a greater degree than does a reference polypeptide, wherein the greater degree of activation can be represented by a peak RLU that is 1.5, 2, 2.5, 3, or more times greater than the peak RLU observed using the reference polypeptide.
  • an antibody or antigen binding fragment thereof includes a Fc moiety comprising a GAALIE mutation does not activate a human FcyRIIB, as determined by the absence of a statistically significant and/or measurable RLU in a luminescence bioreporter assay as described above.
  • an antibody or antigen binding fragment thereof includes a Fc moiety comprising a GAALIE mutation and activates a human natural killer (NK) cell in the presence of HBsAg to a greater degree than does a reference polypeptide.
  • activation of a NK cell is determined by CD 107a expression (e.g., by flow cytometry).
  • the NK cell comprises a cell that comprises V158 V158 homozygous, a F158/F158 homozygous, or a V158/F158 heterozygous FcyRIIIa genotype.
  • any an antibody or antigen binding fragment thereof including a Fc moiety comprising a GAALIE mutation can perform or possess any one or more of the features described herein; e.g., enhanced binding to a human FcyRIIA and/or a human FcyRIIIA as compared to a reference polypeptide; reduced binding to a human FcyRIIB as compared to a reference polypeptide (and/or no binding to a human FcyRIIB); reduced binding to a human Clq as compared to a reference polypeptide (and/or no binding to a human Clq); activates a FcyRIIA. a human FcyRIIIA.
  • a reference polypeptide does not activate a human FcyRIIB; and/or activates a human natural killer (NK) cell in the presence of HBsAg to a greater degree than does a reference polypeptide (e.g., an antibody that is specific for HBsAg and includes a Fc moiety that does not comprise a GAALIE mutation).
  • a reference polypeptide e.g., an antibody that is specific for HBsAg and includes a Fc moiety that does not comprise a GAALIE mutation.
  • the Fc moiety of an antibody or antigen binding fragment thereof of the disclosure can comprise at least a portion known in the art to be required for Protein A binding; and/or the Fc moiety of an antibody of the disclosure comprises at least the portion of an Fc molecule known in the art to be required for protein G binding.
  • a retained function comprises the clearance of HBsAg and HBVg.
  • an Fc moiety comprises at least a portion known in the art to be required for FcyR binding.
  • an Fc moiety may thus at least comprise (i) the lower hinge site of native IgG Fc, in particular amino acid residues L, L, G, G (234 - 237, EU numbering), and (ii) the adjacent region of the CH2 domain of native IgG Fc, in particular a loop and strands in the upper CH2 domain adjacent to the lower hinge region, e.g. in a region of P331, for example a region of at least 3, 4, 5, 6, 7, 8, 9, or 10 consecutive amino acids in the upper CH2 domain of native IgG Fc around P331, e.g. between amino acids 320 and 340 (EU numbering) of native IgG Fc.
  • an antibody or antigen binding fragment thereof comprises an Fc region.
  • Fc region refers to the portion of an immunoglobulin formed by two or more Fc moieties of antibody heavy chains.
  • an Fc region may be monomeric or "single-chain" Fc region (i.e., a scFc region).
  • Single chain Fc regions are comprised of Fc moieties linked within a single polypeptide chain (e.g., encoded in a single contiguous nucleic acid sequence).
  • Exemplary scFc regions are disclosed in WO 2008/143954 A2, and are incorporated by reference herein.
  • the Fc region can be or comprise a dimeric Fc region.
  • a “dimeric Fc region” or “dcFc” refers to the dimer formed by the Fc moieties of two separate immunoglobulin heavy chains.
  • the dimeric Fc region may be a homodimer of two identical Fc moieties (e.g., an Fc region of a naturally occurring immunoglobulin) or a heterodimer of two non-identical Fc moieties (e.g., one Fc monomer of the dimeric Fc region comprises at least one amino acid modification (e.g., substitution, deletion, insertion, or chemical modification) that is not present in the other Fc monomer, or one Fc monomer may be truncated as compared to the other).
  • an antibody or antigen binding fragment comprises a heavy chain according to SEQ ID NO:91 and a light chain according to SEQ ID NO:93.
  • an antibody or antigen binding fragment comprises a heavy chain according to SEQ ID NO:92 and a light chain according to SEQ ID NO:94.
  • an antibody or antigen binding fragment comprises a heavy chain according to SEQ ID NO:91 and a light chain according to SEQ ID NO:94. In other embodiments, an antibody or antigen binding fragment comprises a heavy chain according to SEQ ID NO:92 and a light chain according to SEQ ID NO:93. In some embodiments, an antibody or antigen binding fragment comprises or consists of a heavy chain according to SEQ ID NO: 129. In some embodiments, an antibody or antigen binding fragment comprises or consists of a heavy chain according to SEQ ID NO: 138.
  • Fc moieties may comprise Fc sequences or regions of the same or different class and/or subclass.
  • Fc moieties may be derived from an immunoglobulin (e.g., a human immunoglobulin) of an IgGl, IgG2, IgG3 or IgG4 subclass, or from any combination thereof.
  • the Fc moieties of Fc region are of the same class and subclass.
  • the Fc region (or one or more Fc moieties of an Fc region) may also be chimeric, whereby a chimeric Fc region may comprise Fc moieties derived from different immunoglobulin classes and/or subclasses.
  • At least two of the Fc moieties of a dimeric or single-chain Fc region may be from different immunoglobulin classes and/or subclasses.
  • a dimeric Fc region can comprise sequences from two or more different isotypes or subclasses; e.g., a SEEDbody ("strand-exchange engineered domains"), see Davis ei al., Protein Eng. Des. Sel. 23(4): 195 (2010)
  • chimeric Fc regions may comprise one or more chimeric Fc moieties.
  • the chimeric Fc region or moiety may comprise one or more portions derived from an immunoglobulin of a first subclass (e.g., an IgGl, IgG2, or IgG3 subclass) while the remainder of the Fc region or moiety is of a different subclass.
  • an Fc region or moiety of an Fc polypeptide may comprise a CH2 and/or CH3 domain derived from an immunoglobulin of a first subclass (e.g., an IgGl, IgG2 or IgG4 subclass) and a hinge region from an immunoglobulin of a second subclass (e.g., an IgG3 subclass).
  • the Fc region or moiety may comprise a hinge and/or CH2 domain derived from an immunoglobulin of a first subclass (e.g., an IgG4 subclass) and a CH3 domain from an immunoglobulin of a second subclass (e.g., an IgGl, IgG2, or IgG3 subclass).
  • the chimeric Fc region may comprise an Fc moiety (e.g., a complete Fc moiety) from an immunoglobulin for a first subclass (e.g., an IgG4 subclass) and an Fc moiety from an immunoglobulin of a second subclass (e.g., an IgGl, IgG2 or IgG3 subclass).
  • the Fc region or moiety may comprise a CH2 domain from an IgG4 immunoglobulin and a CH3 domain from an IgGl immunoglobulin.
  • the Fc region or moiety may comprise a CHI domain and a CH2 domain from an IgG4 molecule and a CH3 domain from an IgGl molecule.
  • the Fc region or moiety may comprise a portion of a CH2 domain from a particular subclass of antibody, e.g., EU positions 292-340 of a CH2 domain.
  • an Fc region or moiety may comprise amino acids a positions 292-340 of CH2 derived from an IgG4 moiety and the remainder of CH2 derived from an IgGl moiety (alternatively, 292-340 of CH2 may be derived from an IgGl moiety and the remainder of CH2 derived from an IgG4 moiety).
  • any antibody, antigen-binding fragment, or Fc region or moiety of the present disclosure can be of any allotype and/or haplotype.
  • human Immunoglobulin G allotypes include those disclosed in Jefferis and LeFranc, mAbs 7(4): 1-7 (2009), which allotypes (including Glm (1(a); 2(x); 3(f); and 17(z)); G2m (23(n)); G3m (21(gl); 28(g5); ll(b0); 5(b2); 13(b3); 14(b4); 10(b5); 15(s); 16(t); 6(c3); 24(c5); 26(u); and 27(v)); A2m (1 and 2); and Km (1; 2; and 3) and haplotypes, and resultant amino acid sequences, and combinations thereof, are incorporated herein by reference.
  • an antibody, antigen-binding fragment, or Fc region or moiety of the present disclosure comprises
  • an Fc region or moiety may (additionally or alternatively) for example comprise a chimeric hinge region.
  • the chimeric hinge may be derived, e.g. in part, from an IgGl, IgG2, or IgG4 molecule (e.g., an upper and lower middle hinge sequence) and, in part, from an IgG3 molecule (e.g., an middle hinge sequence).
  • an Fc region or moiety may comprise a chimeric hinge derived, in part, from an IgGl molecule and, in part, from an IgG4 molecule.
  • the chimeric hinge may comprise upper and lower hinge domains from an IgG4 molecule and a middle hinge domain from an IgGl molecule.
  • Such a chimeric hinge may be made, for example, by introducing a proline substitution
  • the chimeric hinge can comprise amino acids at EU positions 233-236 are from an IgG2 antibody and/or the Ser228Pro mutation, wherein the remaining amino acids of the hinge are from an IgG4 antibody (e.g., a chimeric hinge of the sequence ESKYGPPCPPCPAPPVAGP).
  • a chimeric hinge of the sequence ESKYGPPCPPCPAPPVAGP e.g., a chimeric hinge of the sequence ESKYGPPCPPCPAPPVAGP.
  • the Fc moiety, or the Fc region comprises or consists of an amino acid sequence derived from a human immunoglobulin sequence (e.g., from an Fc region or Fc moiety from a human IgG molecule).
  • polypeptides may comprise one or more amino acids from another mammalian species.
  • a primate Fc moiety or a primate binding site may be included in the subject polypeptides.
  • one or more murine amino acids may be present in the Fc moiety or in the Fc region.
  • the disclosure provides a nucleic acid molecule comprising a polynucleotide encoding an antibody or antigen binding fragment thereof according to the present disclosure
  • Table 4 shows exemplary VH-, VL-, CH-, CL-, HC-, and LC-encoding nucleotide sequences according to the present disclosure:
  • the present disclosure also comprises sequence variants of these nucleic acid sequences and in particular such sequence variants, which encode the same amino acid sequences.
  • a polynucleotide or nucleic acid molecule comprises a nucleotide sequence sharing at least 80% identity to the nucleotide sequence according to any one of SEQ ID NOs: 103-110 and 130-136, wherein the nucleotide sequence is codon optimized for expression by a host cell.
  • a nucleic acid molecule according to the present disclosure comprises or consists of a nucleic acid sequence according to any one of SEQ ID NOs: 103-110 and 130-136.
  • a polynucleotide comprises a V H -encoding nucleotide sequence according to SEQ ID NO: 103 and a V L -encoding nucleotide sequence according to SEQ ID NO: 105.
  • a polynucleotide comprises a V H -encoding nucleotide sequence according to SEQ ID NO: 103, and a V L -encoding nucleotide sequence according to SEQ ID NO: 104.
  • a polynucleotide comprises a V H -encoding nucleotide sequence according to SEQ ID NO: 108, and a V L -encoding nucleotide sequence according to SEQ ID NO: 109.
  • polynucleotides that encode an antibody or antigen binding fragment
  • the polynucleotide comprises or consists of a V H -encoding nucleotide sequence according to SEQ ID NO: 103 and a V L -encoding nucleotide sequence according to SEQ ID NO: 110, wherein the encoded antibody or antigen binding fragment binds to the antigenic loop region of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
  • a polynucleotide can comprise a CHl-hinge- CH2-CH3 -encoding nucleotide sequence according to SEQ ID NO: 130, and/or comprises a HC (VH-CHl-hinge-CH3-CH3)-encoding nucleotide sequence according to SEQ ID NO: 131.
  • a polynucleotide comprises a CL-encoding nucleotide sequence according to SEQ ID NO: 132 and/or comprises a LC (VL-CL) -encoding nucleotide sequence according to SEQ ID NO: 133.
  • a polynucleotide comprises a CL-encoding nucleotide sequence according to SEQ ID NO: 134 and/or comprises a LC (VL-CL)-encoding nucleotide sequence according to SEQ ID NO: 135 or SEQ ID NO: 136.
  • vectors for example, expression vectors, that comprise a nucleic acid molecule according to the present disclosure.
  • vector refers to a construct comprising a nucleic acid molecule.
  • a vector in the context of the present disclosure is suitable for incorporating or harboring a desired nucleic acid sequence.
  • Such vectors may be storage vectors, expression vectors, cloning vectors, transfer vectors etc.
  • a storage vector is a vector which allows the convenient storage of a nucleic acid molecule.
  • the vector may comprise a sequence corresponding, e.g., to a desired antibody or antibody fragment thereof according to the present description.
  • expression vector refers to a DNA construct containing a nucleic acid molecule that is operably linked to a suitable control sequence capable of effecting the expression of the nucleic acid molecule in a suitable host.
  • control sequences include a promoter (e.g., a heterologous promoter) to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites, and sequences which control termination of transcription and translation.
  • Any of the elements of an expression vector that contribute to transcription of a nucleic acid molecule of interest may be heterologous to the vector.
  • the vector may be a plasmid, a phage particle, a virus, or simply a potential genomic insert.
  • the vector may replicate and function independently of the host genome, or may, in some instances, integrate into the genome itself.
  • plasmid "expression plasmid,” “virus” and “vector” are often used interchangeably.
  • a cloning vector is typically a vector that contains a cloning site, which may be used to incorporate nucleic acid sequences into the vector.
  • a cloning vector may be, e.g., a plasmid vector or a bacteriophage vector.
  • a transfer vector may be a vector which is suitable for transferring nucleic acid molecules into cells or organisms, for example, viral vectors.
  • a vector in the context of the present disclosure may be, e.g., an RNA vector or a DNA vector.
  • a vector may be a DNA molecule.
  • a vector in the sense of the present application comprises a cloning site, a selection marker, such as an antibiotic resistance factor, and a sequence suitable for multiplication of the vector, such as an origin of replication.
  • a vector in the context of the present application is a plasmid vector.
  • a vector comprises a lentiviral vector or a retroviral vector.
  • the present disclosure also provides a cell (also referred to as a "host cell”) expressing an antibody, antigen binding fragment, or fusion protein according to the present disclosure; or comprising a vector or polynucleotide according the present disclosure.
  • the cells include but are not limited to, eukaryotic cells, e.g., yeast cells, animal cells, insect cells, plant cells; and prokaryotic cells, including E. coli.
  • the cells are mammalian cells.
  • the cells are a mammalian cell line such as CHO cells (e.g., DHFR- CHO cells (Urlaub et al, PNAS 77:4216 (1980)), human embryonic kidney cells (e.g., HEK293T cells), PER.C6 cells, Y0 cells, Sp2/0 cells.
  • NS0 cells human liver cells, e.g. Hepa RG cells, myeloma cells or hybridoma cells.
  • mammalian host cell lines include mouse sertoli cells (e.g., TM4 cells); monkey kidney CV1 line transformed by SV40 (COS-7); baby hamster kidney cells (BHK); African green monkey kidney cells (VERO-76); monkey kidney cells (CV1); human cervical carcinoma cells (HELA); human lung cells (W138); human liver cells (Hep G2); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); mouse mammary tumor (MMT 060562); TRI cells; MRC 5 cells; and FS4 cells.
  • Mammalian host cell lines suitable for antibody production also include those described in, for example, Yazaki and Wu. Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J.), pp. 255-268 (2003).
  • a host cell is a prokaryotic cell, such as an E. coli.
  • a prokaryotic cell such as an E. coli.
  • the expression of peptides in prokaryotic cells such as E. coli is well established (see, e.g., Pluckthun, A. Bio/Technology 9:545-551 (1991).
  • antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
  • For expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Pat. Nos. 5,648,237; 5,789,199; and 5,840,523.
  • Insect cells useful expressing an antibody or antigen binding fragment thereof of the present disclosure are known in the art and include, for example, Spodoptera frugipera Sf9 cells, Trichoplusia ni BTI-TN5B1-4 cells, and Spodoptera frugipera SfSWTOl “MimicTM” cells. See, e.g., Palmberger et al., J. Biotechnol. 753(3-4): 160-166 (2011). Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
  • Eukaryotic microbes such as filamentous fungi or yeast are also suitable hosts for cloning or expressing protein-encoding vectors, and include fungi and yeast strains with “humanized” glycosylation pathways, resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gemgross, Nat. Biotech. 22: 1409-1414 (2004); Li et al., Nat. Biotech. 24:210-215 (2006).
  • Plant cells can also be utilized as hosts for expressing an antibody or antigen binding fragment thereof of the present disclosure.
  • PLANTIBODIESTM technology (described in, for example, U.S. Pat. Nos. 5,959,177; 6,040,498; 6,420,548; 7,125,978; and 6,417,429) employs transgenic plants to produce antibodies.
  • any protein expression system compatible with the disclosure may be used to produce a disclosed an antibody or antigen binding fragment thereof.
  • Suitable expression systems include transgenic animals described in Gene Expression Systems, Academic Press, eds. Fernandez et al., 1999.
  • the cell may be transfected with a vector according to the present description with an expression vector.
  • the term "transfection” refers to the introduction of nucleic acid molecules, such as DNA or R A (e.g. mR A) molecules, into cells, such as into eukaryotic cells.
  • R A e.g. mR A
  • the term “transfection” encompasses any method known to the skilled person for introducing nucleic acid molecules into cells, such as into eukaryotic cells, including into mammalian cells.
  • Such methods encompass, for example, electroporation, lipofection, e.g., based on cationic lipids and/or liposomes, calcium phosphate precipitation, nanoparticle based transfection, virus based transfection, or transfection based on cationic polymers, such as DEAE-dextran or polyethylenimine etc.
  • the introduction is non-viral.
  • cells of the present disclosure may be transfected stably or transiently with the vector according to the present description, e.g. for expressing an antibody, or an antigen binding fragment thereof, according to the present description.
  • the cells are stably transfected with the vector as described herein encoding a binding protein.
  • cells may be transiently transfected with a vector according to the present disclosure encoding a binding protein according to the present description.
  • a polynucleotide may be heterologous to the host cell.
  • the present disclosure provides methods for producing an antibody or antigen binding fragment thereof, wherein the methods comprise culturing a host cell of the present disclosure under conditions and for a time sufficient to produce the antibody or antigen binding fragment thereof.
  • the present disclosure also provides recombinant host cells that heterologously express an antibody or antigen binding fragment thereof of the present disclosure.
  • the cell may be of a species that is different to the species from which the antibody was fully or partially obtained (e.g., CHO cells expressing a human antibody or an engineered human antibody).
  • the cell type of the host cell does not express the antibody or antigen binding fragment in nature.
  • the host cell may impart a post-translational modification (PTM; e.g., glysocylation or fucosylation) on the antibody or antigen binding fragment that is not present in a native state of the antibody or antigen binding fragment (or in a native state of a parent antibody from which the antibody or antigen binding fragment was engineered or derived).
  • PTM post-translational modification
  • Such a PTM may result in a functional difference (e.g., reduced immunogenicity).
  • an antibody or antigen binding fragment of the present disclosure that is produced by a host cell as disclosed herein may include one or more post- translational modification that is distinct from the antibody (or parent antibody) in its native state (e.g., a human antibody produced by a CHO cell can comprise a more post-translational modification that is distinct from the antibody when isolated from the human and/or produced by the native human B cell or plasma cell,
  • Antibodies and antigen binding fragments of the disclosure may be coupled, for example, to a drug for delivery to a treatment site or coupled to a detectable label to facilitate imaging of a site comprising cells of interest.
  • Methods for coupling antibodies to drugs and detectable labels are well known in the art, as are methods for imaging using detectable labels.
  • Labeled antibodies may be employed in a wide variety of assays, employing a wide variety of labels. Detection of the formation of an antibody-antigen complex between an antibody (or antigen binding fragment or fusion protein) of the disclosure and an epitope of interest on HBsAg, in particular on the antigenic loop region of HBsAg, can be facilitated by attaching a detectable substance to the antibody.
  • Suitable detection means include the use of labels such as radionuclides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
  • labels such as radionuclides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, b-galactosidase, or acetylcholinesterase;
  • suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material is luminol;
  • examples of bioluminescent materials include luciferase, luciferin, and aequorin; and
  • suitable radioactive material include 1251, 1311, 35S, or 3H.
  • labeled reagents may be used in a variety of well-known assays, such as radioimmunoassays, enzyme immunoassays, e.g., ELISA, fluorescent immunoassays, and the like. Labeled antibodies and antigen binding fragments according to the present disclosure may be thus be used in such assays for example as described in US 3,766,162; US 3,791,932; US 3,817,837; and US 4,233,402.
  • an antibody or antigen binding fragment thereof may be conjugated to a therapeutic moiety such as a cytotoxin, a therapeutic agent, or a radioactive metal ion or radioisotope.
  • a therapeutic moiety such as a cytotoxin, a therapeutic agent, or a radioactive metal ion or radioisotope.
  • radioisotopes include, but are not limited to, 1-131, I- 123, 1-125, Y-90, Re-188, Re-186, At-211, Cu-67, Bi-212, Bi-213, Pd- 109, Tc-99, In-111, and the like.
  • Such antibody conjugates can be used for modifying a given biological response; the drug moiety is not to be construed as limited to classical chemical therapeutic agents.
  • the drug moiety may be a protein or polypeptide possessing a desired biological activity.
  • proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exot
  • an antibody or antigen binding fragment thereof can be conjugated to a second antibody, or antibody fragment thereof, (or second fusion protein) to form a heteroconjugate as described in US 4,676,980.
  • linkers may be used between the labels and the antibodies of the description, e.g., as described in US 4,831,175.
  • Antibodies, antigen-binding fragments, and fusion proteins may be directly labeled with radioactive iodine, indium, yttrium, or other radioactive particle known in the art, e.g., as described in US 5,595,721.
  • Treatment may consist of a combination of treatment with conjugated and non-conjugated antibodies and/or antigen binding fragments, administered simultaneously or subsequently e.g., as described in WO00/52031 ; WOOO/52473.
  • Antibodies and antigen binding fragments as described herein may also be attached to a solid support. Additionally, the antibodies of the present disclosure, or functional antibody fragments thereof, can be chemically modified by covalent conjugation to a polymer to, for example, increase their circulating half-life. Examples of polymers, and methods to attach them to peptides, are shown in US 4,766,106; US 4,179,337; US 4,495,285 and US 4,609,546. In some embodiments, the polymers may be selected from polyoxyethylated polyols and polyethylene glycol (PEG).
  • PEG polyethylene glycol
  • PEG is soluble in water at room temperature and has the general formula: R(0- CH 2 -CH 2 ) n O-R, wherein R can be hydrogen, or a protective group such as an alkyl or alkanol group.
  • the protective group may have between 1 and 8 carbons.
  • the protective group may be methyl.
  • the symbol n is a positive integer. In one embodiment, n is between 1 and 1,000. In another embodiment n is between 2 and 500.
  • the PEG has an average molecular weight selected from between 1,000 and 40,000, between 2,000 and 20,000, and between 3,000 and 12,000.
  • PEG may have at least one hydroxy group, for example the PEG may have a terminal hydroxy group. For example, it is the terminal hydroxy group which is activated to react with a free amino group on the inhibitor.
  • the type and amount of the reactive groups may be varied to achieve a covalently conjugated PEG/antibody of the present description.
  • Water-soluble polyoxyethylated polyols may also be utlized in the context of the antibodies and antigen binding fragements described herein. They include polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG), and the like. In one embodiment, POG is used. Without being bound by any theory, because the glycerol backbone of polyoxyethylated glycerol is the same backbone occurring naturally in, for example, animals and humans in mono-, di-, triglycerides, this branching would not necessarily be seen as a foreign agent in the body. POG may have a molecular weight in the same range as PEG.
  • liposome Another drug delivery system that can be used for increasing circulatory half-life is the liposome.
  • Methods of preparing liposome delivery systems are known to one of skill in the art.
  • Other drug delivery systems are known in the art and are described in, for example, referenced in Poznansky et al. (1980) and Poznansky (1984).
  • the antibody or antigen binding fragment will be present in a composition that is substantially free of other polypeptides e.g., where less than 90% (by weight), usually less than 60% and more usually less than 50% of the composition is made up of other polypeptides.
  • Antibodies, or antigen binding fragments of the disclosure may be immunogenic in non-human (or heterologous) hosts e.g., in mice.
  • the antibodies, antigen binding fragments, or fusion proteins may have an idiotope that is immunogenic in non-human hosts, but not in a human host.
  • such molecules of the disclosure for human use include those that cannot be easily isolated from hosts such as mice, goats, rabbits, rats, non-primate mammals, etc. and cannot generally be obtained by humanization or from xeno-mice. Production of antibodies, antigen binding fragments, and fusion proteins
  • Antibodies and antigen binding fragments according to the disclosure can be made by any method known in the art.
  • the general methodology for making monoclonal antibodies using hybridoma technology is well known (Kohler, G. and Milstein, C., 1975; Kozbar et al. 1983).
  • the alternative EBV immortalization method described in W02004/076677 is used.
  • antibodies are produced using a method described in WO 2004/076677.
  • B cells producing the antibody are transformed with EBV and a polyclonal B cell activator. Additional stimulants of cellular growth and differentiation may optionally be added during the transformation step to further enhance the efficiency. These stimulants may be cytokines such as IL-2 and IL-15. In one aspect, IL-2 is added during the immortalization step to further improve the efficiency of immortalization, but its use is not essential.
  • the immortalized B cells produced using these methods can then be cultured using methods known in the art and antibodies isolated therefrom.
  • WO 2010/046775 Another method for producing antibodies is described in WO 2010/046775.
  • plasma cells are cultured in limited numbers, or as single plasma cells in microwell culture plates.
  • Antibodies can be isolated from the plasma cell cultures. Further, from the plasma cell cultures, RNA can be extracted and PCR can be performed using methods known in the art.
  • the VH and VL regions of the antibodies can be amplified by RT-PCR (reverse transcriptase PCR), sequenced and cloned into an expression vector that is then transfected into HEK293T cells or other host cells.
  • RT-PCR reverse transcriptase PCR
  • the cloning of nucleic acid in expression vectors, the transfection of host cells, the culture of the transfected host cells and the isolation of the produced antibody can be done using any methods known to one of skill in the art.
  • the antibodies may be further purified, if desired, using filtration, centrifugation and various chromatographic methods such as HPLC or affinity chromatography. Techniques for purification of antibodies, e.g., monoclonal antibodies, including techniques for producing pharmaceutical-grade antibodies, are well known in the art.
  • Standard techniques of molecular biology may be used to prepare DNA sequences encoding the antibodies, antibody fragments, or fusion proteins of the present description. Desired DNA sequences may be synthesized completely or in part using oligonucleotide synthesis techniques. Site-directed mutagenesis and polymerase chain reaction (PCR) techniques may be used as appropriate.
  • PCR polymerase chain reaction
  • Any suitable host cell/vector system may be used for expression of the DNA sequences encoding the antibody or fusion protein molecules of the present disclosure or fragments thereof.
  • Bacterial, for example E. coli, and other microbial systems may be used, in part, for expression of antibody fragments such as Fab and F(ab’)2 fragments, and especially Fv fragments and single chain antibody fragments, for example, single chain Fvs.
  • Eukaryotic, e.g., mammalian, host cell expression systems may be used for production of larger antibody molecules, including complete antibody molecules.
  • Suitable mammalian host cells include, but are not limited to, CHO, HEK293T, PER.C6, NS0, myeloma or hybridoma cells.
  • the present disclosure also provides a process for the production of an antibody or antigen binding fragment according to the present disclosure comprising culturing a host cell comprising a vector encoding a nucleic acid of the present disclosure under conditions suitable for expression of protein from DNA encoding the antibody molecule of the present description, and isolating the antibody molecule.
  • An antibody molecule or antibody fragment may comprise only a heavy or light chain polypeptide, in which case only a heavy chain or light chain polypeptide coding sequence needs to be used to transfect the host cells.
  • the cell line may be transfected with two vectors, a first vector encoding a light chain polypeptide and a second vector encoding a heavy chain polypeptide.
  • a single vector may be used, the vector including sequences encoding a light chain polypeptide and and a heavy chain polypeptide.
  • antibodies and antigen binding fragments according to the disclosure may be produced by (i) expressing a nucleic acid sequence according to the disclosure in a host cell, e.g. by use of a vector according to the present description, and (ii) isolating the expressed desired product. Additionally, the method may include (iii) purifying the isolated antibody or antigen binding fragment. Transformed B cells and cultured plasma cells may be screened for those producing antibodies and antigen binding fragments of the desired specificity or function.
  • Screening may be carried out by any immunoassay, e.g., EFISA, by staining of tissues or cells (including transfected cells), by neutralization assay or by one of a number of other methods known in the art for identifying desired specificity or function.
  • the assay may select on the basis of simple recognition of one or more antigens, or may select on the additional basis of a desired function e.g., to select neutralizing antibodies rather than just antigen-binding antibodies, to select antibodies that can change characteristics of targeted cells, such as their signaling cascades, their shape, their growth rate, their capability of influencing other cells, their response to the influence by other cells or by other reagents or by a change in conditions, their differentiation status, or the like.
  • Individual transformed B cell clones may then be produced from the positive transformed B cell culture.
  • the cloning step for separating individual clones from the mixture of positive cells may be carried out using limiting dilution, micromanipulation, single cell deposition by cell sorting or another method known in the art.
  • Nucleic acid from the cultured plasma cells can be isolated, cloned and expressed in HEK293T cells or other known host cells using methods known in the art.
  • the immortalized B cell clones or the transfected host-cells of described herein can be used in various ways e.g., as a source of monoclonal antibodies, as a source of nucleic acid (DNA or mRNA) encoding a monoclonal antibody of interest, for research, etc.
  • the present disclosure provides pharmaceutical compositions comprising an antibody that neutralizes hepatitis B virus and a pharmaceutically acceptable, aqueous vehicle.
  • a vehicle is typically understood to be a material that is suitable for storing, transporting, formulating and/or administering a compound, such as a pharmaceutically active compound, in particular the antibodies according to the present disclosure.
  • the vehicle may be a physiologically acceptable liquid, which is suitable for storing, transporting, and/or administering a pharmaceutically active compound, in particular the antibodies according to the present disclosure.
  • compositions described herein are prepared for injection or infusion into a patient.
  • the composition may be prepared for intravenous (“IV” or “i.v.”), intra-arterial, or intraventricular infusion.
  • the composition may be prepared for intravenous, intra-arterial, intraventricular, intramedullary, intraperitoneal, intrathecal, intraventricular, or injection.
  • the composition is prepared for subcutaneous (“SC” or “s.c.”) injection.
  • SC subcutaneous
  • compositions described herein are pharmaceutically acceptable, sterile aqueous solutions exhibiting suitable pH, isotonicity and stability for administration to a human subject.
  • Aqueous vehicles suitable for formulation of the compositions described herein include water (e.g., sterile water, USP water for injection), as well as isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
  • compositions according to the present description include an antibody selected from HBV neutralizing antibodies according to the present description.
  • pharmaceutical compositions according to the present description include an (isolated) antibody comprising (i) a heavy chain variable region (VH) comprising at least 90% identity to the amino acid sequence according to SEQ ID NO:41; and (ii) a light chain variable region (VL) comprising at least 90% identity to the amino acid sequence according to any one of SEQ ID NOs: 59, 89, or 90, provided that the amino acid at position 40 of the VL according to IMGT numbering is not a cysteine, wherein the antibody or antigen binding fragment thereof binds to the antigenic loop region of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
  • VH heavy chain variable region
  • VL light chain variable region
  • the VH comprises at least 95% identity to the amino acid sequence according to SEQ ID NO:41; and/or (ii) the VL comprises at least 95% identity to the amino acid sequence according to any one of SEQ ID NOs: 59, 89, or 90.
  • the amino acid at position 40 of the VL is alanine. In certain embodiments, the amino acid at position 40 of the VL is serine. In certain embodiments, the amino acid at position 40 of the VL is glycine.
  • the antibody comprises CDRHl, CDRH2, CDRH3, CDRLl, CDRL2, and CDRL3 sequences according to SEQ ID NOs: (i) 34-36, 37, 38, and 40, respectively; (ii) 34, 66, 36, 37, 38, and 40, respectively; (iii) 34-36, 37, 39, and 40, respectively; (iv) 34, 66, 36, 37, 39, and 40, respectively; (v) 34-36, 37, 38, and 58, respectively; (vi) 34, 66, 36, 37, 38, and 58, respectively; (vii) 34-36, 37, 39, and 58, respectively; or (viii) 34, 66, 36, 37, 39, and 58, respectively.
  • the VL comprises or consists of the amino acid sequence according to SEQ ID NO: 89.
  • the VL comprises or consists of the amino acid sequence according to SEQ ID NO:90.
  • the VH comprises or consists of the amino acid sequence according to SEQ ID NO:41.
  • the VH comprises or consists of the amino acid sequence according to SEQ ID NO:41 and VL comprises or consists of the amino acid sequence according to SEQ ID NO:89.
  • the VH comprises or consists of the amino acid sequence according to SEQ ID NO:41 and VL comprises or consists of the amino acid sequence according to SEQ ID NO:90.
  • the antibody comprises a human antibody and/or a monoclonal antibody.
  • the antibody is a multi specific antibody. In certain embodiments, the antibody is a bispecific antibody.
  • the antibody comprises a Fc moiety.
  • the Fc moiety comprises a mutation that enhances binding to a (e.g., human) FcRn as compared to a reference Fc moiety that does not comprise the mutation.
  • Fc moiety comprises a mutation that enhances binding to a (e.g., human) FcyR (e.g., such as a FcyRIIa, a FcyRIIIa, or both) as compared to a reference Fc moiety that does not comprise the mutation.
  • a FcyR e.g., such as a FcyRIIa, a FcyRIIIa, or both
  • the Fc moiety is an IgG isotype or is derived from an IgG isotype.
  • the mutation that enhances binding to FcRn comprises: M428L; N434S; N434H; N434A; N434S; M252Y; S254T; T256E; T250Q; P257I; Q311I; D376V; T307A; E380A; or any combination thereof.
  • the mutation that enhances binding to FcRn comprises: (i) M428L/N434S; (ii) M252Y/S254T/T256E; (iii) T250Q/M428L; (iv) P257I/Q311I; (v) P257I/N434H; (vi) D376V/N434H; (vii) T307A/E380A/N434A; or (viii) any combination of (i)-(vii).
  • the mutation that enhances binding to FcRn comprises M428L/N434S.
  • the mutation that enhances binding to a FcyR comprises S239D; I332E; A330L; G236A; or any combination thereof.
  • the mutation that enhances binding to a FcyR comprises: (i) S239D/I332E; (ii) S239D/A330L/I332E; (iii) G236A/S239D/I332E; or (iv) G236A/A330L/I332E.
  • the mutation that enhances binding to a FcyR comprises or consists of G236A/A330L/I332E. In some embodiments, the mutation that enhances binding to a FcyR does not comprise S239D. In some embodiments, the Fc moiety comprises a native Ser (S) at position 239.
  • the Fc moiety comprises the amino acid substitution mutations: M428L; N434S; G236A; A330L; and I332E. In certain further embodiments, the Fc moiety does not comprise a further mutation.
  • the antibody comprises the heavy chain (HC) amino acid sequence according to SEQ ID NO: 91.
  • the antibody comprises the heavy chain (HC) amino acid sequence according to SEQ ID NO: 92.
  • the antibody comprises the light chain (LC) amino acid sequence according to SEQ ID NO:93. In certain embodiments, the antibody comprises the light chain (LC) amino acid sequence according to SEQ ID NO: 94.
  • the antibody comprises the HC amino acid sequence according to SEQ ID NO:91 and the LC amino acid sequence according to SEQ ID NO:93.
  • the antibody comprises the HC amino acid sequence according to SEQ ID NO:92 and the LC amino acid sequence according to SEQ ID NO:94.
  • the antibody comprises the HC amino acid sequence according to SEQ ID NO:91 and the LC amino acid sequence according to SEQ ID NO:94.
  • the antibody comprises the HC amino acid sequence according to SEQ ID NO:92 and the LC amino acid sequence according to SEQ ID NO:93
  • compositions according to the present description include an (isolated) antibody comprising: (i) a heavy chain (HC) comprising the amino acid sequence according to SEQ ID NO:91; and (ii) a light chain (LC) comprising the amino acid sequence according to SEQ ID NO:93, wherein the antibody binds to the antigenic loop region of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
  • HC heavy chain
  • LC light chain
  • the antibody binds an HBsAg of a genotype selected from the HBsAg genotypes A, B, C, D, E, F, G, H, I, and J, or any combination thereof.
  • the antibody or pharmaceutical composition reduces a serum concentration of HBV DNA in a mammal having an HBV infection. In some embodiments, the antibody or pharmaceutical composition reduces a serum concentration of HBsAg in a mammal having an HBV infection. In some embodiments, the antibody or pharmaceutical composition reduces a serum concentration of HBeAg in a mammal having an HBV infection. In some embodiments, the antibody or pharmaceutical composition reduces a serum concentration of HBcrAg in a mammal having an HBV infection.
  • compositions according to the present description include an antibody comprising: a heavy chain variable region (V H ) comprising a CDRH1 amino acid sequence according to SEQ ID NO:34, a CDRH2 amino acid sequence according to SEQ ID NO:35 or 66, a CDRH3 amino acid sequence according to SEQ ID NO:36; and a light chain variable region (V L ) comprising a CDRL1 acid sequence according to SEQ ID NO:37, a CDRL2 acid sequence according to SEQ ID NO:38 or 39, and CDRL3 amino acid sequence according to SEQ ID NO:58 or 40; and a Fc moiety, wherein the Fc moiety comprises G236A/A330L/I332E.
  • V H heavy chain variable region
  • V L light chain variable region
  • the Fc moiety does not comprise S239D. In certain embodiments, the Fc moiety comprises a Ser (S) at position 239.
  • the Fc moiety further comprises M428L/N434S.
  • the VH comprises or consists of the amino acid sequence according to any one of SEQ ID NOs:41 or 67 and the VL comprises or consists of the amino acid sequence according to any one of SEQ ID NOs:42, 59, 65, 89, 90, and 111-120.
  • a pharmaceutical composition comprising an antibody, or an antigen binding fragment thereof, comprising: (i) a heavy chain variable region (VH) comprising a CDRH1 amino acid sequence according to SEQ ID NO:97, a CDRH2 amino acid sequence according to SEQ ID NO:98, a CDRH3 amino acid sequence according to SEQ ID NO:99; (ii) a light chain variable region (VL) comprising a CDRL1 acid sequence according to SEQ ID NO: 100, a CDRL2 acid sequence according to SEQ ID NO: 100, and CDRL3 amino acid sequence according to SEQ ID NO: 102; and (iii) a Fc moiety, wherein the Fc moiety comprises G236A/A330L/I332E.
  • VH heavy chain variable region
  • VL light chain variable region
  • Fc moiety wherein the Fc moiety comprises G236A/A330L/I332E.
  • VH comprises or consists of the amino acid sequence according to SEQ ID NO:95
  • VL comprises or consists of the amino acid sequence according to SEQ ID NO:96.
  • the Fc moiety does not comprise S239D. In certain embodiments, the Fc moiety further comprises M428L/N434S.
  • the antibody of the pharmaceutical composition has enhanced binding to a human FcyRIIA, a human FcyRIIIA, or both, as compared to a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E, wherein the human FcyRIIA is optionally H131 or R131, and/or the human FcyRIIIA is optionally F158 or V158; has reduced binding to a human FcyRIIB.
  • a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E wherein the human FcyRIIA is optionally HI 31 or R131, and/or the human FcyRIIIA is optionally F158 or V158; does not activate a human FcyRIIB; and/or activates a human natural killer (NK) cell in the presence of HBsAg to a greater degree than does a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E.
  • NK human natural killer
  • the pharmaceutical compositions include sufficient antibody material to facilitate administration of a therapeutically effective amount of antibody to a patient.
  • the antibody is included at a concentration selected from 100 mg/mL, 110 mg/mL, 120 mg/mL, 130 mg/mL, 140 mg/mL, 150 mg/mL, 160 mg/mL, 170 mg/mL, 180 mg/mL, 190 mg/mL, and 200 mg/mL.
  • the antibody is included in the composition at a concentration selected from above 50 mg/mL, above 75 mg/mL, above 100 mg/mL, above 125 mg/mL, above 150 mg/mL, above 175 mg/mL, above 200 mg/mL, above 225 mg/mL, and above 250 mg/mL.
  • the composition comprises the antibody at a concentration selected from a range of 50 mg/mL to 200 mg/mL, a range of 75 mg/mL to 225 mg/mL, and a range of 100 mg/mL to 200 mg/mL.
  • composition comprises the antibody at a concentration ranging from 125 mg/ml to 150 mg/ml.
  • the composition comprises the antibody at a concentration of 150 mg/mL.
  • compositions according to the present description may include one or more of a buffer, a surfactant or a triblock copolymer, a salt (e.g., sodium chloride), and a stabilizer (such as a sugar alcohol, disaccharide, or polysaccharide stabilizer, and/or a stabilizing amino acid, (e.g., arginine and/or glycine)).
  • a stabilizer such as a sugar alcohol, disaccharide, or polysaccharide stabilizer, and/or a stabilizing amino acid, (e.g., arginine and/or glycine).
  • the compositions described herein may be formulated to additionally include one or more antioxidants (e.g., ascorbic acid, methionine, ethylenediaminetetraacetic acid (EDTA)).
  • EDTA ethylenediaminetetraacetic acid
  • compositions of the disclosure exhibit and maintain a pH that maintains the viability of the antibody, while also being suitable for injection or infusion.
  • the compositions described herein are generally have a pH in a range from about 5.5 to about 8.5.
  • the pharmaceutical composition has a pH in a range from about 5.5 to about 6.5, such as in a range from 5.5 to 6.5.
  • the pharmaceutical composition has a pH in a range from 5.8 to 6.2, for example, about 6.0.
  • the pH may be 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, or 6.5.
  • the composition has a pH in a range from 6 to 8, for example, about 7.
  • the pH may be about 6, such as, for example, 6.
  • the composition may include a buffering agent to achieve and maintain a desired pH.
  • Buffers suitable for use in the compositions described herein include, e.g., acetate, citrate, histidine, succinate, phosphate, and hydroxymethylaminomethane (Tris) buffers.
  • the composition includes a buffer selected from a histidine buffer and a phosphate buffer.
  • the composition exhibits of pH of 6 and includes a histidine buffer.
  • the histidine may be included in the composition at a concentration in a range from lOmM to 40mM (e.g., 10 mM, 15 mM, 20 mM, 25 mM, 30 mM, 35 mM, or 40 mM).
  • the composition according to the present description exhibits a pH of 6 and includes histidine at a concentration selected from 10 mM, 15 mM, 20 mM, 25 mM, 30 mM, 35 mM, and 40 mM.
  • compositions described herein may also include a surfactant or a triblock copolymer.
  • Surfactants sometimes referred to as “detergents,” can serve one or more functions. For instance, in aqueous antibody solutions, surfactants and serve to preserve antibody functionality, aid in dissolution of the antibody or other excipients, and/or work to control microbial growth.
  • Surfactants that may be used in the compositions described herein include, e.g., polysorbate 80 (Tween 80), polysorbate 20 (Tween 20). Additionally or alternatively, a triblock copolymer such as poloxamer 188 may be used.
  • the composition includes a surfactant at a concentration ranging from 0.01% to 0.05% (w/v).
  • the surfactant may be selected from polysorbate 80 (Tween 80), polysorbate 20 (Tween 20), and poloxamer 188.
  • the pharmaceutical composition of the present description includes polysorbate 80 (Tween 80) at a concentration ranging from 0.01% to 0.05% (w/v). In other embodiments, the pharmaceutical composition of the present description includes polysorbate 80 (Tween 80) at a concentration 0.02% (w/v).
  • compositions according to the present disclosure include a sugar alcohol, disaccharide, or polysaccharide stabilizer
  • the stabilizer may be selected from, e.g., mannitol, sorbitol, sucrose, trehalose, and dextran 40.
  • the stabilizer is a disaccharide.
  • the pharmaceutical composition includes a disaccharide at a concentration selected from 4.0% to 10% (w/v). In certain such embodiments, the disaccharide is sucrose.
  • the pharmaceutical composition includes sucrose at a concentration selected from 4.0%, 4.1%, 4.2%, 4.3%, 4.4%, 4.5%, 4.6%, 4.7%, 4.8%, 4.9%, 5.0%, 5.1%, 5.2%, 5.3%, 5.4%, 5.5%, 5.6%, 5.7%, 5.8%, 5.9%, 6.0%, 6.1%, 6.2%,
  • the pharmaceutical composition includes sucrose at a concentration of about 7%, such as 7% (w/v).
  • the compositions are adapted for administration to mammalian, e.g., human subjects.
  • the composition is sterile, and may be specifically prepared to be pyrogen free.
  • the composition may be isotonic with respect to humans.
  • compositions described herein may be prepared for direct administration to a subject (i.e., without a reconstitution or mixing step), or they may be prepared as a lyophilized material to be reconstituted in an aqueous vehicle prior to injection or infusion to a patient.
  • the pharmaceutical composition according to the present disclosure may be provided, e.g., in a pre-filled syringe, or in a vial, such as a glass vial.
  • pharmaceutical compositions of the disclosure are supplied in hermetically-sealed containers.
  • the composition may be in kit form, designed such that a combined composition is reconstituted just prior to administration to a subject.
  • a lyophilized antibody may be provided in kit form with sterile water or a sterile buffer.
  • a pharmaceutical composition according to the present disclosure in the methods and uses according to the disclosure can be carried out alone or in combination with a co-agent (also referred to as "additional active component" herein), which may be useful for preventing and/or treating hepatitis B virus infection.
  • a co-agent also referred to as "additional active component” herein
  • the disclosure encompasses the administration of a pharmaceutical composition according to the present disclosure, wherein it is administered to a subject prior to, simultaneously with or after a co-agent or another therapeutic regimen useful for treating and/or preventing hepatitis B virus infection.
  • Said pharmaceutical composition administered in combination with said co agent can be administered in the same or different composition(s) and by the same or different route(s) of administration.
  • expressions like "combination therapy”, “combined administration”, “administered in combination” and the like refer to a combined action of the drugs (which are to be administered "in combination”).
  • the combined drugs are usually present at a site of action at the same time and/or within an overlapping time window.
  • the effects resulting from one of the drugs are still ongoing (even if the drug itself may no longer be present at a detectable) while the other drug is administered, such that effects of both drugs can interact.
  • a drug which was administered long before another drug e.g., more than one, two, three or more months or a year
  • it is no longer present at a detectable level (or its effects are not ongoing) when the other drug is administered is typically not considered to be administered "in combination”.
  • a pharmaceutical composition of the present disclosure is used in combination with a PD-1 inhibitor, for example a PD- 1 -specific antibody or binding fragment thereof, such as pidilizumab, nivolumab, pembrolizumab, MEDI0680 (formerly AMP-514), AMP-224, BMS-936558 or any combination thereof.
  • a PD-1 inhibitor for example a PD- 1 -specific antibody or binding fragment thereof, such as pidilizumab, nivolumab, pembrolizumab, MEDI0680 (formerly AMP-514), AMP-224, BMS-936558 or any combination thereof.
  • a pharmaceutical composition of the present disclosure is used in combination with a PD-L1 specific antibody or binding fragment thereof, such as BMS-936559, durvalumab (MEDI4736), atezolizumab (RG7446), avelumab (MSB0010718C), MPDL3280A, or any combination thereof.
  • a PD-L1 specific antibody or binding fragment thereof such as BMS-936559, durvalumab (MEDI4736), atezolizumab (RG7446), avelumab (MSB0010718C), MPDL3280A, or any combination thereof.
  • a pharmaceutical composition of the present disclosure is used in combination with a LAG3 inhibitor, such as LAG525, IMP321, IMP701, 9H12, BMS-986016, or any combination thereof.
  • a LAG3 inhibitor such as LAG525, IMP321, IMP701, 9H12, BMS-986016, or any combination thereof.
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of CTLA4.
  • a pharmaceutical composition of the present disclosure is used in combination with a CTLA4 specific antibody or binding fragment thereof, such as ipilimumab, tremelimumab, CTLA4-Ig fusion proteins (e.g., abatacept, belatacept), or any combination thereof.
  • a pharmaceutical composition of the present disclosure is used in combination with a B7-H3 specific antibody or binding fragment thereof, such as enoblituzumab (MGA271), 376.96, or both.
  • a B7-H3 antibody binding fragment may be a scFv or fusion protein thereof, as described in, for example, Dangaj et al, Cancer Res. 73:4820, 2013, as well as those described in U.S. Patent No. 9,574,000 and PCT Patent Publication Nos. WO /201740724A1 and WO 2013/025779A1.
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of CD244.
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of BLTA, HVEM, CD 160, or any combination thereof.
  • Anti CD-160 antibodies are described in, for example, PCT Publication No. WO 2010/084158.
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of TIM3.
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of Gal9.
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of adenosine signaling, such as a decoy adenosine receptor.
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of A2aR.
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of KIR, such as lirilumab (BMS-986015).
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of an inhibitory cytokine (typically, a cytokine other than TGF ) or Treg development or activity.
  • an inhibitor of an inhibitory cytokine typically, a cytokine other than TGF
  • Treg development or activity typically, a cytokine other than TGF
  • a pharmaceutical composition of the present disclosure is used in combination with an IDO inhibitor, such as levo-1 -methyl tryptophan, epacadostat (INCB024360; Liu et al., Blood 775:3520-30, 2010), ebselen (Terentis et al. , Biochem. 49:591- 600, 2010), indoximod, NLG919 (Mautino et al., American Association for Cancer Research 104th Annual Meeting 2013; Apr 6-10, 2013), 1 -methyl -tryptophan (l-MT)-tira-pazamine, or any combination thereof.
  • an IDO inhibitor such as levo-1 -methyl tryptophan, epacadostat (INCB024360; Liu et al., Blood 775:3520-30, 2010), ebselen (Terentis et al. , Biochem. 49:591- 600, 2010), indoximod, NLG919 (Mau
  • a pharmaceutical composition of the present disclosure is used in combination with an arginase inhibitor, such as N(omega)-Nitro-L-arginine methyl ester (L- NAME), N-omega-hydroxy-nor-l-arginine (nor-NOHA), L-NOHA, 2(S)-amino-6- boronohexanoic acid (ABH), S-(2-boronoethyl)-L-cysteine (BEC), or any combination thereof.
  • an arginase inhibitor such as N(omega)-Nitro-L-arginine methyl ester (L- NAME), N-omega-hydroxy-nor-l-arginine (nor-NOHA), L-NOHA, 2(S)-amino-6- boronohexanoic acid (ABH), S-(2-boronoethyl)-L-cysteine (BEC), or any combination thereof.
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of VISTA, such as CA-170 (Curis, Lexington, Mass.).
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of TIGIT such as, for example, COM902 (Compugen, Toronto, Ontario Canada), an inhibitor of CD 155, such as, for example, COM701 (Compugen), or both.
  • an inhibitor of TIGIT such as, for example, COM902 (Compugen, Toronto, Ontario Canada)
  • an inhibitor of CD 155 such as, for example, COM701 (Compugen)
  • COM701 Compugen
  • a pharmaceutical composition of the present disclosure is used in combination with an inhibitor of PVRIG, PVRL2, or both.
  • Anti-PVRIG antibodies are described in, for example, PCT Publication No. WO 2016/134333.
  • Anti-PVRL2 antibodies are described in, for example, PCT Publication No. WO 2017/021526.
  • composition of the present disclosure is used in combination with a LAIR1 inhibitor.
  • composition of the present disclosure is used in combination with an inhibitor of CEACAM-1, CEACAM-3, CEACAM-5, or any combination thereof.
  • a pharmaceutical composition of the present disclosure is used in combination with an agent that increases the activity (i.e.. is an agonist) of a stimulatory immune checkpoint molecule.
  • a composition of the present disclosure can be used in combination with a CD137 (4-1BB) agonist (such as, for example, urelumab), a CD134 (OX-40) agonist (such as, for example, MEDI6469, MEDI6383, or MEDI0562), lenalidomide, pomalidomide, a CD27 agonist (such as, for example, CDX-1127), a CD28 agonist (such as, for example, TGN1412, CD80, or CD86), a CD40 agonist (such as, for example, CP-870,893, rhuCD40L, or SGN-40), a CD 122 agonist (such as, for example, IL-2) an agonist of GITR (such as, for example, humanized monoclonal antibodies described in PCT Patent Publication
  • a method may comprise administering a pharmaceutical composition of the present disclosure with one or more agonist of a stimulatory immune checkpoint molecule, including any of the foregoing, singly or in any combination.
  • a pharmaceutical composition of this disclosure is used in combination with a nucleos(t)ide reverse transcriptase inhibitor (NRTI), an interferon (e.g., IFNa, PT ⁇ b, or both), or any combination thereof.
  • NRTI nucleos(t)ide reverse transcriptase inhibitor
  • the NRTI comprises one or more of: tenofovir; tenofovir disoproxil (e.g., tenofovir disproxil fumarate); tenofovir alafenamide; Entecavir; Lamivudine; Adefovir; and adefovir dipivoxil.
  • the present disclosure provides the use of a pharmaceutical composition according to the present disclosure in treatment of infection with Hepatitis B virus.
  • the present disclosure provides methods for treatment of infection with Hepatitis B virus, with the methods comprising: administering to a subject in need thereof, a therapeutically effective amount of a pharmaceutical composition according to the present disclosure.
  • the subject is infected with Hepatitis B virus infection, diagnosed with Hepatitis B virus infection, and/or showing symptoms of Hepatitis B virus infection.
  • treatment and “therapy'V'therapeutic” of Hepatitis B virus infection include (complete) cure as well as attenuation/reduction of Hepatitis B virus infection and/or related symptoms (e.g., attenuation/reduction of severity of infection and/or symptoms, number of symptoms, duration of infection and/or symptoms, or any combination thereof).
  • the subject is an adult. In certain embodiments, the subject is in a range from 18 years of age to 65 years of age. In certain embodments, the subject weighs from 40 kg to 125 kg. In certain embodiments, a subject administered a pharmaceutical composition of the present disclosure has a chronic HBV infection; e.g., defined by positive serum HBsAg, HBV DNA, and/or HBeAg on 2 occasions at least 6 months apart.
  • a chronic HBV infection e.g., defined by positive serum HBsAg, HBV DNA, and/or HBeAg on 2 occasions at least 6 months apart.
  • a subject administered a pharmaceutical composition of the present disclosure does not have cirrhosis. Absence of cirrhosis is determined by: Fibroscan evaluation (e.g., within 6 months prior to administering the single dose of the pharmaceutical composition); or liver biopsy (e.g., within 12 months prior to administering the single dose of the pharmaceutical composition), wherein, preferably, the absence of cirrhosis is determined by the absence of Metavir F3 fibrosis or the absence of F4 cirrhosis.
  • a subject administered a pharmaceutical composition of the present disclosure has received a nucleos(t)ide reverse transcriptase inhibitor (NRTI), optionally within 120 days, further optionally within 60 days, prior to the single dose of the pharmaceutical composition being administered.
  • NRTI nucleos(t)ide reverse transcriptase inhibitor
  • the subject has previously received NRTI, such as within 120 days or within 60 days of administration of the pharmaceutical composition.
  • the NRTI comprises one or more of: tenofovir; tenofovir disoproxil (e.g., tenofovir disproxil fumarate); tenofovir alafenamide; Entecavir; Lamivudine; Adefovir; and adefovir dipivoxil.
  • a subject administered a pharmaceutical composition of the present disclosure has a serum HBV DNA concentration of less than 100 IU/mL (e.g., 99, 98, 97, 96, 95, 90, 80, 70, 60, or the like) no more than 28 days prior to the single dose being administered.
  • a subject administered a pharmaceutical composition of the present disclosure has a serum HBsAg concentration of less than 1,000 IU/mL prior to the single dose being administered.
  • a subject administered a pharmaceutical composition of the present disclosure has a serum HB surface antigen (HBsAg) concentration of greater than or equal to 1,000 IU/mL no more than 28 days prior to the single dose being administered.
  • HBsAg concentration can be determined using, for example using an Abbott ARCHITECT assay.
  • a subject administered a pharmaceutical composition of the present disclosure was HB e-antigen (HBeAg)-negative no more than 28 days prior to the single dose being administered.
  • the subject was negative for anti-HB antibodies no more than 28 days prior to the single dose being administered.
  • a subject administered a pharmaceutical composition of the present disclosure (i) does not have fibrosis and/or does not have cirrhosis; and/or (ii) has (serum) alanine aminotransferase (ALT) ⁇ 2 x Upper Limit of Normal (ULN).
  • a method comprises administering a single dose of a pharmaceutical composition of the present disclosure.
  • the single dose of the pharmaceutical composition comprises the antibody in a range from 2 to 18 mg/kg (subject body weight); e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 or 18 mg/kg.
  • a single dose of the pharmaceutical composition comprises up to 6 mg, up to 18 mg, up to 75 mg, up to 90 mg, up to 300 mg, up to 900 mg, or up to 3000 mg of the antibody.
  • the single dose of the pharmaceutical composition comprises about 10, about 25, about 50, about 75, about 90, about 100, about 125, about 150, about 175, about 200, about 250, about 300, about 350, about 400, about 450, about 500, about 550, about 600, about 650, about 700, about 750, about 800, about 850, about 900, about 950, about 1000, about 1250, about 1500, about 1750, about 2000, about 2250, about 2500, about 2750, or about 3000 mg of the antibody.
  • the single dose of the pharmaceutical composition comprises about 75 mg of the antibody. In other embodiments, the single dose of the pharmaceutical composition comprises about 90 mg of the antibody. In still other embodiments, the single dose of the pharmaceutical composition comprises up to 300 mg of the antibody. In yet other embodiments, the single dose of the pharmaceutical composition comprises up to 900 mg of the antibody. In yet other embodiments, the single dose of the pharmaceutical composition comprises up to 3,000 mg of the antibody.
  • a single dose of the pharmaceutical composition comprises the antibody at a concentration in a range from 100 mg/mL to 200 mg/mL, such as 100 mg/mL, 110 mg/mL, 120 mg/mL, 130 mg/mL, 140 mg/mL, 150 mg/mL, 160 mg/mL, 170 mg/mL, 180 mg/mL, 190 mg/mL, or 200 mg/mL, preferably 150 mg/mL.
  • the pharmaceutical composition can be administered via injection or infusion.
  • the pharmaceutical compositions may be administered by, e.g., intravenous, intra arterial, or intraventricular infusion.
  • the pharmaceutical compositions may be administered by, e.g., intravenous, intra-arterial, intraventricular, intramedullary, intraperitoneal, intrathecal, intraventricular, or subcutaneous injection.
  • the pharmaceutical composition is administered via subcutaneous (“SC") injection, or via intravenous ("IV”) injection.
  • the dose is referred to as a "single dose” and the administration is regarded to be a “single administration.”
  • the multiple injections or infusions are administered over a period of about 5 minutes or less, about 15 minutes or less, about 30 minutes or less, about 1 hour or less, about 2 hours or less, about 4 hours or less, about 6 hours or less, about 1 day or less, about 1 week or less, or about 1 month or less.
  • the subject has a > 2-fold reduction in serum HBsAg (e.g., concentration of HBsAg in serum, e.g., as determined using an Abbott ARCHITECT assay) as compared to the subject’s serum HBsAg at from 0 days to 28 days prior to administration of the single dose.
  • serum HBsAg e.g., concentration of HBsAg in serum, e.g., as determined using an Abbott ARCHITECT assay
  • the subject following administration of the single dose of the pharmaceutical composition (e.g., at 56 days following administration of the single dose), the subject has: (i) has reduced or less severe intrahepatic spread of HBV as compared to a reference subject (e.g., a subject having a HBV infection of similar severity and of a same gender, age, body weight, and/or general health as the subject receiving the pharmaceutical composition) over a same time period who received a placebo or did not receive a therapy for HBV.; and/or (ii) comprises an adaptive immune response against HBV, e.g. , including a T cell response specific for HBV.
  • a reference subject e.g., a subject having a HBV infection of similar severity and of a same gender, age, body weight, and/or general health as the subject receiving the pharmaceutical composition
  • an adaptive immune response against HBV e.g. , including a T cell response specific for HBV.
  • the present disclosure also includes the following exemplary embodiments.
  • Embodiment 1 An isolated antibody, or an antigen binding fragment thereof, comprising: (i)a heavy chain variable region (V H ) comprising at least 90% identity to the amino acid sequence according to SEQ ID NO:41; and (ii) a light chain variable region (V L ) comprising at least 90% identity to the amino acid sequence according to any one of SEQ ID NOs: 59, 89, or 90, provided that the amino acid at position 40 of the V L according to IMGT numbering is not a cysteine, wherein the antibody or antigen binding fragment thereof binds to the antigenic loop region of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
  • V H heavy chain variable region
  • V L light chain variable region
  • Embodiment 2 The antibody or antigen binding fragment of Embodiment 1, wherein: (i) the V H comprises at least 95% identity to the amino acid sequence according to SEQ ID NO:41; and/or (ii) the V L comprises at least 95% identity to the amino acid sequence according to any one of SEQ ID NOs: 59, 89, or 90.
  • Embodiment 3 The antibody or antigen binding fragment of Embodiment 1 or 2, wherein the amino acid at position 40 of the V L is alanine.
  • Embodiment 4 The antibody or antigen binding fragment of Embodiment 1 or 2, wherein the amino acid at position 40 of the V L is serine.
  • Embodiment 5 The antibody or antigen binding fragment of Embodiment 1 or 2, wherein the amino acid at position 40 of the V L is glycine.
  • Embodiment 6 The antibody or antigen binding fragment of any one of Embodiments 1-5, comprising CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 sequences according to SEQ ID NOs: (i) 34-36, 37, 38, and 40, respectively; (ii) 34, 66, 36, 37, 38, and 40, respectively; (iii) 34-36, 37, 39, and 40, respectively; (iv) 34, 66, 36, 37, 39, and 40, respectively; (v) 34-36, 37, 38, and 58, respectively; (vi) 34, 66, 36, 37, 38, and 58, respectively; (vii) 34-36, 37, 39, and 58, respectively; or (viii) 34, 66, 36, 37, 39, and 58, respectively.
  • Embodiment 7 The antibody or antigen binding fragment of any one of Embodiments 1-3 or 6, wherein the V L comprises or consists of the amino acid sequence according to SEQ ID NO:
  • Embodiment 8 The antibody or antigen binding fragment of any one of Embodiments 1, 2, 4, or 6, wherein the V L comprises or consists of the amino acid sequence according to SEQ ID NO: 90.
  • Embodiment 9 The isolated antibody of any one of Embodiments 1-8, wherein the V H comprises or consists of the amino acid sequence according to SEQ ID NO:41.
  • Embodiment 10 The isolated antibody of any one of Embodiments 1-3, 6, 7, or 9, wherein the V H comprises or consists of the amino acid sequence according to SEQ ID NO:41 and V L comprises or consists of the amino acid sequence according to SEQ ID NO: 89.
  • Embodiment 11 The isolated antibody of any one of Embodiments 1, 2, 4, 6, 8, or 9, wherein the V H comprises or consists of the amino acid sequence according to SEQ ID NO:41 and V L comprises or consists of the amino acid sequence according to SEQ ID NO: 90.
  • Embodiment 12 An isolated antibody, or an antigen binding fragment thereof, comprising:
  • V H a heavy chain variable region comprising at least 90% identity to the amino acid sequence according to SEQ ID NO: 95;
  • V L a light chain variable region comprising at least 90% identity to the amino acid sequence according to SEQ ID NO: 96, wherein the antibody or antigen binding fragment thereof binds to the antigenic loop region of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
  • Embodiment 13 The antibody or antigen binding fragment of Embodiment 12, wherein:
  • V H comprises at least 95% identity to the amino acid sequence according to SEQ ID NO: 95;
  • the V L comprises at least 95% identity to the amino acid sequence according to SEQ ID NO: 96.
  • Embodiment 14 The antibody or antigen binding fragment of Embodiment 12 or 13, comprising CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 sequences according to SEQ ID NOs:97-102, respectively.
  • Embodiment 15 The antibody or antigen binding fragment of any one of Embodiments 1-14, wherein the antibody, or the antigen binding fragment thereof, comprises a human antibody, a monoclonal antibody, a purified antibody, a single chain antibody, a Fab, a Fab’, a F(ab’)2, a Fv, or a scFv.
  • Embodiment 16 The antibody or antigen binding fragment of any one of Embodiments 1-15, wherein the antibody or antigen binding fragment is a multi-specific antibody or antigen binding fragment.
  • Embodiment 17 The antibody or antigen binding fragment of any one of Embodiment 16, wherein the antibody or antigen binding fragment is a bispecific antibody or antigen binding fragment.
  • Embodiment 18 The antibody of any one of Embodiments 1-17, or an antigen binding fragment thereof, wherein the antibody or the antigen binding fragment comprises a Fc moiety.
  • Embodiment 19 The antibody or antigen binding fragment of Embodiment 18, wherein the Fc moiety comprises a mutation that enhances binding to (e.g., human) FcRn as compared to a reference Fc moiety that does not comprise the mutation.
  • Embodiment 20 The antibody or antigen binding fragment of Embodiment 18 or 19, wherein the Fc moiety comprises a mutation that enhances binding to a (e.g., human) FcyR as compared to a reference Fc moiety that does not comprise the mutation.
  • a (e.g., human) FcyR as compared to a reference Fc moiety that does not comprise the mutation.
  • Embodiment 21 The antibody or antigen binding fragment of any one of Embodiments 18-20, wherein the Fc moiety is an IgG isotype or is derived from an IgG isotype.
  • Embodiment 22 The antibody or antigen binding fragment of Embodiment 21, wherein the mutation that enhances binding to FcRn comprises: M428L; N434S; N434H; N434A; N434S; M252Y; S254T; T256E; T250Q; P257I; Q311I; D376V; T307A; E380A; or any combination thereof.
  • Embodiment 23 The antibody or antigen binding fragment of Embodiment 21 or 22, wherein the mutation that enhances binding to FcRn comprises: (i) M428L/N434S; (ii) M252Y/S254T/T256E; (iii) T250Q/M428L; (iv) P257I/Q311I; (v) P257I/N434H; (vi) D376V/N434H; (vii) T307A/E380A/N434A; or (viii) any combination of (i)-(vii).
  • Embodiment 24 The antibody or antigen binding fragment of Embodiment 23, wherein the mutation that enhances binding to FcRn comprises M428L/N434S.
  • Embodiment 25 The antibody or antigen binding fragment of any one of Embodiments 20-24, wherein the mutation that enhances binding to a FcyR comprises S239D; I332E; A330L; G236A; or any combination thereof.
  • Embodiment 26 The antibody or antigen binding fragment of Embodiment 25, wherein the mutation that enhances binding to a FcyR comprises: (i) S239D/I332E; (ii) S239D/A330L/I332E; (iii) G236A/S239D/I332E; or (iv)
  • Embodiment 27 The antibody or antigen binding fragment of Embodiment 25 or 26, wherein the mutation that enhances binding to a FcyR comprises or consists of G236 A/A330L/I332E .
  • Embodiment 28 The antibody or antigen binding fragment of any one of Embodiments 18-27, wherein the Fc moiety comprises the amino acid substitution mutations: M428L; N434S; G236A; A330L; and I332E.
  • Embodiment 29 An isolated antibody, or an antigen binding fragment thereof, comprising:
  • V H heavy chain variable region
  • V L light chain variable region
  • Embodiment 30 The isolated antibody or antigen binding fragment of Embodiment 29, further comprising an Fc moiety.
  • Embodiment 31 The isolated antibody or antigen binding fragment of Embodiment 30, wherein the Fc moiety is derived from an IgG isotype and comprises M428L and N434S substitution mutations.
  • Embodiment 32 The isolated antibody or antigen binding fragment of Embodiment 30 or 31, wherein the Fc moiety is derived from an IgG isotype and comprises G236A, A330L, and I332E substitution mutations.
  • Embodiment 33 The isolated antibody or antigen binding fragment of Embodiment 32, wherein the Fc moiety comprises M428L, N434S, G236A, A330L, and I332E substitution mutations.
  • Embodiment 34 The antibody or antigen binding fragment of any one of Embodiments 1-10, 15-33, comprising the heavy chain (HC) amino acid sequence according to SEQ ID NO: 91.
  • Embodiment 35 The antibody or antigen binding fragment of any one of Embodiments 1-10 and 15-32, comprising the heavy chain (HC) amino acid sequence according to SEQ ID NO: 92.
  • Embodiment 36 The antibody or antigen binding fragment of any one of Embodiments 1-3, 6,
  • Embodiment 37 The antibody or antigen binding fragment of any one of Embodiments 1, 2, 4, 6, 8, 11, and 15-28, comprising the light chain (LC) amino acid sequence according to SEQ ID NO: 94.
  • Embodiment 38 The antibody or antigen binding fragment of Embodiment 34 or 36, comprising the HC amino acid sequence according to SEQ ID NO:91 and the LC amino acid sequence according to SEQ ID NO:93.
  • Embodiment 39 The antibody or antigen binding fragment of Embodiment 35 or 37, comprising the HC amino acid sequence according to SEQ ID NO:92 and the LC amino acid sequence according to SEQ ID NO:94.
  • Embodiment 40 The antibody or antigen binding fragment of Embodiment 34 or 37, comprising the HC amino acid sequence according to SEQ ID NO:91 and the LC amino acid sequence according to SEQ ID NO:94.
  • Embodiment 41 The antibody or antigen binding fragment of Embodiment 35 or 36, comprising the HC amino acid sequence according to SEQ ID NO:92 and the LC amino acid sequence according to SEQ ID NO:93
  • Embodiment 42 An isolated antibody, or an antigen binding fragment thereof, comprising:
  • HC heavy chain
  • LC light chain
  • Embodiment 43 The antibody or antigen binding fragment of any one of Embodiments 1-42, wherein the antibody or the antigen binding fragment binds an HBsAg of a genotype selected from the HBsAg genotypes A, B, C, D, E, F, G, H, I, and J, or any combination thereof.
  • Embodiment 44 The antibody or antigen binding fragment of any one of Embodiments 1-43, wherein the antibody or antigen binding fragment reduces a serum concentration of HBV DNA in a mammal having an HBV infection.
  • Embodiment 45 The antibody or antigen binding fragment of any one of Embodiments 1-44, wherein the antibody or antigen binding fragment reduces a serum concentration of HBsAg in a mammal having an HBV infection.
  • Embodiment 46 The antibody or antigen binding fragment of any one of Embodiments 1-45, wherein the antibody or antigen binding fragment reduces a serum concentration of HBeAg in a mammal having an HBV infection.
  • Embodiment 47 The antibody or antigen binding fragment of any one of Embodiments 1-46, wherein the antibody or antigen binding fragment reduces a serum concentration of HBcrAg in a mammal having an HBV infection.
  • Embodiment 48 A kit comprising:
  • Embodiment 49 The kit of Embodiment 48, further comprising:
  • polymerase inhibitor optionally comprises Lamivudine, Adefovir, Entecavir, Telbivudine, Tenofovir, or any combination thereof;
  • interferon optionally comprises IFNbeta and/or IFNalpha
  • checkpoint inhibitor optionally comprises an anti -PD- 1 antibody or antigen binding fragment thereof, an anti- PD-L1 antibody or antigen binding fragment thereof, and/or an anti-CTLA4 antibody or antigen binding fragment thereof;
  • Embodiment 50 The kit of Embodiment 49, wherein the polymerase inhibitor comprises lamivudine.
  • Embodiment 51 Use of the antibody or antigen binding fragment of any one of Embodiments 1-47 in the manufacture of a medicament to prevent, treat, attenuate, and/or diagnose a hepatitis B infection and/or a hepatitis D infection in a subject.
  • Embodiment 52 A method of treating, preventing, and/or attenuating a hepatitis B and/or hepatitis D infection in a subject, comprising administering to the subject an effective amount of: (i) the antibody or antigen binding fragment of any one of Embodiments 1-47.
  • Embodiment 53 The method of Embodiment 52, further comprising administering to the subject one or more of: a polymerase inhibitor, wherein the polymerase inhibitor optionally comprises Lamivudine, Adefovir, Entecavir, Telbivudine,
  • Tenofovir or any combination thereof; an interferon, wherein the interferon optionally comprises IFNbeta and/or IFNalpha; a checkpoint inhibitor, wherein the checkpoint inhibitor optionally comprises an anti-PD-1 antibody or antigen binding fragment thereof, an anti-PD-Ll antibody or antigen binding fragment thereof, and/or an anti-CTLA4 antibody or antigen binding fragment thereof; an agonist of a stimulatory immune checkpoint molecule; or any combination thereof.
  • Embodiment 54 The method of Embodiment 52 or 53, wherein the hepatitis B infection is a chronic hepatitis B infection.
  • Embodiment 55 The method of any one of Embodiments 52-54, wherein the subject has received a liver transplant.
  • Embodiment 56 The method of any one of Embodiments 52-55, wherein the subject is non- immunized against hepatitis B.
  • Embodiment 57 The method of any one of Embodiments 52-56, wherein the subject is a newborn.
  • Embodiment 58. The method of any one of Embodiments 52-57, wherein the subject is undergoing or has undergone hemodialysis.
  • Embodiment 59 An isolated antibody, or an antigen binding fragment thereof, comprising: a heavy chain variable region (V H ) comprising a CDRH1 amino acid sequence according to SEQ ID NO:34, a CDRH2 amino acid sequence according to SEQ ID NO: 35 or 66, a CDRH3 amino acid sequence according to SEQ ID NO:36; a light chain variable region (V L ) comprising a CDRL1 acid sequence according to SEQ ID NO:37, a CDRL2 acid sequence according to SEQ ID NO:38 or 39, and CDRL3 amino acid sequence according to SEQ ID NO:58 or 40; and a Fc moiety, wherein the Fc moiety comprises G236A/A330L/I332E.
  • Embodiment 60 The antibody or antigen binding fragment of Embodiment 59, wherein the Fc moiety does not comprise S239D.
  • Embodiment 61 The antibody or antigen binding fragment of Embodiment 59 or 60, wherein the Fc moiety further comprises M428L/N434S.
  • Embodiment 62 The antibody or antigen binding fragment of any one of Embodiments 59-61, wherein the V H comprises or consists of the amino acid sequence according to any one of SEQ ID NOs:41 or 67 and wherein the V L comprises or consists of the amino acid sequence according to any one of SEQ ID NOs:42, 59, 65, 89, 90, and 111-120.
  • Embodiment 63 An isolated antibody, or an antigen binding fragment thereof, comprising:
  • V H a heavy chain variable region comprising a CDRH1 amino acid sequence according to SEQ ID NO:97, a CDRH2 amino acid sequence according to SEQ ID NO:98, a CDRH3 amino acid sequence according to
  • a light chain variable region comprising a CDRL1 acid sequence according to SEQ ID NO: 100, a CDRL2 acid sequence according to SEQ ID NO: 100, and CDRL3 amino acid sequence according to SEQ ID NO: 102; and (iii) a Fc moiety, wherein the Fc moiety comprises G236A/A330L/I332E.
  • Embodiment 65 The antibody or antigen binding fragment of Embodiment 63 or 64, wherein the Fc moiety further comprises M428L/N434S.
  • Embodiment 66 The antibody or antigen binding fragment of any one of Embodiments 63-65, wherein the VH comprises or consists of the amino acid sequence according to SEQ ID NO:95, and wherein the VL comprises or consists of the amino acid sequence according to SEQ ID NO:96.
  • Embodiment 67 The antibody or antigen binding fragment of any one of Embodiments 63-66, wherein the antibody or antigen binding fragment: (i) has enhanced binding to a human FcyRIIA, a human FcyRIIIA, or both, as compared to a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E, wherein the human FcyRIIA is optionally H131 or R131, and/or the human FcyRIIIA is optionally F158 orV158; (ii) has reduced binding to a human FcyRIIB, as compared to a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E; (iii) does not bind to a human FcyRIIB; has reduced binding to a human Clq, as compared to a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330
  • G236A/A330F/I332E wherein the human FcyRIIA is optionally H131 or R131, and/or the human FcyRIIIA is optionally F158 orV158; does not activate a human FcyRIIB; and/or activates a human natural killer (NK) cell in the presence of HBsAg to a greater degree than does a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330F/I332E.
  • NK human natural killer
  • Embodiment 68 A method of treating a Hepatitis B Virus infection in a subject, the method comprising administering to the subject a single dose of a composition comprising the antibody or antigen binding fragment of any one of Embodiments 1-47 or 59-67 at 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 mg/kg, or more, of the antibody or antigen-binding fragment, or at a dose of up to 75 mg (i.e., including any integer or non-integer dose up to 75 mg), up to 300 mg, or up to 900 mg, of the antibody or antigen-binding fragment.
  • a composition comprising the antibody or antigen binding fragment of any one of Embodiments 1-47 or 59-67 at 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 mg/kg, or more, of the antibody or antigen-binding fragment, or at a dose of up to 75 mg (i.e., including any integer or non-integer dose up to 75 mg), up to 300 mg
  • Embodiment 69 The method of Embodiment 68, wherein the antibody or antigen-binding fragment comprises a heavy chain (HC) amino acid sequence according to SEQ ID NO: 91 and a light chain (LC) amino acid sequence according to SEQ ID NO:93.
  • HC heavy chain
  • LC light chain
  • Embodiment 70 The method of Embodiment 68 or 69, wherein prior to the administering, the composition comprises the antibody or antigen-binding fragment at 150 mg/mL, optionally in sterile water, and further comprises 20 mM Histidine,
  • Embodiment 71 The method of any one of Embodiments 68-70, wherein the subject: (i) is aged 18 to 65 years, or is older; (ii) weighs > 40 kg to ⁇ 125 kg; (iii) has a chronic HBV infection, wherein a chronic HBV infection is defined by: positive serum HBsAg, HBV DNA, or HBeAg on 2 occasions at least 6 months apart based on previous or current laboratory documentation (or a positive result based on any combination of these tests performed at least 6 months apart); (iv) does not have cirrhosis; (v) received a nucleoside reverse transcriptase inhibitor (NTRI) therapy for at least 4 months (120 days) prior to the single dose being administered, wherein the NTRI therapy optionally comprises Tenofovir disoproxil/tenofovir alafenamide, Entecavir, Lamivudine, or Adefovir/adefovir dipivoxil; (vi) had HBV DNA at ⁇
  • Embodiment 72 The method of any one of Embodiments 68-71, wherein the administering comprises subcutaneous injection.
  • Embodiment 73 The method of any one of Embodiments 68-72, wherein at 8 weeks following the adminstering of the single dose, the subject has a > 2-fold reduction in HBsAg as compared to from 0 days to 4 weeks (28 days) prior to the administering.
  • Embodiment 74 A method of treating a Hepatitis B virus (HBV) infection in a subject, the method comprising administering to the subject a single dose of a pharmaceutical composition comprising an antibody according to any one of Embodiments 1-47 or 59-67, wherein, optionally, the antibody comprises the heavy chain amino acid sequence of SEQ ID NO.:91 and the light chain amino acid sequence of SEQ ID NO.:93.
  • HBV Hepatitis B virus
  • Embodiment 75 The method of Embodiment 74, wherein the single dose of the pharmaceutical composition comprises the antibody in a range from 2 to 18 mg/kg (subject body weight).
  • Embodiment 76 The method of Embodiment 74 or 75, wherein the single dose of the pharmaceutical composition comprises up to 6 mg, up to 18 mg, up to 75 mg, up to 90 mg, up to 300 mg, up to 900 mg, or up to 3000 mg of the antibody.
  • Embodiment 77 The method of any one of Embodiments 74-76, wherein the single dose of the pharmaceutical composition comprises the antibody at a concentration in a range from 100 mg/mL to 200 mg/mL, such as 100 mg/mL, 110 mg/mL, 120 mg/mL, 130 mg/mL, 140 mg/mL, 150 mg/mL, 160 mg/mL, 170 mg/mL, 180 mg/mL, 190 mg/mL, or 200 mg/mL, preferably 150 mg/mL.
  • Embodiment 78 The method of any one of Embodiments 74-77, wherein the single dose of the pharmaceutical composition comprises about 75 mg of the antibody.
  • Embodiment 79. The method of any one of Embodiments 74-78, wherein the single dose of the pharmaceutical composition comprises about 90 mg of the antibody.
  • Embodiment 80 The method of any one of Embodiments 74-78, wherein the single dose of the pharmaceutical composition comprises up to 300 mg of the antibody.
  • Embodiment 81 The method of any one of Embodiments 74-78, wherein the single dose of the pharmaceutical composition comprises up to 900 mg of the antibody.
  • Embodiment 82 The method of any one of Embodiments 74-78, wherein the single dose of the pharmaceutical composition comprises up to 3,000 mg of the antibody.
  • Embodiment 83 The method of any one of Embodiments 74-82, wherein the method comprises administering the single dose by subcutaneous injection.
  • Embodiment 84 The method of any one of Embodiments 74-83, wherein the method comprises administering the single dose by intravenous injection.
  • Embodiment 85 The method of any one of Embodiments 74-84, wherein the pharmaceutical composition further comprises water, optionally USP water.
  • Embodiment 86 The method of any one of Embodiments 74-85, wherein the pharmaceutical composition further comprises histidine, optionally at a concentration in a range from 10 mM to 40 mM, such as 20 mM, in the pharmaceutical composition.
  • Embodiment 87 The method of any one of Embodiments 74-86, wherein the pharmaceutical composition further comprises a disaccharide, such as sucrose, optionally at 5%, 6%, 7%, 8%, or 9%, preferably about 7% (w/v).
  • a disaccharide such as sucrose
  • Embodiment 88 The method of any one of Embodiments 74-87, wherein the pharmaceutical composition further comprises a surfactant or a triblock copolymer, optionally a polysorbate or poloxamer-188, preferably polysorbate 80 (PS80), wherein, optionally, the polysorbate or poloxamer-188 is present in a range from 0.01% to 0.05% (w/v), preferably 0.02% (w/v).
  • Embodiment 89 The method of any one of Embodiments 74-88, wherein the pharmaceutical composition has a pH in a range from 5.8 to 6.2, in a range from 5.9 to 6.1, or of 5.8, of 5.9, of 6.0, of 6.1, or of 6.2.
  • Embodiment 90 The method of Embodiment 89, wherein the pharmaceutical composition comprises:
  • Embodiment 91 The method of any one of Embodiments 74-90, wherein the subject is an adult.
  • Embodiment 92 The method of Embodiment 74-91, wherein the subject is in a range from 18 years of age to 65 years of age.
  • Embodiment 93 The method of any one of Embodiments 74-92, wherein the subject weighs from 40 kg to 125 kg.
  • Embodiment 94 The method of any one of Embodiments 74-93, wherein the subject has a chronic HBV infection; e.g., defined by positive serum HBsAg, HBV DNA, and/or HBeAg on 2 occasions, wherein the 2 occasions are at least 6 months apart.
  • a chronic HBV infection e.g., defined by positive serum HBsAg, HBV DNA, and/or HBeAg on 2 occasions, wherein the 2 occasions are at least 6 months apart.
  • Embodiment 95 The method of any one of Embodiments 74-94, wherein the subject does not have cirrhosis.
  • Embodiment 96 The method of Embodiment 95, wherein absence of cirrhosis is determined by: Fibroscan evaluation (e.g., within 6 months prior to administering the single dose of the pharmaceutical composition); or liver biopsy (e.g., within 12 months prior to administering the single dose of the pharmaceutical composition), wherein, preferably the absence of cirrhosis is determined by the absence of Metavir F3 fibrosis or the absence of F4 cirrhosis.
  • Embodiment 97 The method of any one of Embodiments 74-96, wherein the subject has received a nucleos(t)ide reverse transcriptase inhibitor (NRTI), optionally within 120 days, further optionally within 60 days, prior to the single dose being administered.
  • NRTI nucleos(t)ide reverse transcriptase inhibitor
  • Embodiment 98 The method of Embodiment 97, wherein the NRTI comprises one or more of: tenofovir; tenofovir disoproxil (e.g., tenofovir disproxil fumarate); tenofovir alafenamide; Entecavir; Lamivudine; Adefovir; and adefovir dipivoxil.
  • tenofovir e.g., tenofovir disproxil fumarate
  • tenofovir alafenamide tenofovir alafenamide
  • Entecavir Lamivudine
  • Adefovir Adefovir
  • adefovir dipivoxil e.g., adefovir dipivoxil.
  • Embodiment 99 The method of any one of Embodiments 74-98, wherein the subject has a serum HBV DNA concentration of less than 100 IU/mL no more than 28 days prior to the single dose being administered.
  • Embodiment 100 The method of any one of Embodiments 74-99, wherein the subject has a serum HBsAg concentration of less than 1,000 IU/mL prior to the single dose being administered.
  • Embodiment 101 The method of any one of Embodiments 74-99, wherein the subject has a serum HBsAg concentration of greater than or equal to 1,000 IU/mL no more than 28 days prior to the single dose being administered.
  • Embodiment 102 The method of any one of Embodiments 74-101, wherein the subject was HB e-antigen (HBeAg) -negative no more than 28 days prior to the single dose being administered.
  • Embodiment 103 The method of any one of Embodiments 74-102, wherein the subject was negative for anti-HB antibodies no more than 28 days prior to the single dose being administered.
  • Embodiment 105 The method of any one of Embodiments 74-103, wherein the subject, prior to administration of the single dose: (i) does not have fibrosis and/or does not have cirrhosis; and/or (ii) has alanine aminotransferase (ALT) ⁇ 2 x Upper Limit of Normal (ULN).
  • ALT alanine aminotransferase
  • UNN Upper Limit of Normal
  • Embodiment 106 The method of any one of Embodiments 74-105, wherein at 56 days following administration of the single dose, the subject has a > 2-fold reduction in serum HBsAg (e.g., concentration of HBsAg in serum, e.g., as determined using an Abbott ARCHITECT assay) as compared to the subject’s serum HBsAg at from 0 days to 28 days prior to administration of the single dose.
  • serum HBsAg e.g., concentration of HBsAg in serum, e.g., as determined using an Abbott ARCHITECT assay
  • Embodiment 107 The method of any one of Embodiments 74-106, wherein following administration of the single dose (e.g., at 56 days following administration of the single dose), the subject has: (i) has reduced or less severe intrahepatic spread of HBV as compared to a reference subject; and/or (ii) comprises an adaptive immune response against HBV.
  • Embodiment 108 The method of any one of Embodiments 74-107, wherein the subject is male.
  • Embodiment 110 A pharmaceutical composition comprising an antibody, wherein the antibody comprises the heavy chain amino acid sequence of SEQ ID NO.:91 and the light chain amino acid sequence of SEQ ID NO.:93, wherein the pharmaceutical composition comprises the antibody at a concentration ranging from 100 mg/mL to 200 mg/mL, such as 100 mg/mL, 110 mg/mL, 120 mg/mL, 130 mg/mL, 140 mg/mL, 150 mg/mL, 160 mg/mL, 170 mg/mL, 180 mg/mL, 190 mg/mL, or 200 mg/mL, preferably 150 mg/mL.
  • Embodiment 111 The pharmaceutical composition of Embodiment 1110, wherein the pharmaceutical composition comprises up to 6 mg, up to 18 mg, up to 75 mg, up to 90 mg, up to 300 mg, up to 900 mg, or up to 3000 mg of the antibody.
  • Embodiment 112. The pharmaceutical composition of Embodiment 110 or 111, wherein the pharmaceutical composition comprises about 75 mg of the antibody.
  • Embodiment 113. The pharmaceutical composition of Embodiment 110 or 111, wherein the pharmaceutical composition comprises about 90 mg of the antibody.
  • Embodiment 114 The pharmaceutical composition of Embodiment 110 or 111, wherein the pharmaceutical composition comprises about 300 mg of the antibody.
  • Embodiment 115 The pharmaceutical composition of Embodiment 110 or 111, wherein the pharmaceutical composition comprises about 900 mg of the antibody.
  • Embodiment 116 The pharmaceutical composition of Embodiment 110 or 111, wherein the pharmaceutical composition comprises about 3,000 mg of the antibody.
  • Embodiment 117 The pharmaceutical composition of any one of Embodiments 110-116, wherein the pharmaceutical composition further comprises water, optionally USP water.
  • Embodiment 118 The pharmaceutical composition of any one of Embodiments 110-117, wherein the pharmaceutical composition further comprises histidine, optionally at a concentration from 10 mM to 40 mM, such as 20 mM, in the pharmaceutical composition.
  • Embodiment 119 The pharmaceutical composition of any one of Embodiments 110-118, wherein the pharmaceutical composition further comprises a disaccharide, such as sucrose, optionally at 5%, 6%, 7%, 8%, or 9%, preferably about 7% (w/v).
  • a disaccharide such as sucrose
  • Embodiment 120 The pharmaceutical composition of any one of Embodiments 110-119, wherein the pharmaceutical composition further comprises a surfactant, optionally a polysorbate, preferably polysorbate 80 (PS80), wherein, optionally, the polysorbate is present in a range from 0.01% to 0.05% (w/v), preferably 0.02% (w/v).
  • Embodiment 121 The pharmaceutical composition of any one of Embodiments 110-120, wherein the pharmaceutical composition has a pH ranging from 5.8 to 6.2, ranging from 5.9 to 6.1, or of 5.8, of 5.9, of 6.0, of 6.1, or of 6.2.
  • Embodiment 122 The pharmaceutical composition of any one of Embodiments 110-121, wherein the pharmaceutical composition comprises:
  • HBC34-V7 (WO 2017/060504) were engineered in which the cysteine amino acid at position 40 was substituted with a serine (thereby generating "HBC34-V34") or with an alanine (thereby generating "HBC34-V35").
  • nucleotide sequences encoding these additional variant antibodies were codon-optimized, and antibodies were expressed as IgGl (glml7, 1 allotype) in ExpiCHOTM cells (ThermoFisher). Codon-optimized nucleotide sequences encoding the VH and VL domains of HBC34-V35 are provided in SEQ ID NOS: 103 and 104, respectively.
  • HBC34-V34 and HBC34-V35 were investigated using a direct antigen-binding ELISA.
  • HBC34-V7 was used as a comparator.
  • both HBC34-V34 and HBC34-V35 bound effectively to two recombinant HBsAg antigens (“adw”, top panel; "adr”, bottom panel), and HBC34-V35 had very similar binding as the parent HBC34-V7.
  • the variant antibodies were examined for binding to all known HBsAg genotypes ((A)-(J)). Briefly, human epithelial cells (Hep2 cells) were transfected with plasmids expressing each of the HBsAg of the 10 HBV genotypes A, B, C, D, E, F, G, H, I, and J. All antibodies were tested at multiple concentrations for staining of transiently transfected permeabilized cells. Two days after transfection, Hep2 cells were collected, fixed and permeabilized with saponin for immunostaining with HBC34 and the five selected variants. HBC34-V7 was included as a comparator.
  • HBC34-V34 and HBC34-V35 recognized all 10 HBV HBsAg genotypes. HBC34-V35 showed somewhat stronger staining than HBC34-V34.
  • Example 2 HBC antibodies having modified Fc regions efficiently bind to antigen
  • HBC34-V35 was expressed as IgGl with wild-type Fc, or with Fc containing a "MLNS" mutation (M428L/N434S) or with MLNS in combination with "GAALIE” (G239A/A330L/I332E).
  • MLNS a "MLNS” mutation
  • GAALIE G239A/A330L/I332E
  • Each construct was tested for binding to recombinant HBsAg (adw) in two separate antigen-binding ELISA experiments.
  • Three (3) lots of HBC34-v35 wild-type Fc were tested.
  • Two (2) lots of HBC34-V35-MLNS and two (2) lots of HBC34-V35-MLNS- GAALIE were tested.
  • HBC34v7 (one lot) was tested as a comparator. As shown in Figures 3A and 3B, the introduced Fc mutations did not affect antigen-binding activity of HBC34-V35. EC50 values varied somewhat between the various constructs and the two experiments, but were generally low.
  • HBC34-V35 In vitro and in vivo neutralization studies are performed using HBC34-V35, HBC34-V35- MLNS, and HBC34-V35-MLNS-GAALIE. In one study, antibodies are tested for neutralizing activity using HBV-infected mouse PXB cells. In another study, antibodies are tested using human hepatocyte cells infected with HBV of the C genotype.
  • Hebsbulin Human Hepatitis B Immunoglobulin
  • HBC24 is an IgGl-type fully human monoclonal antibody having the CDR, V H and V L sequences as shown above in Table 3. Exemplary nucleotide sequences encoding the V H and V L of HBC24 are provided in Table 4.
  • Example 5 Clearance of HB Antigens and viral entry inhibition in a mouse model
  • mice An immune-deficient mouse having transplanted human hepatocytes was used to test the effectiveness of anti-HBV antibodies of the present disclosure in clearing HBsAg. Briefly, primary human hepatocytes were transplanted into SCID mice for which mouse hepatocytes had previously been destroyed enzymatically. The mice were T- and B-cell deficient. This model is useful for studying HBV infection including entry, spreading, cccDNA regulation, hepatocyte -intrinsic immune responses, and viral integration into host genome.
  • Plasma and serum samples were collected periodically throughout the study, and viral loads, HBV DNA (by PCR), and HB Ag (HBsAg, HBeAg, HBcrAg). Mice were sacrificed at week 6. As shown in Figures 4-7, treatment with the highest dose of HBC34-v35 reduced viral load and viral entry into hepatocytes.
  • HBC24 is analyzed for the presence of somatic mutations in the variable regions relative to germline sequence. Identified somatic mutations are reverted to germline sequence to produce HBC24 variants. HBC24 and variants are tested for binding (in vitro) and neutralization (in vitro, ⁇ in vivo) of HBV and HBD serotypes using assays as described in Examples 1 and 3.
  • HBC24 variants are produced that contain the MLNS and GAALIE mutations in both Fc monomers.
  • the HC amino acid sequences of selected variants are provided in SEQ ID NOs: 120 and 121.
  • Variants are examined for: (1) in vitro binding to antigen; (2) in vitro neutralization of HBV serotypes using assays as described in Examples 1 and 3.
  • GLP Good Laboratory Practice
  • ADCC Antibody-dependent cellular cytotoxicity
  • ADCP Antibody-dependent cellular phagocytosis
  • Fc Fragment crystallizable
  • HBsAg Hepatitis B surface Antigen
  • mAb Monoclonal antibody
  • PBS Phosphate- buffered saline
  • UHPL-SEC Ultra-high performance liquid size-exclusion chromatography
  • ATCC American Type Culture Collection
  • FcyRs Fc gamma receptor(s)
  • CHO cells Chinese hamster ovary cells
  • RLU Relative luminescence units
  • BLI Bio-layer interferometry. Table 5. Test Articles.
  • Binding of HBC34v35-MLNS and HBC34-V35-MLNS-GAALIE to human FcyRs was measured on an Octet instrument (BLI, biolayer interferometry). Briefly, His-tagged human FcyRs (FcyRIIa allele H131, FcyRIIa allele R131, FcyRIIAa allele F158, FcyRIIIa allele V158 and FcyRIIb) at 2 pg/ml were captured onto anti-penta-His sensors for 6 minutes.
  • FcyR-loaded sensors were then exposed for 4 minutes to a solution of kinetics buffer (pH 7.1) containing 2 pg/ml of each mAb in the presence 1 pg/ml of affmiPure F(ab Fragment Goat Anti-Human IgG, F(ab fragment-specific (to cross-link human mAbs through the Fab fragment), followed by a dissociation step in the same buffer for 4 additional minutes (right part of the plot). Association and dissociation profiles were measured in real time as change in the interference pattern using an Octet RED 96 (ForteBio).
  • Binding of HBC34v35-MLNS and HBC34-V35-MLNS-GAALIE to human complement was measured on an Octet instrument (BLI, biolayer interferometry). Briefly, anti-human Fab (CHI -specific) sensors were used to capture, through the Fab fragment, the full IgGl of HBC34v35 MLNS and HBC34-V35-MLNS-GAALIE mAbs at 10 pg/ml for 10 minutes. IgG- loaded sensors were then exposed for 4 minutes to a solution of kinetics buffer (pH 7.1) containing 3 pg/ml of purified human Clq (left part of the plot), followed by a dissociation step in the same buffer for 4 additional minutes (right part of the plot). Association and dissociation profiles were measured in real time as change in the interference pattern using an Octet RED96 (ForteBio). Preparation of Human NK cells from whole blood
  • NK cells were freshly isolated from whole EDTA blood using the MACSxpress® NK isolation Kit following the manufacturer’s instruction. Briefly, anticoagulated blood was mixed in a 50 ml tube with 15 ml of the NK isolation cocktail and incubated for 5 minutes at room temperature using a rotator at approximately 12 rounds per minute. The tube was then placed in the magnetic field of the MACSxpress® Separator for 15 minutes. The magnetically labeled cells adhere to the wall of the tube while the aggregated erythrocytes sediment to the bottom. The target NK cells were then collected from the supernatant while the tube was still inside the MACSxpress® Separator. NK cells were centrifuged, treated with distilled water to remove residual erythrocytes, centrifuged again and finally resuspended in AIM-V medium.
  • MAbs were serially diluted 10-fold in AIM-V medium from 100 pg/ml to 0.001 pg/ml.
  • Target cells PLC/PRF/5; MacNab, et al., British Journal of Cancer, 34(5), 1976
  • PLC/PRF/5 MacNab, et al., British Journal of Cancer, 34(5), 1976
  • PLC/PRF/5 MacNab, et al., British Journal of Cancer, 34(5), 1976
  • serially diluted antibodies were added to each well (23 m ⁇ per well), and the antibody/cell mixture was incubated for 10 minutes at room temperature.
  • human NK cells were added at a cell density of 7.5 x 10 4 /well in 23 m ⁇ , yielding an effector to target ratio of 10:1.
  • Control wells were also included that were used to measure maximal lysis (containing target cells with 23 m ⁇ of 3% Triton x-100) and spontaneous lysis (containing target cells and effector cells without antibody). Plates were incubated for 4 hours at 37°C with 5% CO2. Cell death was determined by measuring lactate dehydrogenase (LDH) release using a LDH detection kit according to the manufacturer’s instructions. In brief, plates were centrifuged for 4 minutes at 400 x g, and 35 m ⁇ of supernatant was transferred to a flat 384-well plate. LDH reagent was prepared and 35 m ⁇ were added to each well.
  • LDH lactate dehydrogenase
  • Activation of primary NK cells was tested using freshly isolated cells from two donors that had been previously genotyped for expressing homozygous high (V158 allele) or low (F158 allele) affinity FcyRIIIa.
  • Serial dilutions of mAbs (serially diluted 10-fold in AIM-V medium from 100 mg/ml to 0.0001 mg/ml) were incubated with NK cells for 4 hours.
  • Activation of NK cell was measured by flow cytometry by staining NK cells with anti-CD 107a mAb (anti-CD 107 PE, BioLegend, used diluted 1/35) as a functional marker for NK cell activity.
  • HB C34v35 -MLN S and HBC34-V35-MLNS-GAALIE were serially diluted 4-fold in ADCC Assay buffer from 5 mg/ml to 0.076 mg/ml.
  • Target antigen HBsAg from Engerix B, Glaxo SmithKline
  • HBsAg from Engerix B, Glaxo SmithKline
  • Effector cells for the ADCC Bioassay were thawed and added at a cell density of 7.5 x lOVwell in 25 m ⁇ (final HBsAg concentration was 0.2 pg/ml). Control wells were also included that were used to measure antibody-independent activation (containing HBsAg and effector cells but no antibody) and spontaneous luminescence of the plate (wells containing the ADCC Assay buffer only). Plates were incubated for 24 hours at 37°C with 5% CO2. Activation of human FcyRIIIa (V158 or F158 variants) in this bioassay results in NFAT-mediated expression of the luciferase reporter gene.
  • Luminescence was measured with a luminometer using the Bio-Glo-TM Luciferase Assay Reagent according to the manufacturer’s instructions.
  • the data i.e.. specific FcyRIIIa activation
  • RLU relative luminescence units
  • HBC34v35-MLNS and HBC34-V35-MLNS-GAALIE were serially diluted 5-fold in ADCP Assay buffer from 50 pg/ml to 0.00013 pg/ml.
  • Target antigen (HBsAg from Engerix B) was added in a white flat bottom 96-well plate at 0.6 or 6 pg/ml in 25 m ⁇ , then serially diluted antibodies were added to each well (25 m ⁇ per well), and the antigen/antibody was incubated for 25 minutes at room temperature.
  • Effector cells for the FcyRIIa activation bioassay were thawed and added at a cell density of 50.0 x lOVwell in 25 m ⁇ (final HBsAg concentration was 0.2 or 2 pg/ml, respectively). Control wells were also included that were used to measure antibody- independent activation (containing HBsAg and effector cells but no antibody) and spontaneous luminescence of the plate (wells containing the ADCP Assay buffer only). Plates were incubated for 23 hours at 37°C with 5% CO2. Activation of human FcyRIIa (H131 variants) in this bioassay results in NFAT-mediated expression of the luciferase reporter gene.
  • Luminescence was measured with a luminometer using the Bio-Glo-TM Luciferase Assay Reagent according to the manufacturer’s instructions.
  • the data i.e.. specific FcyRIIa activation
  • RLU relative luminescence units
  • HBC34v35-MLNS and HBC34-V35-MLNS-GAALIE were serially diluted 5-fold in ADCP Assay buffer from 100 pg/ml to 0.00026 pg/ml.
  • Target antigen (HBsAg from Engerix B) was added in a white flat bottom 96-well plate at 3 pg/ml in 25 pi, then serially diluted antibodies were added to each well (25 pi per well), and the antigen/antibody was incubated for 15 minutes at room temperature. Effector cells for the FcyRIIb activation bioassay were thawed and added at a cell density of 75.0 x 10 4 /well in 25 pi (the final HBsAg concentration was 1 pg/ml).
  • Control wells were also included that were used to measure antibody -independent activation (containing HBsAg and effector cells but no antibody) and spontaneous luminescence of the plate (wells containing the ADCP Assay buffer only). Plates were incubated for 20 hours at 37°C with 5% CO2. Activation of human FcyRIIb in this bioassay results in NFAT-mediated expression of the luciferase reporter gene. Luminescence was measured with a luminometer using the Bio-Glo-TM Luciferase Assay Reagent according to the manufacturer’s instructions. The data (i.e.. specific FcyRIIb activation) are expressed as the average of relative luminescence units (RLU) over the background by applying the following formula: (RLU at concentration [x] of mAbs - RLU of background).
  • RLU relative luminescence units
  • PLC/PRF/5 cells were trypsinized for 5 min at 37°C, transferred in 7 ml growing medium, centrifugated at 400 x g, 4 min, 4°C, and extensively washed at 4°C in PBS. Some cells were fixed with 4% formaldehyde (20 minutes at 4°C); others were fixed and then permeabilized with permeabilization buffer (20 minutes at 4°C). The cellular pellet was resuspended in 2.64 ml of wash buffer (fixed cells) or permeabilization buffer (fix&perm cells) (Table 7) and dispensed at 200 pl/well into 96-well round bottom plates (corresponding to 100 ⁇ 00 cells/well). The plate was centrifugated at 400g , 4 min, 4°C.
  • Direct antiviral mechanisms are important for neutralizing HBV in vivo.
  • Fc-dependent mechanisms of action mediated by the interaction of the Fc region with Fc gamma receptors (FcyRs) on immune cells may also have important contributions to in vivo efficacy and to mediate endogenous immune responses.
  • FcyR-dependent mechanisms can be assessed in vitro by measuring binding to FcyRs as well as in antibody-dependent activation of human FcyRs (Hsieh, Y.-T., et al., Journal of Immunological Methods, 441(C), 56-66. doi.org/10.1016/j.jim.2016.12.002).
  • HBC34v35-MLNS and HBC34-V35-MLNS-GAALIE were compared side-by- side for their ability to bind to the full set of human FcyRs (FcyRIIIa V158 and F158 alleles, FcyRIIa H131and R131 alleles and FcyRIIb) using biolayer interferometry (BLI Octet System, ForteBio).
  • Fc bearing MLNS-GAALIE mutations have altered interactions with FcyRs; specifically, Fc bearing these mutations have enhanced binding to FcyRIIIa and FcyRIIa, and reduced binding to FcyRIIb.
  • binding of HBC34-V35- MLNS-GAALIE to Clq was abolished as measured by biolayer interferometry (Figure 9).
  • HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE were also tested for their ability to activate human FcyRIIIa and FcyRIIa using cell-based reporter bioassays. These assays utilize Jurkat cells engineered with a NFAT-mediated luciferase reporter to reflect activation of human FcyRs. While HBC34v35-MLNS poorly activated or did not activate human FcyRIIIa and FcyRIIa in the presence of HBsAg, HBC34-V35-MLNS-GAALIE showed a dose-dependent activation of all tested FcyRs ( Figures 10A, 10B, 11A, and 11B).
  • HBC34-V35- MLNS-GAALIE did not activate FcyRIIb, even when tested at 100 pg/ml ( Figure 12).
  • ADCC activity was also measured using natural killer cells (NK) isolated from human peripheral blood mononuclear cells of one donor who was previously genotyped for expressing heterozygous high (VI 58) and low (FI 58) affinity FcyRIIIa (F/V).
  • NK natural killer cells isolated from human peripheral blood mononuclear cells of one donor who was previously genotyped for expressing heterozygous high (VI 58) and low (FI 58) affinity FcyRIIIa
  • Isolated NK cells were used to measure the killing of the hepatoma cell line PLC/PR/5 upon exposure to HBC34v35; HBC34v35-MLNS; HBC34-V35-MLNS-GAALIE; or another mAh (17.1.41, targeting another epitope on the antigenic loop of the HBsAg; see Eren, R., et ah, Hepatology, doi.org/10.1053/jhep.2000.9632; Galun, E., et al, Hepatology, doi.org/10.1053/jhep.2002.31867).
  • HBV-specific binding proteins of the present disclosure bearing the GAALIE Fc mutation bind to and activate low affinity activating FcyRIIa and FcyRIIIa more effectively than the non-GAALIE Fc parental antibody.
  • GAALIE-bearing binding proteins also do not bind to and or activate low affinity inhibitory FcyRIIb.
  • GAALIE-bearing binding proteins also do not bind to Clq.
  • GAALIE-bearing binding proteins do not promote ADCC on hepatoma cells, but activate human NK cells in the presence of soluble HBsAg.
  • a multi -center phase 1 randomized, placebo-controlled study is performed to evaluate the safety, tolerability, pharmacokinetics, and antiviral activity of HBC34-v35-MLNS-GAALIE (comprising the heavy chain amino acid sequence shown in SEQ ID NO.:91 and the light chain amino acid sequence shown in SEQ ID NO.:93).
  • the study sites are as follows: Part A (single center) and Parts B/C (multi -center). In Part A (up to 40 subjects), the primary objective is to evaluate the safety and tolerability of HBC34-v35-MLNS-GAALIE in healthy adult subjects.
  • the secondary objectives are to characterize the serum pharmacokinetics (PK) of HBC34-v35-MLNS-GAALIE in healthy adult subjects, and to evaluate the immunogenicity (induction of anti-drug antibody [ADA]) of HBC34-v35-MLNS-GAALIE in healthy adult subjects,
  • the primary objective is to evaluate the safety and tolerability of HBC34-v35-MLNS-GAALIE in adult subjects with chronic HBV infection without cirrhosis.
  • the secondary objectives are: to characterize the serum PK of HBC34-v35-MLNS-GAALIE in adult subjects with chronic HBV infection without cirrhosis; to assess the antiviral activity of HBC34-v35-MLNS-GAALIE in adult subjects with chronic HBV infection without cirrhosis; and to evaluate the immunogenicity (induction of ADA) of HBC34-v35-MLNS-GAALIE in adult subjects with chronic HBV infection without cirrhosis.
  • the exploratory objectives include: to evaluate the effect of HBC34-v35-MLNS-GAALIE on additional viral parameters; to evaluate the effect of HBC34-v35-MLNS-GAALIE on immune responses (or exploratory biomarkers) in adult subjects with chronic HBV infection without cirrhosis; and to evaluate the impact of host polymorphisms (or exploratory biomarkers) on response to HBC34-v35-MLNS-GAALIE in adult subjects with chronic HBV infection without cirrhosis.
  • HBC34-v35-MLNS-GAALIE serum free PK parameters for example: C max , Clast, T maX , T last , AUCinf, AUCiast, %AUCexp, ti / 2, l z , V z (IV only), CL (IV only), V z /F (SC only), and CL/F (SC only)
  • HBC34-v35-MLNS-GAALIE serum free and total PK parameters for example: C max , C last , Tmax, Tiast, AUCirf, AUCiast, %AUC exp , ti/2, lz, Vz/F, and CL/F.
  • the exploratory endpoints of this study may include:
  • FcyR Fc gamma receptor
  • Part A Up to 40 healthy adult subjects.
  • Part B Up to 56 adult subjects with chronic HBV infection without cirrhosis on nucleos(t)ide reverse transcriptase inhibitor (NRTI) therapy who are HBeAg-negative and who have HBsAg ⁇ 1000 IU/mL.
  • NRTI nucleos(t)ide reverse transcriptase inhibitor
  • Part C Up to 24 adult subjects with chronic HBV infection without cirrhosis on NRTI therapy who have HBsAg > 1000 IU/mL.
  • Part A Inclusion Criteria Include:
  • WOCBP Women of child-bearing potential
  • Female subjects with female partners of child-bearing potential must agree to meet 1 of the following contraception requirements from the time of study drug administration until 40 weeks post-dose of study drug: vasectomy with documentation of azoospermia, or male condom use plus partner use of a highly effective contraception often.
  • Male subjects must also agree not to donate sperm from the time of study drug administration through 40 weeks after study drug administration. Patients agree not to donate blood during the duration of the study
  • Part B/C Inclusion Critera Include:
  • Aged 18 (or age of legal consent, whichever is older) to 65 years
  • HBsAg, HBV DNA, or HBeAg on 2 occasions at least 6 months apart based on previous or current laboratory documentation (any combination of these tests performed 6 months apart is acceptable))
  • NRTI therapy for at least 2 months at the time of screening, are HBeAg -negative.
  • NRTI therapy include, but are not limited to: Tenofovir disoproxil/tenofovir alafenamide; Entecavir; Lamivudine; Adefovir/adefovir dipivoxil.
  • Post-menopausal status is defined as 12 months with no menses without an alternative medical cause.
  • Part A The duration of study drug treatment is a single dose.
  • the estimated total time on study, inclusive of screening and follow-up, for each subject is up to 28 weeks.
  • Parts B/C The duration of study drug treatment is a single dose.
  • the estimated total time on study, inclusive of screening and follow-up, for each subject is up to 44 weeks.
  • Part A All subjects are followed for 24 weeks after study drug administration.
  • Parts B/C All subjects are followed for 8 weeks after study drug administration. Subjects with > 2-fold HBsAg reduction at Week 8 undergo extended follow-up for up to 40 weeks total or until the reduction in HBsAg is ⁇ 2-fold relative to baseline at 2 consecutive collections, whichever occurs first. The extended follow-up may be discontinued based on emerging data. Study Design
  • a Safety Review Committee performs ongoing reviews of safety, tolerability, and antiviral activity data (Parts B and C only) at specified timepoints based on available data collected throughout the study. While the primary data that will be reviewed by the SRC for dose escalations and enrollment of optional cohorts is listed throughout the protocol, additional relevant data from other cohorts is also reviewed by the SRC as indicated to inform decisions. The study is conducted in 3 Parts:
  • HBC34-v35-MLNS-GAALIE anaphylaxis and other serious allergic reactions and injection/infusion-related reactions.
  • the risk of developing such conditions after dosing with HBC34v35-MLNS-GAALIE specifically is unknown.
  • HBC34v35-MLNS- GAALIE gathers information on the safety and tolerability of HBC34v35-MLNS- GAALIE as well as relevant data on the PK profile and the generation of anti-drug antibodies (ADAs).
  • ADAs anti-drug antibodies
  • HBC34-v35-MLNS-GAALIE is not expected to offer benefit to healthy subjects enrolled in Part A of this study. Subjects will be monitored for important potential risks, and routine pharmacovigilance and risk minimization activities will be performed.
  • HBC34-v35-MLNS-GAALIE potential risks associated with the administration of HBC34-v35-MLNS-GAALIE to subjects with chronic HBV infection include immune complex disease and hepatotoxicity due to the elimination of infected hepatocytes via ADCC/ADCP and/or cytotoxic T-cells induced via a vaccinal effect.
  • the study design of Parts B/C includes several elements to mitigate these risks:
  • Part B enrolls subjects with serum HBsAg ⁇ 1000 IU/mL, to mitigate the risk for immune complex disease and hepatotoxicity. Additionally, Part B safety data is reviewed by the SRC prior to enrolling subjects with potentially higher baseline HBsAg values in the optional Part C of the study.
  • Parts B and C enroll subjects who are on NRTIs and have HBV DNA ⁇ 100 IU/mL at screening and have good hepatic reserve and a low level of hepatic inflammation at baseline as determined by the following attributes: ALT or AST ⁇ 2 c ULN, no history of hepatic decompensation, and lack of significant fibrosis and cirrhosis.
  • Dose escalation occurs after SRC review of available safety data up to 4 weeks after dose administration to account for the anticipated timing of potential immune complex disease and hepatotoxicity due to the elimination of infected hepatocytes via ADCC/ADCP and/or cytotoxic T-cells induced via a vaccinal effect
  • Safety monitoring including liver function tests, urinalysis, renal function, vital signs, and physical examination findings, is designed to detect evidence of HBC34-v35-MLNS- GAALIE -associated immune adverse events.
  • Three sequential cohorts for Part A evaluate 90 mg, up to 300 mg, and up to 900 mg administered by SC injection.
  • the SRC reviews available clinical and laboratory safety data up to 2 weeks post-dose for all available subjects within a cohort prior to dose escalation.
  • Two optional cohorts in Part A can be added evaluating up to 900 mg and 3000 mg administered by IV infusion. Enrollment of these optional cohorts can occur following SRC review of available Week 2 data from all available subjects in Cohort 3a (up to 900 mg SC).
  • SC cohorts (Cohort la, 2a, and 3a) in Part A are enrolled sequentially
  • cohorts may be enrolled in parallel if the additional cohort(s) is examining a dose level which is at or below a dose level that has previously been found to have an acceptable safety and tolerability profde in a prior cohort in Part A.
  • each cohort 2 sentinel subjects are randomized 1:1 to receive HBC34-v35-MLNS-GAALIE or placebo. These subjects are dosed and monitored for at least 24 hours in an inpatient setting; if the investigator has no safety concerns, the remainder of the subjects in the same cohort are dosed. The remaining subjects are randomized 5:1 to receive HBC34-v35-MLNS-GAALIE or placebo.
  • the maximum dose escalation factor in Part A does not exceed 5-fold.
  • the first cohort in Part B (Cohort lb) is enrolled after SRC review of available Week 2 data from all available subjects in Cohort la (90 mg SC).
  • Two optional cohorts in Part B may be added following the same dosing schedule.
  • the optional cohorts may be dosed at a lower, equivalent, or intermediate dose level relative to the dose levels explored in the planned Part B cohorts, or after cohort 5b at a dose level not exceeding 900 mg.
  • the maximum dose level for the optional cohorts in Part B does not exceed the highest single dose found to have an acceptable safety and tolerability profile in Part A.
  • the optional cohorts are enrolled at any time within the Part B planned cohorts based on the approval of the SRC.
  • cohorts in Part B While all of the cohorts in Part B are to be enrolled sequentially, cohorts may be enrolled in parallel if the additional cohort(s) is examining a dose level which is at or below a dose level that has previously been found to have an acceptable safety and tolerability profile in a prior cohort in Part A and Part B.
  • each cohort 2 sentinel subjects are randomized 1:1 to receive HBC34-v35-MLNS-GAALIE or placebo by SC injection. These subjects are dosed and monitored through at least 72 hours post-dose (including inpatient monitoring over at least the first 24 hours); if the investigator(s) have no safety concerns, the remainder of the subjects in the same cohort are dosed. The remaining subjects are randomized 5:1 to receive HBC34-v35-MLNS-GAALIE or placebo by SC injection.
  • the maximum dose escalation factor in Part B does not exceed 5-fold.
  • Part C is optional and may be conducted based on an acceptable safety and tolerability profile of HBC34-v35-MLNS-GAALIE in HBeAg-negative subjects with HBsAg levels ⁇ 1000 IU/mL in Part B.
  • the first cohort in Part C is enrolled after SRC review of available data for all subjects in Part A and Part B through the Week 4 visit for the cohort of subjects in Part B who are receiving a matching or higher dose relative to the proposed starting dose level in Part C.
  • Each cohort may evaluate up to 900 mg administered by SC injection and the dose utilized in Part C cohorts does not exceed the highest dose level in Part B that was found to have an acceptable safety and tolerability profile by the SRC.
  • Cohorts may be enrolled in parallel.
  • each cohort 2 sentinel subjects are randomized 1:1 to receive HBC34-v35-MLNS-GAALIE or placebo by SC injection. These subjects are dosed and monitored through at least 72 hours post-dose (including inpatient monitoring over at least the first 24 hours); if the investigator(s) have no safety concerns, the remainder of the subjects in the same cohort are dosed. The remaining subjects are randomized 5:1 to receive HBC34-v35-MLNS-GAALIE or placebo by SC injection.
  • Eligible subjects are admitted into the clinical investigative site on Day -1 or 1. On Day 1, eligibility criteria related to vital signs, pregnancy testing, drugs of abuse, blood donation, presence of any clinically significant acute condition, and use of prescription, OTC, herbal, or investigational agents are evaluated to ensure ongoing eligibility for the study. Any changes to medical history are also evaluated and recorded. Eligible subjects in each cohort are randomized to receive HBC34-v35-MLNS-GAALIE or placebo within 48 hours prior to study drug administration. Subjects receive a single dose of study drug on Day 1 (HBC34-v35-MLNS- GAALIE or placebo).
  • AEs Adverse events related to screening activities are collected from the time of consent onwards; any other events occurring during the screening period are reported as medical history. All serious adverse events (SAEs) are collected from the time of consent onwards.
  • Subjects return to the clinical investigative site for in-person assessments per the SoA including but not limited to physical examination, vital signs, laboratory testing, PK assessments, and review of AEs and concomitant medications through Week 24.
  • Screening is performed no more than 4 weeks prior to the Day 1 visit and includes written informed consent, determination of eligibility, collection of demographics and medical history, physical examination, vital signs, laboratory tests, 12-lead ECG and other assessments per the SoA.
  • Adverse events related to screening activities are collected from the time of consent onwards; any other events occurring during the screening period are reported as medical history. All SAEs are collected from the time of consent onwards.
  • Screening viral serology parameters are as follows: active infection with HIV, HCV, and hepatitis Delta virus. Subjects who have positive HCV serology result may have HCV-RT PCR reflex testing to determine eligibility.
  • Chronic HBV infection will be determined at screening and is defined as the following: Positive serum HBsAg, HBV DNA, or HBeAg on 2 occasions at least 6 months apart based on previous or current laboratory documentation (any combination of these tests performed 6 months apart is acceptable).
  • Subjects with > 2-fold HBsAg reduction at Week 8 return to the clinical investigative site for in-person assessments per the SoA through Week 40 or until the reduction in HBsAg is ⁇ 2-fold relative to baseline at 2 consecutive collections, whichever occurs first.
  • the extended follow-up may be discontinued based on emerging data.
  • HBC34v35-MLNS-GAALIE is supplied as a lyophilized solid to be reconstituted with Sterile Water for Injection (USP) at a concentration of 150 mg/mL and administered as a SC injection or IV infusion.
  • USP Sterile Water for Injection
  • the unit dose is based on volume and administration method.
  • the drug product, as administered contains 20 mM Histidine, 7% sucrose, 0.02% PS80 at pH 6.
  • Placebo is a sterile, preservative-free normal saline 0.9% solution for IV infusion or SC injection
  • Part B Single Ascending Dose Study in Subjects with Chronic HBV Infection
  • subjects with chronic HBV infection receive a single dose of study drug.
  • the presence of the therapeutic target of HBC34-v35-MLNS-GAALIE, HBsAg, in subjects with chronic HBV infection alters the potential risks of HBC34-v35-MLNS-GAALIE administration. Potential risks include immune complex disease due to the formation of antigen- antibody complexes and hepatotoxicity due to elimination of infected hepatocytes via ADCC/ADCP and/or a “vaccinal effect”.
  • Part B will be conducted in subjects who are on NRTIs and have HBV DNA ⁇ 100 IU/mL at screening and have good hepatic reserve and low levels of hepatic inflammation, as determined by lack of fibrosis/cirrhosis and ALT ⁇ 2 c ULN.
  • Cohort 7b may be enrolled for the purpose of, but not limited to, collection and evaluation of immune response samples and hepatic fine needle aspirate samples at select sites when and where available. These dose levels are based on preclinical animal models and translational PK PD modeling that predict a significant HBsAg decline for doses in the range of 2 to 15 mg/kg. Details on the dose escalation plan for Part B can be found in Table 9. Table 9: Part B Dose Escalation Plan
  • SC subcutaneous Optional Part C: Single Ascending Dose Study in Subjects with Chronic HBV Infection
  • Part C is conducted after the safety, tolerability, and antiviral activity of HBC34-v35-MLNS-GAALIE has been established in HBeAg-negative subjects with HBsAg ⁇ 1000 IU/mL in Part B.
  • Part C consists of three optional dose level cohorts, with each evaluating a dose of up to 900 mg administered by SC injection. Table 10.
  • One or more of the optional cohorts in Part C may be enrolled for the purpose of, but not limited to, collection and evaluation of immune response samples and hepatic fine needle aspirate samples at select sites when and where available. Table 10: Part C Cohort Overview
  • a local tolerability assessment is performed per the Schedule of Assessments ( Figure for subjects receiving study drug by SC injection. Injection site(s) will be marked and mapped for later observation and should be documented. Injection site(s) should be monitored for pain/tendemess, swelling, redness, bruising, and pruritus.
  • the timing of local tolerability assessments for Part A is shown in Figures 15A-15C.
  • the timing of the local tolerability assessments for Parts B/C is shown in Figures 16A-16E.
  • urine is collected for drugs of abuse screening.
  • the panel includes amphetamines, cocaine, methadone, and opiates.
  • Free PK parameters of HBC34-v35-MLNS-GAALIE are computed using standard noncompartmental methods. Parameters include, but not be limited to, serum: Cma x , Ci ast , Tma x , Tiast, AUCin f , AUCiast, %AUC exp , ti / 2, lz, V z (IV only), CL (IV only), WF (SC only), and CL/F (SC only). Other parameters are calculated as necessary.
  • Free and total PK parameters of HBC34-v35-MLNS-GAALIE are computed using standard noncompartmental methods. Parameters include, but are not limited to, serum: Cma x , Ci ast , T max , Tiast, AUCin f , AUCiast, %AUC exp , ti / 2, lz, V F, and CL/F. Other parameters are calculated as necessary.
  • PK/pharmacodynamic analyses are conducted to explore exposure-response relationships between PK parameters and selected antiviral variables.
  • HBC34-v35-MLNS- GAALIE selected data relating to the antiviral activity of HBC34-v35-MLNS- GAALIE, such as HBsAg, anti-HBs, HBeAg, anti-HBe, HBV RNA, HBcrAg, and HBV DNA levels
  • HBsAg, anti-HBs, HBeAg, anti-HBe, HBV RNA, HBcrAg, and HBV DNA levels are summarized (n, mean, SD, median, Ql, Q3, minimum, and maximum) by cohort and study visit along with corresponding change from baseline.
  • Summaries (number and percentage of subjects) of HBsAg loss defined as undetectable HBsAg measured on 2 separate, consecutive occasions, at least 2 weeks apart) are provided by cohort and study visit.
  • Blood samples are collected for analysis of immunogenic responses to determine presence/absence and titers of anti-drug antibodies (ADA) as applicable, according to the time points defined in the Schedule of Assessments ( Figures 15A-16E). Samples are characterized for neutralizing potential of HBC34-v35-MLNS-GAALIE (NAb), as appropriate.
  • ADA anti-drug antibodies
  • assessment of screening viral parameters include: HBsAg, anti-HBs, HBeAg (qualitative), and HBV DNA.
  • HBsAg anti-HBs
  • HBeAg quantitative; should only be collected for Part C subjects who are HBeAg qualitative positive at screening
  • HBeAg quantitative; should only be collected for Part C subjects who are HBeAg qualitative positive at screening
  • anti-HBe HBV RNA
  • HBcrAg hepatitis B core-related antigen
  • HBV genome sequencing is attempted in subjects with confirmed HBV DNA breakthrough as defined by HBV DNA > 500 IU/mL measured at 2 consecutive study visits, or subjects who discontinue early from the study with HBV DNA > 500 IU/mL.
  • samples for resistance surveillance is collected at all study visits noted in the SOA. Samples collected for resistance surveillance may be used to perform additional viral analyses, including viral sequencing.
  • subjects may consent to optional sub-studies in which peripheral immune samples with or without hepatic immune samples (via fine-needle aspiration) will be collected at the timepoints outlined in Figures 15A-16E. These optional sub-studies and associated assessments are done when and where available at select sites.
  • FcyR Fc gamma Receptor
  • Blood samples for FcyR genotyping and immunoglobulin allotyping are collected at baseline for all subjects in Parts B and C to evaluate a possible association between Fc-gamma receptor polymorphisms or immunoglobulin allotype with antiviral activity of HBC34-v35-MLNS- GAALIE.
  • Activation of monocyte -derived (mo)DCs in the presence of immune complexes formed by HBC34-V 35 -MLN S GAALIE (HC SEQ ID NO.:91, LC SEQ ID NO.:93) or HBC34- V35 MLNS (HC SEQ ID NO.:92, LC SEQ ID NO.:93) and HBsAg in the serum of HBV+ patients (supplier: BioIVT), was tested.
  • ICs immune complexes
  • FBS Hy clone
  • non-essential amino acids 1%
  • Glutamine Glutamine
  • Pen/Strep 1% Pen/Strep
  • 1% Sodium Pyruvate 50mM b-mercaptoethanol
  • 50 ng/mL GM-CSF Miltenyi
  • lOOOU/mL IL-4 R&D
  • HBsAg alone diluted to final 250 IU/ml of two patient sera at 1890 and 4460 IU/ml
  • ICs of HBsAg and HBC34-v35-MLNS or HBC34- v35-MLNS_GAALIE mAbs at 20-100 pg/ml
  • Reagents were tested to be endotoxin free. Surface expression of co-stimulatory markers CD83 and CD86 and HLA-DR was measured via flow cytometry.
  • the levels of ten (10) human proinflammatory cytokines were measured using the Meso Scale Diagnostics (MSD) V-PLEX Proinflammatory Panel 1 Human Kit. Culture medium was used as a negative control. LPS (Sigma, 100 ng/ml) served as positive control. Data are shown in Figures 20-24B. Immune complexes (ICs) of HBsAg with HBC34-v35- MLNS-GAALIE induced upregulation of co-stimuatory markers CD83 and CD86, as well as HLA-DR, on the surface of moDCs.
  • ICs Immune complexes

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Virology (AREA)
  • Molecular Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Communicable Diseases (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Oncology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2020/048649 2019-08-29 2020-08-28 Antibody compositions and methods for treating hepatitis b virus infection Ceased WO2021042000A1 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
US17/637,605 US20220380441A1 (en) 2019-08-29 2020-08-28 Antibody compositions and methods for treating hepatitis b virus infection
EP20771699.4A EP4021578A1 (en) 2019-08-29 2020-08-28 Antibody compositions and methods for treating hepatitis b virus infection
CN202080075610.1A CN114630680B (zh) 2019-08-29 2020-08-28 用于治疗乙型肝炎病毒感染的抗体组合物和方法
JP2022513208A JP2022545920A (ja) 2019-08-29 2020-08-28 B型肝炎ウイルス感染を処置するための抗体組成物および方法
CA3152511A CA3152511A1 (en) 2019-08-29 2020-08-28 Antibody compositions and methods for treating hepatitis b virus infection
BR112022003698A BR112022003698A2 (pt) 2019-08-29 2020-08-28 Método de tratamento de uma infecção pelo vírus da hepatite b e composição farmacêutica
NZ785788A NZ785788B2 (en) 2020-08-28 Antibody compositions and methods for treating hepatitis b virus infection
KR1020227010266A KR20220063188A (ko) 2019-08-29 2020-08-28 B형 간염 바이러스 감염을 치료하기 위한 항체 조성물 및 방법
AU2020336980A AU2020336980B2 (en) 2019-08-29 2020-08-28 Antibody compositions and methods for treating hepatitis B virus infection
MX2022002231A MX2022002231A (es) 2019-08-29 2020-08-28 Composiciones de anticuerpos y metodos para tratar la infeccion por el virus de la hepatitis b.
IL290923A IL290923A (en) 2019-08-29 2022-02-27 Antibody preparations and methods for treating hepatitis b virus infection
JP2025129247A JP2025185263A (ja) 2019-08-29 2025-08-01 B型肝炎ウイルス感染を処置するための抗体組成物および方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962893742P 2019-08-29 2019-08-29
US62/893,742 2019-08-29

Publications (1)

Publication Number Publication Date
WO2021042000A1 true WO2021042000A1 (en) 2021-03-04

Family

ID=72473989

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/048649 Ceased WO2021042000A1 (en) 2019-08-29 2020-08-28 Antibody compositions and methods for treating hepatitis b virus infection

Country Status (11)

Country Link
US (1) US20220380441A1 (https=)
EP (1) EP4021578A1 (https=)
JP (2) JP2022545920A (https=)
KR (1) KR20220063188A (https=)
CN (1) CN114630680B (https=)
AU (1) AU2020336980B2 (https=)
BR (1) BR112022003698A2 (https=)
CA (1) CA3152511A1 (https=)
IL (1) IL290923A (https=)
MX (1) MX2022002231A (https=)
WO (1) WO2021042000A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022164805A1 (en) * 2021-01-26 2022-08-04 Vir Biotechnology, Inc. Compositions and methods for treating hepatitis b virus infection
WO2023230439A1 (en) * 2022-05-23 2023-11-30 Vir Biotechnology, Inc. Fc-engineered hepatitis b virus neutralizing antibodies and uses thereof
US12404318B2 (en) 2018-12-20 2025-09-02 Vir Biotechnology, Inc. Combination HBV therapy

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FI3898668T3 (fi) 2018-12-19 2023-11-28 Humabs Biomed Sa B-hepatiittivirusta neutraloivia vasta-aineita ja niiden käyttöjä

Citations (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3766162A (en) 1971-08-24 1973-10-16 Hoffmann La Roche Barbituric acid antigens and antibodies specific therefor
US3791932A (en) 1971-02-10 1974-02-12 Akzona Inc Process for the demonstration and determination of reaction components having specific binding affinity for each other
US3817837A (en) 1971-05-14 1974-06-18 Syva Corp Enzyme amplification assay
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4233402A (en) 1978-04-05 1980-11-11 Syva Company Reagents and method employing channeling
US4495285A (en) 1981-10-30 1985-01-22 Kimihiro Shimizu Plasminogen activator derivatives
US4609546A (en) 1982-06-24 1986-09-02 Japan Chemical Research Co., Ltd. Long-acting composition
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4766106A (en) 1985-06-26 1988-08-23 Cetus Corporation Solubilization of proteins for pharmaceutical compositions using polymer conjugation
US4831175A (en) 1986-09-05 1989-05-16 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Backbone polysubstituted chelates for forming a metal chelate-protein conjugate
US5595721A (en) 1993-09-16 1997-01-21 Coulter Pharmaceutical, Inc. Radioimmunotherapy of lymphoma using anti-CD20
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
WO2000052473A2 (en) 1999-03-01 2000-09-08 Idec Pharmaceuticals Corporation Radiolabeling kit and binding assay
WO2000052031A2 (en) 1999-03-01 2000-09-08 Idec Pharmaceuticals Corporation Kit for radiolabeling proteins with yttrium-90
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
WO2004076677A2 (en) 2003-02-26 2004-09-10 Institute For Research In Biomedicine Monoclonal antibody production by ebv transformation of b cells
US20050163783A1 (en) 2003-06-27 2005-07-28 Biogen Idec Ma Inc. Purification and preferential synthesis of binding molecules
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
WO2008143954A2 (en) 2007-05-14 2008-11-27 Biogen Idec Ma Inc. Single-chain fc (scfc) regions, binding polypeptides comprising same, and methods related thereto
WO2010046775A2 (en) 2008-10-22 2010-04-29 Institute For Research In Biomedicine Methods for producing antibodies from plasma cells
WO2010084158A1 (en) 2009-01-21 2010-07-29 Monoclonal Antibodies Therapeutics Anti-cd 160 monoclonal antibodies and uses thereof
WO2013025779A1 (en) 2011-08-15 2013-02-21 Amplimmune, Inc. Anti-b7-h4 antibodies and their uses
WO2016040724A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anti-b7-h4 antibodies and immunoconjugates
WO2016054638A1 (en) 2014-10-03 2016-04-07 Dana-Farber Cancer Institute, Inc. Glucocorticoid-induced tumor necrosis factor receptor (gitr) antibodies and methods of use thereof
WO2016134333A1 (en) 2015-02-19 2016-08-25 Compugen Ltd. Anti-pvrig antibodies and methods of use
WO2017021526A1 (en) 2015-08-05 2017-02-09 Amgen Research (Munich) Gmbh Immune-checkpoint inhibitors for use in the treatment of blood-borne cancers
US9574000B2 (en) 2012-12-19 2017-02-21 Medimmune, Llc Anti-human B7-H4 antibodies and their uses
WO2017060504A1 (en) 2015-10-07 2017-04-13 Humabs Biomed Sa Antibodies that potently neutralize hepatitis b virus and uses thereof
WO2019125846A1 (en) * 2017-12-19 2019-06-27 The Rockefeller University HUMAN IgG Fc DOMAIN VARIANTS WITH IMPROVED EFFECTOR FUNCTION
WO2020132091A2 (en) * 2018-12-19 2020-06-25 Humabs Biomed Sa Antibodies that neutralize hepatitis b virus and uses thereof
WO2020132346A1 (en) * 2018-12-20 2020-06-25 Vir Biotechnology, Inc. Combination hbv therapy

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JO3000B1 (ar) * 2004-10-20 2016-09-05 Genentech Inc مركبات أجسام مضادة .

Patent Citations (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3791932A (en) 1971-02-10 1974-02-12 Akzona Inc Process for the demonstration and determination of reaction components having specific binding affinity for each other
US3817837A (en) 1971-05-14 1974-06-18 Syva Corp Enzyme amplification assay
US3766162A (en) 1971-08-24 1973-10-16 Hoffmann La Roche Barbituric acid antigens and antibodies specific therefor
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4233402A (en) 1978-04-05 1980-11-11 Syva Company Reagents and method employing channeling
US4495285A (en) 1981-10-30 1985-01-22 Kimihiro Shimizu Plasminogen activator derivatives
US4495285B1 (https=) 1981-10-30 1986-09-23 Nippon Chemiphar Co
US4609546A (en) 1982-06-24 1986-09-02 Japan Chemical Research Co., Ltd. Long-acting composition
US4766106A (en) 1985-06-26 1988-08-23 Cetus Corporation Solubilization of proteins for pharmaceutical compositions using polymer conjugation
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4831175A (en) 1986-09-05 1989-05-16 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Backbone polysubstituted chelates for forming a metal chelate-protein conjugate
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6417429B1 (en) 1989-10-27 2002-07-09 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5595721A (en) 1993-09-16 1997-01-21 Coulter Pharmaceutical, Inc. Radioimmunotherapy of lymphoma using anti-CD20
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
WO2000052031A2 (en) 1999-03-01 2000-09-08 Idec Pharmaceuticals Corporation Kit for radiolabeling proteins with yttrium-90
WO2000052473A2 (en) 1999-03-01 2000-09-08 Idec Pharmaceuticals Corporation Radiolabeling kit and binding assay
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
WO2004076677A2 (en) 2003-02-26 2004-09-10 Institute For Research In Biomedicine Monoclonal antibody production by ebv transformation of b cells
US20050163783A1 (en) 2003-06-27 2005-07-28 Biogen Idec Ma Inc. Purification and preferential synthesis of binding molecules
WO2008143954A2 (en) 2007-05-14 2008-11-27 Biogen Idec Ma Inc. Single-chain fc (scfc) regions, binding polypeptides comprising same, and methods related thereto
WO2010046775A2 (en) 2008-10-22 2010-04-29 Institute For Research In Biomedicine Methods for producing antibodies from plasma cells
WO2010084158A1 (en) 2009-01-21 2010-07-29 Monoclonal Antibodies Therapeutics Anti-cd 160 monoclonal antibodies and uses thereof
WO2013025779A1 (en) 2011-08-15 2013-02-21 Amplimmune, Inc. Anti-b7-h4 antibodies and their uses
US9574000B2 (en) 2012-12-19 2017-02-21 Medimmune, Llc Anti-human B7-H4 antibodies and their uses
WO2016040724A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anti-b7-h4 antibodies and immunoconjugates
WO2016054638A1 (en) 2014-10-03 2016-04-07 Dana-Farber Cancer Institute, Inc. Glucocorticoid-induced tumor necrosis factor receptor (gitr) antibodies and methods of use thereof
WO2016134333A1 (en) 2015-02-19 2016-08-25 Compugen Ltd. Anti-pvrig antibodies and methods of use
WO2017021526A1 (en) 2015-08-05 2017-02-09 Amgen Research (Munich) Gmbh Immune-checkpoint inhibitors for use in the treatment of blood-borne cancers
WO2017060504A1 (en) 2015-10-07 2017-04-13 Humabs Biomed Sa Antibodies that potently neutralize hepatitis b virus and uses thereof
WO2019125846A1 (en) * 2017-12-19 2019-06-27 The Rockefeller University HUMAN IgG Fc DOMAIN VARIANTS WITH IMPROVED EFFECTOR FUNCTION
WO2020132091A2 (en) * 2018-12-19 2020-06-25 Humabs Biomed Sa Antibodies that neutralize hepatitis b virus and uses thereof
WO2020132346A1 (en) * 2018-12-20 2020-06-25 Vir Biotechnology, Inc. Combination hbv therapy

Non-Patent Citations (68)

* Cited by examiner, † Cited by third party
Title
"Controlled Drug Delivery", 1987, MARCEL DEKKER, INC, article "Antibodies for Drug Delivery", pages: 623 - 653
"Genbank", Database accession no. FJ899792
"GenBank", Database accession no. FJ899792.1
"Gene Expression Systems", 1999, ACADEMIC PRESS
"Monoclonal Antibodies for Cancer Detection and Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, and Future Prospective of the Therapeutic Use of Radiolabeled Antibody in Cancer Therapy", pages: 303 - 316
AHMED ET AL., J. STRUC. BIOL., vol. 194, no. 1, 2016, pages 78
ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402
AMON ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, INC, article "Monoclonal Antibodies for Immunotargeting of Drugs in Cancer Therapy", pages: 243 - 256
ARMOUR, K. L. ET AL., EUR. J. IMMUNOL., vol. 29, 1999, pages 2613 - 2624
BANKS DOUGLAS D ET AL: "Removal of cysteinylation from an unpaired sulfhydryl in the variable region of a recombinant monoclonal IgG1 antibody improves homogeneity, stability, and biological activity", JOURNAL OF PHARMACEUTICAL SCIENCES, AMERICAN CHEMICAL SOCIETY AND AMERICAN PHARMACEUTICAL ASSOCIATION, US, vol. 97, no. 2, 1 February 2008 (2008-02-01), pages 775 - 790, XP002539396, ISSN: 0022-3549, DOI: 10.1002/JPS.21014 *
BIOINFORMATICS, vol. 15, 2016, pages 298 - 300
BOERNER, P. ET AL., J. IMMUNOL., vol. 147, 1991, pages 86 - 95
BRINKMANNKONTERMANN, MABS, vol. 9, no. 2, 2017, pages 182 - 212
BRUGGEMANN, M. ET AL., YEAR IMMUNOL, vol. 7, 1993, pages 3340
BRUHNS ET AL., BLOOD, vol. 113, 2009, pages 3716 - 3725
BRUNS M. ET AL., J VIROL, vol. 72, no. 2, 1998, pages 1462 - 1468
BURTON, D. R., MOL. IMMUNOL., vol. 22, 1985, pages 161 - 206
CAPEL, P. J. ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34
CHISARI FVISOGAWA MWIELAND SF, PATHOLOGIE BIOLOGIE, vol. 58, 2010, pages 258 - 66
CHU, S. ET AL.: "Accelerated Clearance of IgE In Chimpanzees Is Mediated By Xmab7195, An Fc-Engineered Antibody With Enhanced Affinity For Inhibitory Receptor FcyRIIb", AM J RESPIR CRIT, 2014
CHU, S. Y. ET AL.: "Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD 19 and FcgammaRIIb with Fc-engineered antibodies", MOLECULAR IMMUNOLOGY, vol. 45, 2008, pages 3926 - 3933, XP002498116, DOI: 10.1016/j.molimm.2008.06.027
DANGAJ ET AL., CANCER RES, vol. 73, 2013, pages 4820
DAVIS ET AL., PROTEIN ENG. DES. SEL., vol. 23, no. 4, 2010, pages 195
DE HAAS, M. ET AL., J LAB. CLIN. MED., vol. 126, 1995, pages 330 - 341
DELILLORAVETCH, CELL, vol. 161, no. 5, 2015, pages 1035 - 1045
DUNCAN, A. R.WINTER, G., NATURE, vol. 332, 1988, pages 738 - 740
FATTOVICH GGIUSTINA GCHRISTENSEN EPANTALENA MZAGNI IREALDI GSCHALM SW, INFLUENCE OF HEPATITIS DELTA VIRUS INFECTION ON MORBIDITY AND MORTALITY IN COMPENSATED CIRRHOSIS TYPE B. GUT., vol. 46, no. 3, March 2000 (2000-03-01), pages 420 - 6
GALUN, E. ET AL., HEPATOLOGY
GANESAN, L. P. ET AL.: "FcyRIIb on liver sinusoidal endothelium clears small immune complexes", JOURNAL OF IMMUNOLOGY, vol. 189, 2012, pages 4981 - 4988, XP002724347, DOI: 10.4049/jimmunol.1202017
GESSNER, J. E. ET AL., ANN. HEMATOL., vol. 76, 1998, pages 231 - 248
HOLLIGERHUDSON, NATURE BIOTECHNOLOGY, vol. 9, 2005, pages 1126 - 1136
HOOGENBOOM, H. R.WINTER, G., J. MOL. BIOL., vol. 227, 1992, pages 381 - 388
HSIEH, Y.-T. ET AL., JOURNAL OF IMMUNOLOGICAL METHODS, vol. 441, no. C, pages 56 - 66
JAKOBOVITS, A. ET AL., NATURE, vol. 362, 1993, pages 255 - 258
JAKOBOVITS, A. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551 - 2555
JAOUDE GASUREAU C, JOURNAL OF VIROLOGY, vol. 79, 2005, pages 10460 - 6
JEFFERISLEFRANC, MABS, vol. 7, no. 4, 2009, pages 1 - 7
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", U.S. DEPT. HEALTH AND HUMAN SERVICES, 1983
LEFRANC, M.-P. ET AL., NUCLEIC ACIDS RES, vol. 37, 2009, pages D1006 - D1012, Retrieved from the Internet <URL:www.imgt.org>
LI ET AL., NAT. BIOTECH., vol. 24, 2006, pages 210 - 215
LIANG TJBLOCK TMMCMAHON BJGHANY MGURBAN SGUO JTLOCAMINI SZOULIM FCHANG KMLOK AS: "Present and future therapies of hepatitis B: From discovery to cure", HEPATOLOGY, 3 August 2015 (2015-08-03)
LIU ET AL., BLOOD, vol. 115, 2010, pages 3520 - 30
MACNAB ET AL., BRITISH JOURNAL OF CANCER, vol. 34, no. 5, 1976
MARKS, J. D. ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
MAUTINO ET AL., AMERICAN ASSOCIATION FOR CANCER RESEARCH 104TH ANNUAL MEETING 2013, 6 April 2013 (2013-04-06)
PALMBERGER ET AL., J. BIOTECHNOL., vol. 153, no. 3-4, 2011, pages 160 - 166
PLUCKTHUN, A., BIO/TECHNOLOGY, vol. 9, 1991, pages 545 - 551
RATTAN ET AL.: "Protein Synthesis: Post-translational Modifications and Aging", ANN NY ACAD SCI, vol. 663, 1992, pages 48 - 62
RAVETCH, J. V.KINET, J. P., ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492
SALISSE J.SUREAU C., JOURNAL OF VIROLOGY, vol. 83, 2009, pages 9321 - 9328
SCHOLTEN ET AL., CLIN. IMMUNOL., vol. 119, 2006, pages 135 - 145
SEE GERNGROSS, NAT. BIOTECH., vol. 22, 2004, pages 1409 - 1414
SEIFTER ET AL.: "Analysis for protein modifications and nonprotein cofactors", METH. ENZYMOL., vol. 182, 1990, pages 626 - 646, XP009082492, DOI: 10.1016/0076-6879(90)82049-8
SHIELDS, R. L. ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 6591 - 6604
SPIESS ET AL., MOL. IMMUNOL., vol. 67, no. 2, 2015, pages 95
SUNBUL M., WORLD J GASTROENTEROL, vol. 20, no. 18, 2014, pages 5427 - 5434
TERENTIS ET AL., BIOCHEM., vol. 49, 2010, pages 591 - 600
THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 158
THORPE ET AL.: "Monoclonal Antibodies '84: Biological and Clinical Applications", 1985, KURTIS, article "Antibody Carriers of Cytotoxic Agents in Cancer Therapy: A Review", pages: 475 - 506
TRAGGIAI E. ET AL., NAT MED, vol. 10, no. 8, 2004, pages 871 - 5
TRAGGIAI EBECKER SSUBBARAO KKOLESNIKOVA LUEMATSU YGISMONDO MRMURPHY BRRAPPUOLI RLANZAVECCHIA A: "An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus", NAT MED., vol. 10, no. 8, 2004, pages 871 - 5, XP037065944, DOI: 10.1038/nm1080
URLAUB ET AL., PNAS, vol. 77, 1980, pages 4216
VAN DE WINKEL, J. G.ANDERSON, C. L., J. LEUKOC. BIOL., vol. 49, 1991, pages 511 - 524
VAN DIJK, M. A.VAN DE WINKEL, J. G., CURR. OPIN. CHEM. BIOL., vol. 5, 2001, pages 368 - 374
WARD, E. S.GHETIE, V., THER. IMMUNOL., vol. 2, 1995, pages 77 - 94
WINES, B.D. ET AL., J. IMMUNOL., vol. 164, 2000, pages 5313 - 5318
YAZAKIWU: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, TOTOWA, pages: 255 - 268
ZAIGHAM ABBAS: "Minaam Abbas Management of hepatitis delta: Need for novel therapeutic Options", WORLD J GASTROENTEROL, vol. 21, no. 32, 28 August 2015 (2015-08-28), pages 9461 - 9465

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12404318B2 (en) 2018-12-20 2025-09-02 Vir Biotechnology, Inc. Combination HBV therapy
WO2022164805A1 (en) * 2021-01-26 2022-08-04 Vir Biotechnology, Inc. Compositions and methods for treating hepatitis b virus infection
WO2023230439A1 (en) * 2022-05-23 2023-11-30 Vir Biotechnology, Inc. Fc-engineered hepatitis b virus neutralizing antibodies and uses thereof

Also Published As

Publication number Publication date
JP2022545920A (ja) 2022-11-01
MX2022002231A (es) 2022-03-22
CN114630680B (zh) 2024-10-11
CA3152511A1 (en) 2021-03-04
BR112022003698A2 (pt) 2022-05-24
IL290923A (en) 2022-04-01
US20220380441A1 (en) 2022-12-01
CN114630680A (zh) 2022-06-14
KR20220063188A (ko) 2022-05-17
JP2025185263A (ja) 2025-12-19
NZ785788A (en) 2025-09-26
AU2020336980B2 (en) 2025-07-10
AU2020336980A1 (en) 2022-03-24
EP4021578A1 (en) 2022-07-06

Similar Documents

Publication Publication Date Title
US20250353900A1 (en) Antibodies that neutralize hepatitis b virus and uses thereof
AU2020336980B2 (en) Antibody compositions and methods for treating hepatitis B virus infection
US20240092872A1 (en) Compositions and methods for treating hepatitis b virus infection
CA3121004C (en) Antibodies that neutralize hepatitis b virus and uses thereof
HK40073510B (zh) 用於治疗乙型肝炎病毒感染的抗体组合物和方法
CN117042797A (zh) 用于治疗乙型肝炎病毒感染的组合物和方法
HK40073510A (en) Antibody compositions and methods for treating hepatitis b virus infection
OA20238A (en) Antibodies that neutralize hepatitis B virus and uses thereof.
EA046709B1 (ru) Антитела, нейтрализирующие вирус гепатита в, и их применение
RU2812910C2 (ru) Антитела к cd38 и комбинации с антителами к cd3 и cd28
HK40056051A (en) Antibodies that neutralize hepatitis b virus and uses thereof
HK40056051B (zh) 中和乙型肝炎病毒的抗体和其用途
TW202613160A (zh) 中和b型肝炎病毒之抗體和彼之用途

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20771699

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3152511

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022513208

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 290923

Country of ref document: IL

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022003698

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2020336980

Country of ref document: AU

Date of ref document: 20200828

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20227010266

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2020771699

Country of ref document: EP

Effective date: 20220329

ENP Entry into the national phase

Ref document number: 112022003698

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20220225

WWD Wipo information: divisional of initial pct application

Ref document number: 824602

Country of ref document: NZ