OA20238A - Antibodies that neutralize hepatitis B virus and uses thereof. - Google Patents
Antibodies that neutralize hepatitis B virus and uses thereof. Download PDFInfo
- Publication number
- OA20238A OA20238A OA1202100281 OA20238A OA 20238 A OA20238 A OA 20238A OA 1202100281 OA1202100281 OA 1202100281 OA 20238 A OA20238 A OA 20238A
- Authority
- OA
- OAPI
- Prior art keywords
- antibody
- hbsag
- binding fragment
- antigen binding
- amino acid
- Prior art date
Links
- 102000004965 antibodies Human genes 0.000 title claims abstract description 471
- 108090001123 antibodies Proteins 0.000 title claims abstract description 471
- 241000700721 Hepatitis B virus Species 0.000 title claims abstract description 123
- 230000027455 binding Effects 0.000 claims abstract description 363
- 239000000427 antigen Substances 0.000 claims abstract description 266
- 102000038129 antigens Human genes 0.000 claims abstract description 265
- 108091007172 antigens Proteins 0.000 claims abstract description 265
- 102000037240 fusion proteins Human genes 0.000 claims abstract description 83
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 83
- 241000724709 Hepatitis delta virus Species 0.000 claims abstract description 57
- 208000002672 Hepatitis B Diseases 0.000 claims abstract description 50
- 201000009910 diseases by infectious agent Diseases 0.000 claims abstract description 40
- 230000000890 antigenic Effects 0.000 claims abstract description 34
- 208000005331 Hepatitis D Diseases 0.000 claims abstract description 23
- 238000003745 diagnosis Methods 0.000 claims abstract description 12
- 150000001413 amino acids Chemical group 0.000 claims description 169
- 235000001014 amino acid Nutrition 0.000 claims description 155
- 239000000203 mixture Substances 0.000 claims description 151
- 230000035772 mutation Effects 0.000 claims description 111
- 229920001184 polypeptide Polymers 0.000 claims description 86
- 239000008194 pharmaceutical composition Substances 0.000 claims description 43
- 230000002401 inhibitory effect Effects 0.000 claims description 39
- 230000014509 gene expression Effects 0.000 claims description 37
- 229920000023 polynucleotide Polymers 0.000 claims description 36
- 239000002157 polynucleotide Substances 0.000 claims description 36
- 108010045030 monoclonal antibodies Proteins 0.000 claims description 35
- 102000005614 monoclonal antibodies Human genes 0.000 claims description 35
- 238000006467 substitution reaction Methods 0.000 claims description 33
- 239000003112 inhibitor Substances 0.000 claims description 32
- 238000000338 in vitro Methods 0.000 claims description 30
- 108020004705 Codon Proteins 0.000 claims description 27
- 239000002253 acid Substances 0.000 claims description 21
- 230000035693 Fab Effects 0.000 claims description 20
- 210000004369 Blood Anatomy 0.000 claims description 16
- 210000004185 Liver Anatomy 0.000 claims description 16
- 239000008280 blood Substances 0.000 claims description 16
- 229920003013 deoxyribonucleic acid Polymers 0.000 claims description 16
- 239000000556 agonist Substances 0.000 claims description 15
- 230000002829 reduced Effects 0.000 claims description 15
- 102100014838 FCGRT Human genes 0.000 claims description 14
- 101710003435 FCGRT Proteins 0.000 claims description 14
- 230000002708 enhancing Effects 0.000 claims description 13
- DHMQDGOQFOQNFH-UHFFFAOYSA-N glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 12
- 230000002147 killing Effects 0.000 claims description 12
- 238000004519 manufacturing process Methods 0.000 claims description 12
- QDGZDCVAUDNJFG-FXQIFTODSA-N Entecavir Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@H]1C[C@H](O)[C@@H](CO)C1=C QDGZDCVAUDNJFG-FXQIFTODSA-N 0.000 claims description 11
- 102000014150 Interferons Human genes 0.000 claims description 11
- 108010050904 Interferons Proteins 0.000 claims description 11
- 239000000969 carrier Substances 0.000 claims description 11
- 235000018417 cysteine Nutrition 0.000 claims description 11
- 229960000980 entecavir Drugs 0.000 claims description 11
- 229940079322 interferon Drugs 0.000 claims description 11
- 208000000419 Chronic Hepatitis B Diseases 0.000 claims description 10
- 241000124008 Mammalia Species 0.000 claims description 10
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 claims description 10
- 229940121650 immune-checkpoint protein inhibitors Drugs 0.000 claims description 10
- 230000003472 neutralizing Effects 0.000 claims description 10
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 9
- 235000004279 alanine Nutrition 0.000 claims description 9
- 108009000423 Hepatitis B infection Proteins 0.000 claims description 8
- 102000006992 Interferon-alpha Human genes 0.000 claims description 8
- 108010047761 Interferon-alpha Proteins 0.000 claims description 8
- XUJNEKJLAYXESH-REOHCLBHSA-N L-cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 claims description 8
- 102100001957 SLC10A1 Human genes 0.000 claims description 7
- 108091006526 SLC10A1 Proteins 0.000 claims description 7
- 230000001976 improved Effects 0.000 claims description 7
- 230000004936 stimulating Effects 0.000 claims description 7
- JTEGQNOMFQHVDC-NKWVEPMBSA-N 4-amino-1-[(2R,5S)-2-(hydroxymethyl)-1,3-oxathiolan-5-yl]-1,2-dihydropyrimidin-2-one Chemical compound O=C1N=C(N)C=CN1[C@H]1O[C@@H](CO)SC1 JTEGQNOMFQHVDC-NKWVEPMBSA-N 0.000 claims description 6
- 239000004471 Glycine Substances 0.000 claims description 6
- 229960001627 Lamivudine Drugs 0.000 claims description 6
- 229960005486 vaccines Drugs 0.000 claims description 6
- SUPKOOSCJHTBAH-UHFFFAOYSA-N 2-(6-aminopurin-9-yl)ethoxymethylphosphonic acid Chemical compound NC1=NC=NC2=C1N=CN2CCOCP(O)(O)=O SUPKOOSCJHTBAH-UHFFFAOYSA-N 0.000 claims description 5
- 102000003996 Interferon beta Human genes 0.000 claims description 5
- 108090000467 Interferon beta Proteins 0.000 claims description 5
- IQFYYKKMVGJFEH-CSMHCCOUSA-N Telbivudine Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1O[C@@H](CO)[C@H](O)C1 IQFYYKKMVGJFEH-CSMHCCOUSA-N 0.000 claims description 5
- SGOIRFVFHAKUTI-ZCFIWIBFSA-N Tenofovir Chemical compound N1=CN=C2N(C[C@@H](C)OCP(O)(O)=O)C=NC2=C1N SGOIRFVFHAKUTI-ZCFIWIBFSA-N 0.000 claims description 5
- 229960004556 Tenofovir Drugs 0.000 claims description 5
- 229960001997 adefovir Drugs 0.000 claims description 5
- 229960005311 telbivudine Drugs 0.000 claims description 5
- 239000003085 diluting agent Substances 0.000 claims description 3
- 238000001631 haemodialysis Methods 0.000 claims description 2
- 230000000322 hemodialysis Effects 0.000 claims description 2
- 230000001177 retroviral Effects 0.000 claims description 2
- 101700052274 HBEAG Proteins 0.000 claims 5
- MTCFGRXMJLQNBG-UWTATZPHSA-N D-serine Chemical compound OC[C@@H](N)C(O)=O MTCFGRXMJLQNBG-UWTATZPHSA-N 0.000 claims 1
- 239000000546 pharmaceutic aid Substances 0.000 claims 1
- 150000007523 nucleic acids Chemical class 0.000 abstract description 91
- 108020004707 nucleic acids Proteins 0.000 abstract description 76
- 230000000069 prophylaxis Effects 0.000 abstract description 7
- 210000004027 cells Anatomy 0.000 description 261
- 125000003275 alpha amino acid group Chemical group 0.000 description 137
- 102000024070 binding proteins Human genes 0.000 description 123
- 108091007650 binding proteins Proteins 0.000 description 123
- 102000004169 proteins and genes Human genes 0.000 description 70
- 108090000623 proteins and genes Proteins 0.000 description 70
- 235000018102 proteins Nutrition 0.000 description 66
- 238000004166 bioassay Methods 0.000 description 53
- 108090001095 Immunoglobulin G Proteins 0.000 description 48
- 102000004851 Immunoglobulin G Human genes 0.000 description 48
- 230000004913 activation Effects 0.000 description 40
- 210000000822 Killer Cells, Natural Anatomy 0.000 description 36
- 230000000694 effects Effects 0.000 description 29
- 238000002838 bio layer interferometry Methods 0.000 description 23
- 230000005591 charge neutralization Effects 0.000 description 23
- 230000001264 neutralization Effects 0.000 description 23
- 238000006386 neutralization reaction Methods 0.000 description 23
- 102000018358 Immunoglobulins Human genes 0.000 description 21
- 108060003951 Immunoglobulins Proteins 0.000 description 21
- UIIMBOGNXHQVGW-UHFFFAOYSA-M buffer Substances [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 20
- 239000003153 chemical reaction reagent Substances 0.000 description 20
- 229920001850 Nucleic acid sequence Polymers 0.000 description 19
- 238000004020 luminiscence type Methods 0.000 description 19
- -1 Μ-HBsAg Proteins 0.000 description 19
- 150000001875 compounds Chemical class 0.000 description 18
- 238000000034 method Methods 0.000 description 18
- 238000003860 storage Methods 0.000 description 18
- 125000000539 amino acid group Chemical group 0.000 description 17
- 239000002609 media Substances 0.000 description 17
- 230000001404 mediated Effects 0.000 description 17
- 101700045135 HBSAG Proteins 0.000 description 16
- 108091006028 chimera Proteins 0.000 description 16
- 230000003612 virological Effects 0.000 description 16
- 241000700605 Viruses Species 0.000 description 15
- 230000004048 modification Effects 0.000 description 15
- 238000006011 modification reaction Methods 0.000 description 15
- 102000005962 receptors Human genes 0.000 description 15
- 108020003175 receptors Proteins 0.000 description 15
- 108010087819 Fc receptors Proteins 0.000 description 14
- 102000009109 Fc receptors Human genes 0.000 description 14
- 230000000875 corresponding Effects 0.000 description 14
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 14
- 230000037250 Clearance Effects 0.000 description 13
- 238000002965 ELISA Methods 0.000 description 13
- 230000035512 clearance Effects 0.000 description 13
- 239000003814 drug Substances 0.000 description 13
- 229960000060 monoclonal antibodies Drugs 0.000 description 13
- 229960000070 antineoplastic Monoclonal antibodies Drugs 0.000 description 12
- 201000010099 disease Diseases 0.000 description 12
- 239000002245 particle Substances 0.000 description 12
- 210000001519 tissues Anatomy 0.000 description 12
- 102000033180 ERVK-6 Human genes 0.000 description 11
- 201000011510 cancer Diseases 0.000 description 11
- 238000010494 dissociation reaction Methods 0.000 description 11
- 230000005593 dissociations Effects 0.000 description 11
- 101710038044 ERVK-6 Proteins 0.000 description 10
- 101710027967 ERVW-1 Proteins 0.000 description 10
- 101710023234 Segment 5 Proteins 0.000 description 10
- 101700028070 VPX Proteins 0.000 description 10
- 239000012131 assay buffer Substances 0.000 description 10
- 239000012537 formulation buffer Substances 0.000 description 10
- 238000010186 staining Methods 0.000 description 10
- 239000000126 substance Substances 0.000 description 10
- 238000001890 transfection Methods 0.000 description 10
- MTCFGRXMJLQNBG-REOHCLBHSA-N L-serine Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 9
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 9
- 239000005089 Luciferase Substances 0.000 description 9
- 108060001084 Luciferase family Proteins 0.000 description 9
- 238000010367 cloning Methods 0.000 description 9
- 230000002068 genetic Effects 0.000 description 9
- 230000002163 immunogen Effects 0.000 description 9
- 238000002347 injection Methods 0.000 description 9
- 239000007924 injection Substances 0.000 description 9
- 238000003780 insertion Methods 0.000 description 9
- 230000003993 interaction Effects 0.000 description 9
- 239000007788 liquid Substances 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- 210000003719 B-Lymphocytes Anatomy 0.000 description 8
- 102000004190 Enzymes Human genes 0.000 description 8
- 108090000790 Enzymes Proteins 0.000 description 8
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 8
- 210000004693 NK cell Anatomy 0.000 description 8
- 239000002202 Polyethylene glycol Substances 0.000 description 8
- 210000001744 T-Lymphocytes Anatomy 0.000 description 8
- 239000004473 Threonine Substances 0.000 description 8
- 229940079593 drugs Drugs 0.000 description 8
- 238000002474 experimental method Methods 0.000 description 8
- 238000000684 flow cytometry Methods 0.000 description 8
- 230000002458 infectious Effects 0.000 description 8
- 238000003670 luciferase enzyme activity assay Methods 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 229920001223 polyethylene glycol Polymers 0.000 description 8
- 238000003752 polymerase chain reaction Methods 0.000 description 8
- 230000001225 therapeutic Effects 0.000 description 8
- 238000002560 therapeutic procedure Methods 0.000 description 8
- 241000283707 Capra Species 0.000 description 7
- 206010073071 Hepatocellular carcinoma Diseases 0.000 description 7
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 7
- 102000003855 L-lactate dehydrogenases Human genes 0.000 description 7
- 108091000084 L-lactate dehydrogenases Proteins 0.000 description 7
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 7
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 7
- 210000004011 Plasma Cells Anatomy 0.000 description 7
- 238000004113 cell culture Methods 0.000 description 7
- 238000002955 isolation Methods 0.000 description 7
- 102000004196 processed proteins & peptides Human genes 0.000 description 7
- 108090000765 processed proteins & peptides Proteins 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 239000011780 sodium chloride Substances 0.000 description 7
- 230000002269 spontaneous Effects 0.000 description 7
- 229920000160 (ribonucleotides)n+m Polymers 0.000 description 6
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 6
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 6
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 6
- 239000003795 chemical substances by application Substances 0.000 description 6
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 description 6
- 229920000642 polymer Polymers 0.000 description 6
- 230000004481 post-translational protein modification Effects 0.000 description 6
- 230000004044 response Effects 0.000 description 6
- 241000894007 species Species 0.000 description 6
- 230000000699 topical Effects 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 108010047814 Antigen-Antibody Complex Proteins 0.000 description 5
- 229960005261 Aspartic Acid Drugs 0.000 description 5
- 241000283690 Bos taurus Species 0.000 description 5
- 108090000331 Firefly luciferases Proteins 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 229960000310 ISOLEUCINE Drugs 0.000 description 5
- 108090001124 Immunoglobulin E Proteins 0.000 description 5
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 5
- 210000002540 Macrophages Anatomy 0.000 description 5
- 229920001785 Response element Polymers 0.000 description 5
- 230000004075 alteration Effects 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 235000003704 aspartic acid Nutrition 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 239000002775 capsule Substances 0.000 description 5
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 5
- 230000009089 cytolysis Effects 0.000 description 5
- 230000028993 immune response Effects 0.000 description 5
- 235000014705 isoleucine Nutrition 0.000 description 5
- 210000003292 kidney cell Anatomy 0.000 description 5
- 230000002934 lysing Effects 0.000 description 5
- 229910052717 sulfur Inorganic materials 0.000 description 5
- 239000003826 tablet Substances 0.000 description 5
- 238000002255 vaccination Methods 0.000 description 5
- 239000011534 wash buffer Substances 0.000 description 5
- 239000004475 Arginine Substances 0.000 description 4
- 210000003979 Eosinophils Anatomy 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- 210000001035 Gastrointestinal Tract Anatomy 0.000 description 4
- 230000036499 Half live Effects 0.000 description 4
- 241000238631 Hexapoda Species 0.000 description 4
- 229960002885 Histidine Drugs 0.000 description 4
- 206010053317 Hydrophobia Diseases 0.000 description 4
- 210000000987 Immune System Anatomy 0.000 description 4
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- 108020004999 Messenger RNA Proteins 0.000 description 4
- 210000001616 Monocytes Anatomy 0.000 description 4
- 108010061543 Neutralizing Antibodies Proteins 0.000 description 4
- 206010057249 Phagocytosis Diseases 0.000 description 4
- 241000288906 Primates Species 0.000 description 4
- 102100009178 RUNX1T1 Human genes 0.000 description 4
- 101710034060 RUNX1T1 Proteins 0.000 description 4
- 210000002845 Virion Anatomy 0.000 description 4
- 125000001931 aliphatic group Chemical group 0.000 description 4
- 235000009697 arginine Nutrition 0.000 description 4
- 229960003121 arginine Drugs 0.000 description 4
- 229910052799 carbon Inorganic materials 0.000 description 4
- 230000001413 cellular Effects 0.000 description 4
- 230000001684 chronic Effects 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N edta Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 210000004602 germ cell Anatomy 0.000 description 4
- 235000004554 glutamine Nutrition 0.000 description 4
- 230000003899 glycosylation Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 235000014304 histidine Nutrition 0.000 description 4
- 230000016784 immunoglobulin production Effects 0.000 description 4
- 239000002502 liposome Substances 0.000 description 4
- 235000018977 lysine Nutrition 0.000 description 4
- 229960003646 lysine Drugs 0.000 description 4
- 239000003550 marker Substances 0.000 description 4
- 229920002106 messenger RNA Polymers 0.000 description 4
- 239000000178 monomer Substances 0.000 description 4
- 230000008782 phagocytosis Effects 0.000 description 4
- 210000001236 prokaryotic cell Anatomy 0.000 description 4
- 230000001681 protective Effects 0.000 description 4
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 4
- 230000002285 radioactive Effects 0.000 description 4
- 150000007949 saponins Chemical class 0.000 description 4
- 238000002741 site-directed mutagenesis Methods 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 230000004083 survival Effects 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- 206010069754 Acquired gene mutation Diseases 0.000 description 3
- 239000012099 Alexa Fluor family Substances 0.000 description 3
- 229960001230 Asparagine Drugs 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 101700056583 CD27 Proteins 0.000 description 3
- 102100019459 CD27 Human genes 0.000 description 3
- 102100019456 CD276 Human genes 0.000 description 3
- 101700015421 CD276 Proteins 0.000 description 3
- 102100019461 CD28 Human genes 0.000 description 3
- 101700033362 CD28 Proteins 0.000 description 3
- 102100019404 CDSN Human genes 0.000 description 3
- 101700062689 CDSN Proteins 0.000 description 3
- 210000000234 Capsid Anatomy 0.000 description 3
- QIVBCDIJIAJPQS-SECBINFHSA-N D-tryptophane Chemical compound C1=CC=C2C(C[C@@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-SECBINFHSA-N 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 229940088598 Enzyme Drugs 0.000 description 3
- 229960002989 Glutamic Acid Drugs 0.000 description 3
- 101710005864 HI_0216 Proteins 0.000 description 3
- 206010019663 Hepatic failure Diseases 0.000 description 3
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 3
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 3
- 102000004090 Immunoglobulin Isotypes Human genes 0.000 description 3
- 108090000539 Immunoglobulin Isotypes Proteins 0.000 description 3
- 108010002350 Interleukin-2 Proteins 0.000 description 3
- 210000003734 Kidney Anatomy 0.000 description 3
- 208000007903 Liver Failure Diseases 0.000 description 3
- 210000004072 Lung Anatomy 0.000 description 3
- 101710005865 MPN_201 Proteins 0.000 description 3
- 101710005862 MPN_285 Proteins 0.000 description 3
- 101710005861 MPN_289 Proteins 0.000 description 3
- 101710005860 MPN_290 Proteins 0.000 description 3
- 101710029070 MPN_343 Proteins 0.000 description 3
- 101710005841 MPN_365 Proteins 0.000 description 3
- 101710005863 MPN_615 Proteins 0.000 description 3
- 101710005859 MPN_638 Proteins 0.000 description 3
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 3
- 210000000440 Neutrophils Anatomy 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 210000001672 Ovary Anatomy 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 239000004698 Polyethylene (PE) Substances 0.000 description 3
- 102000004389 Ribonucleoproteins Human genes 0.000 description 3
- 108010081734 Ribonucleoproteins Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 108010070144 Single-Chain Antibodies Proteins 0.000 description 3
- 102000005632 Single-Chain Antibodies Human genes 0.000 description 3
- 210000003491 Skin Anatomy 0.000 description 3
- 102100008790 TNFRSF14 Human genes 0.000 description 3
- 101700055524 VME1 Proteins 0.000 description 3
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 3
- 230000000208 anti-hepatitis Effects 0.000 description 3
- 235000009582 asparagine Nutrition 0.000 description 3
- 230000000712 assembly Effects 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- 239000012228 culture supernatant Substances 0.000 description 3
- 230000001419 dependent Effects 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000003260 fluorescence intensity Methods 0.000 description 3
- 238000005755 formation reaction Methods 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 3
- 239000001963 growth media Substances 0.000 description 3
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 3
- 238000003384 imaging method Methods 0.000 description 3
- 230000001965 increased Effects 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 125000005647 linker group Chemical group 0.000 description 3
- 231100000835 liver failure Toxicity 0.000 description 3
- 101710026800 lyc Proteins 0.000 description 3
- 210000004962 mammalian cells Anatomy 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 230000003278 mimic Effects 0.000 description 3
- 101700045377 mvp1 Proteins 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- 230000001717 pathogenic Effects 0.000 description 3
- 244000052769 pathogens Species 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 101700083974 prrB Proteins 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- 230000002194 synthesizing Effects 0.000 description 3
- 230000001131 transforming Effects 0.000 description 3
- NFGXHKASABOEEW-UHFFFAOYSA-N (+)-methoprene Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 2
- CZPWVGJYEJSRLH-UHFFFAOYSA-N 289-95-2 Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 2
- 108091008154 B cell receptors Proteins 0.000 description 2
- 210000004556 Brain Anatomy 0.000 description 2
- 102100005826 CD19 Human genes 0.000 description 2
- 101700087100 CD19 Proteins 0.000 description 2
- 101710040446 CD40 Proteins 0.000 description 2
- 102100013137 CD40 Human genes 0.000 description 2
- 102100005310 CTLA4 Human genes 0.000 description 2
- 101700054183 CTLA4 Proteins 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 2
- 206010061818 Disease progression Diseases 0.000 description 2
- 230000036809 Fabs Effects 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- 102100013132 HBD Human genes 0.000 description 2
- 101700070089 HBD Proteins 0.000 description 2
- 206010019641 Hepatic cirrhosis Diseases 0.000 description 2
- 208000006454 Hepatitis Diseases 0.000 description 2
- 108010064750 Humanized Monoclonal Antibodies Proteins 0.000 description 2
- 102000015434 Humanized Monoclonal Antibodies Human genes 0.000 description 2
- 210000004408 Hybridomas Anatomy 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N Hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 102100001475 ITGB2 Human genes 0.000 description 2
- 102000009490 IgG Receptors Human genes 0.000 description 2
- 108010073807 IgG Receptors Proteins 0.000 description 2
- 229920002459 Intron Polymers 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-2-aminohexanoic acid zwitterion Chemical group CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- 125000002707 L-tryptophyl group Chemical group [H]C1=C([H])C([H])=C2C(C([C@](N([H])[H])(C(=O)[*])[H])([H])[H])=C([H])N([H])C2=C1[H] 0.000 description 2
- 108060004270 LAG3 Proteins 0.000 description 2
- 102100017213 LAG3 Human genes 0.000 description 2
- 101700048185 LAMP1 Proteins 0.000 description 2
- 102100005918 LAMP1 Human genes 0.000 description 2
- GUBGYTABKSRVRQ-UUNJERMWSA-N Lactose Natural products O([C@@H]1[C@H](O)[C@H](O)[C@H](O)O[C@@H]1CO)[C@H]1[C@@H](O)[C@@H](O)[C@H](O)[C@H](CO)O1 GUBGYTABKSRVRQ-UUNJERMWSA-N 0.000 description 2
- 102000004895 Lipoproteins Human genes 0.000 description 2
- 108090001030 Lipoproteins Proteins 0.000 description 2
- 210000000138 Mast Cells Anatomy 0.000 description 2
- 102000018697 Membrane Proteins Human genes 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- KCWZGJVSDFYRIX-YFKPBYRVSA-N Ngamma-Nitro-L-arginine methyl ester Chemical compound COC(=O)[C@@H](N)CCCN=C(N)N[N+]([O-])=O KCWZGJVSDFYRIX-YFKPBYRVSA-N 0.000 description 2
- 229940055729 Papain Drugs 0.000 description 2
- 108090000526 Papain Proteins 0.000 description 2
- 229960005190 Phenylalanine Drugs 0.000 description 2
- 210000002826 Placenta Anatomy 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- KDCGOANMDULRCW-UHFFFAOYSA-N Purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- 239000007759 RPMI Media 1640 Substances 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 210000003079 Salivary Glands Anatomy 0.000 description 2
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 2
- 241000256248 Spodoptera Species 0.000 description 2
- 101710038603 TNFRSF18 Proteins 0.000 description 2
- 102100003096 TNFRSF18 Human genes 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N Thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- 210000001685 Thyroid Gland Anatomy 0.000 description 2
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K Trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 108020005202 Viral DNA Proteins 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N Xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- 230000002378 acidificating Effects 0.000 description 2
- 230000001154 acute Effects 0.000 description 2
- 230000003044 adaptive Effects 0.000 description 2
- 230000033289 adaptive immune response Effects 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 230000001919 adrenal Effects 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 230000003042 antagnostic Effects 0.000 description 2
- 230000000840 anti-viral Effects 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 239000007900 aqueous suspension Substances 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 125000002091 cationic group Chemical group 0.000 description 2
- 101700018328 ccdB Proteins 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- 210000004748 cultured cells Anatomy 0.000 description 2
- 230000001086 cytosolic Effects 0.000 description 2
- 231100000599 cytotoxic agent Toxicity 0.000 description 2
- 230000003247 decreasing Effects 0.000 description 2
- 150000002019 disulfides Chemical class 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 230000004077 genetic alteration Effects 0.000 description 2
- 231100000118 genetic alteration Toxicity 0.000 description 2
- 150000002314 glycerols Polymers 0.000 description 2
- 231100000283 hepatitis Toxicity 0.000 description 2
- 229910052739 hydrogen Inorganic materials 0.000 description 2
- 239000001257 hydrogen Substances 0.000 description 2
- 125000004435 hydrogen atoms Chemical group [H]* 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 238000003125 immunofluorescent labeling Methods 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 230000003834 intracellular Effects 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 238000000111 isothermal titration calorimetry Methods 0.000 description 2
- GUBGYTABKSRVRQ-XLOQQCSPSA-N lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000006193 liquid solution Substances 0.000 description 2
- 239000006194 liquid suspension Substances 0.000 description 2
- 201000004044 liver cirrhosis Diseases 0.000 description 2
- 238000011068 load Methods 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 230000000051 modifying Effects 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 239000002674 ointment Substances 0.000 description 2
- 210000000056 organs Anatomy 0.000 description 2
- 235000019834 papain Nutrition 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 239000000816 peptidomimetic Substances 0.000 description 2
- 235000019271 petrolatum Nutrition 0.000 description 2
- 230000001817 pituitary Effects 0.000 description 2
- 229920001583 poly(oxyethylated polyols) Polymers 0.000 description 2
- 230000001323 posttranslational Effects 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 230000002335 preservative Effects 0.000 description 2
- 230000002035 prolonged Effects 0.000 description 2
- DNIAPMSPPWPWGF-UHFFFAOYSA-N propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 238000003892 spreading Methods 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 239000000021 stimulant Substances 0.000 description 2
- 125000001424 substituent group Chemical group 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- NINIDFKCEFEMDL-UHFFFAOYSA-N sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 2
- 239000011593 sulfur Substances 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- 239000011778 trisodium citrate Substances 0.000 description 2
- 238000010798 ubiquitination Methods 0.000 description 2
- ORHBXUUXSCNDEV-UHFFFAOYSA-N umbelliferone Chemical compound C1=CC(=O)OC2=CC(O)=CC=C21 ORHBXUUXSCNDEV-UHFFFAOYSA-N 0.000 description 2
- ZADWXFSZEAPBJS-SNVBAGLBSA-N (2R)-2-amino-3-(1-methylindol-3-yl)propanoic acid Chemical compound C1=CC=C2N(C)C=C(C[C@@H](N)C(O)=O)C2=C1 ZADWXFSZEAPBJS-SNVBAGLBSA-N 0.000 description 1
- YPBKTZBXSBLTDK-PKNBQFBNSA-N (3E)-3-[(3-bromo-4-fluoroanilino)-nitrosomethylidene]-4-[2-(sulfamoylamino)ethylamino]-1,2,5-oxadiazole Chemical compound NS(=O)(=O)NCCNC1=NON\C1=C(N=O)/NC1=CC=C(F)C(Br)=C1 YPBKTZBXSBLTDK-PKNBQFBNSA-N 0.000 description 1
- MUVQOOPKPBEAJZ-VQHVLOKHSA-N (4E)-4-[(3-chloro-4-fluoroanilino)-nitrosomethylidene]-1,2,5-oxadiazol-3-amine Chemical compound NC1=NON\C1=C(N=O)/NC1=CC=C(F)C(Cl)=C1 MUVQOOPKPBEAJZ-VQHVLOKHSA-N 0.000 description 1
- ZADWXFSZEAPBJS-UHFFFAOYSA-N 1-Methyltryptophan Chemical compound C1=CC=C2N(C)C=C(CC(N)C(O)=O)C2=C1 ZADWXFSZEAPBJS-UHFFFAOYSA-N 0.000 description 1
- YTRRAUACYORZLX-UHFFFAOYSA-N 1-cyclohexyl-2-(5H-imidazo[5,1-a]isoindol-5-yl)ethanol Chemical compound C12=CC=CC=C2C2=CN=CN2C1CC(O)C1CCCCC1 YTRRAUACYORZLX-UHFFFAOYSA-N 0.000 description 1
- KOBHCUDVWOTEKO-UHFFFAOYSA-N 2-amino-4-[[amino-(hydroxyamino)methylidene]amino]butanoic acid Chemical compound OC(=O)C(N)CCN=C(N)NO KOBHCUDVWOTEKO-UHFFFAOYSA-N 0.000 description 1
- LEACJMVNYZDSKR-UHFFFAOYSA-N 2-octyldodecan-1-ol Chemical compound CCCCCCCCCCC(CO)CCCCCCCC LEACJMVNYZDSKR-UHFFFAOYSA-N 0.000 description 1
- 101700027111 3SA0 Proteins 0.000 description 1
- XPDXVDYUQZHFPV-UHFFFAOYSA-N 5-Dimethylaminonaphthyl-5-sulfonyl chloride Chemical compound C1=CC=C2C(N(C)C)=CC=CC2=C1S(Cl)(=O)=O XPDXVDYUQZHFPV-UHFFFAOYSA-N 0.000 description 1
- OIRDTQYFTABQOQ-GAWUUDPSSA-N 9-β-D-XYLOFURANOSYL-ADENINE Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@H](O)[C@H]1O OIRDTQYFTABQOQ-GAWUUDPSSA-N 0.000 description 1
- 108010061171 Abatacept Proteins 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 229940022698 Acetylcholinesterase Drugs 0.000 description 1
- 102000012440 Acetylcholinesterase Human genes 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 206010059193 Acute hepatitis B Diseases 0.000 description 1
- 229960000643 Adenine Drugs 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Natural products NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- OIRDTQYFTABQOQ-SXVXDFOESA-N Adenosine Natural products Nc1ncnc2c1ncn2[C@@H]3O[C@@H](CO)[C@H](O)[C@@H]3O OIRDTQYFTABQOQ-SXVXDFOESA-N 0.000 description 1
- 102000009346 Adenosine receptors Human genes 0.000 description 1
- 108050000203 Adenosine receptors Proteins 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 108010083359 Antigen Receptors Proteins 0.000 description 1
- 102000006306 Antigen Receptors Human genes 0.000 description 1
- 102000004452 Arginases Human genes 0.000 description 1
- 108020001204 Arginases Proteins 0.000 description 1
- 229950002916 Avelumab Drugs 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 108010090685 BMS-936559 Proteins 0.000 description 1
- 101710043792 BNA2 Proteins 0.000 description 1
- 108010071919 Bispecific Antibodies Proteins 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 102100014174 CD160 Human genes 0.000 description 1
- 101710039069 CD160 Proteins 0.000 description 1
- 102100007290 CD274 Human genes 0.000 description 1
- 101710012053 CD274 Proteins 0.000 description 1
- 102100013077 CD4 Human genes 0.000 description 1
- 101700022938 CD4 Proteins 0.000 description 1
- 102100019443 CD79A Human genes 0.000 description 1
- 101700037975 CD79A Proteins 0.000 description 1
- 102100019449 CD79B Human genes 0.000 description 1
- 101700045471 CD79B Proteins 0.000 description 1
- 102100019451 CD80 Human genes 0.000 description 1
- 101700080477 CD80 Proteins 0.000 description 1
- 102100008186 CD83 Human genes 0.000 description 1
- 101700013105 CD83 Proteins 0.000 description 1
- 102100008191 CD8A Human genes 0.000 description 1
- 101700054655 CD8A Proteins 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N Carboxyglutamic acid Chemical compound OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 231100000023 Cell-mediated cytotoxicity Toxicity 0.000 description 1
- 206010057250 Cell-mediated cytotoxicity Diseases 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 210000000349 Chromosomes Anatomy 0.000 description 1
- 229920001405 Coding region Polymers 0.000 description 1
- 229920000062 Coding strand Polymers 0.000 description 1
- 208000003322 Coinfection Diseases 0.000 description 1
- 229920002676 Complementary DNA Polymers 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 229940104302 Cytosine Drugs 0.000 description 1
- OPTASPLRGRRNAP-UHFFFAOYSA-N Cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 1
- 210000000172 Cytosol Anatomy 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N D-Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Polymers OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 101700011961 DPOM Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 230000036947 Dissociation constant Effects 0.000 description 1
- 206010013710 Drug interaction Diseases 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 229950009791 Durvalumab Drugs 0.000 description 1
- 108010092799 EC 2.7.7.49 Proteins 0.000 description 1
- 101700008821 EXO Proteins 0.000 description 1
- 101700083023 EXRN Proteins 0.000 description 1
- 229950010033 Ebselen Drugs 0.000 description 1
- DYEFUKCXAQOFHX-UHFFFAOYSA-N Ebselenum Chemical compound [se]1C2=CC=CC=C2C(=O)N1C1=CC=CC=C1 DYEFUKCXAQOFHX-UHFFFAOYSA-N 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 229950004270 Enoblituzumab Drugs 0.000 description 1
- 229950006370 Epacadostat Drugs 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 210000003743 Erythrocytes Anatomy 0.000 description 1
- 231100000776 Exotoxin Toxicity 0.000 description 1
- 210000003414 Extremities Anatomy 0.000 description 1
- 101710044640 FCGR2A Proteins 0.000 description 1
- 101710044641 FCGR2B Proteins 0.000 description 1
- 102100015544 FCGR2C Human genes 0.000 description 1
- 101710044642 FCGR2C Proteins 0.000 description 1
- 102100015541 FCGR3A Human genes 0.000 description 1
- 101710044656 FCGR3A Proteins 0.000 description 1
- 101710044657 FCGR3B Proteins 0.000 description 1
- 101700077459 FCRLB Proteins 0.000 description 1
- 101700037202 FYN Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 101710042220 GAL5 Proteins 0.000 description 1
- 101710042195 GAL9 Proteins 0.000 description 1
- 102100011343 GLB1 Human genes 0.000 description 1
- 102000000802 Galectin 3 Human genes 0.000 description 1
- 108010001517 Galectin 3 Proteins 0.000 description 1
- 102000002068 Glycopeptides Human genes 0.000 description 1
- 108010015899 Glycopeptides Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 210000002288 Golgi Apparatus Anatomy 0.000 description 1
- UYTPUPDQBNUYGX-UHFFFAOYSA-N Guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 1
- 102100016384 HAVCR2 Human genes 0.000 description 1
- 101710004393 HAVCR2 Proteins 0.000 description 1
- 101700079958 HCST Proteins 0.000 description 1
- 102100004898 HCST Human genes 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N HEPES Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 101710011863 HPD Proteins 0.000 description 1
- 102000008055 Heparan Sulfate Proteoglycans Human genes 0.000 description 1
- 108010088992 Heparan Sulfate Proteoglycans Proteins 0.000 description 1
- 229920002971 Heparan sulfate Polymers 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 229940098197 Human Immunoglobulin G Drugs 0.000 description 1
- 229960002591 Hydroxyproline Drugs 0.000 description 1
- 102100004115 ICAM1 Human genes 0.000 description 1
- 102100008614 IDO1 Human genes 0.000 description 1
- 101710031171 IDO1 Proteins 0.000 description 1
- 101700082799 IL2RA Proteins 0.000 description 1
- 229940072221 IMMUNOGLOBULINS Drugs 0.000 description 1
- 101700015336 ISG20 Proteins 0.000 description 1
- 102100002950 ISG20 Human genes 0.000 description 1
- 101710006663 ITGB2 Proteins 0.000 description 1
- 229950009034 Indoximod Drugs 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 210000004020 Intracellular Membrane Anatomy 0.000 description 1
- 108010089187 Ipilimumab Proteins 0.000 description 1
- 102100019598 KLRF1 Human genes 0.000 description 1
- 101700086173 KLRF1 Proteins 0.000 description 1
- 101710036390 KLRK1 Proteins 0.000 description 1
- 102100012223 KLRK1 Human genes 0.000 description 1
- 210000001865 Kupffer Cells Anatomy 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N L-glucitol Polymers OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine zwitterion Chemical group OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 1
- 102100016650 LAIR1 Human genes 0.000 description 1
- 101700010670 LAIR1 Proteins 0.000 description 1
- 102100004651 LGALS9 Human genes 0.000 description 1
- 101710015837 LGALS9 Proteins 0.000 description 1
- 102100005410 LINE-1 retrotransposable element ORF2 protein Human genes 0.000 description 1
- GOTYRUGSSMKFNF-UHFFFAOYSA-N Lenalidomide Chemical compound C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O GOTYRUGSSMKFNF-UHFFFAOYSA-N 0.000 description 1
- 210000000265 Leukocytes Anatomy 0.000 description 1
- 108010028921 Lipopeptides Proteins 0.000 description 1
- 229950011263 Lirilumab Drugs 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N Luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 1
- 101710029649 MDV043 Proteins 0.000 description 1
- 229920002521 Macromolecule Polymers 0.000 description 1
- 230000035633 Metabolized Effects 0.000 description 1
- LSDPWZHWYPCBBB-UHFFFAOYSA-O Methylsulfide anion Chemical compound [SH2+]C LSDPWZHWYPCBBB-UHFFFAOYSA-O 0.000 description 1
- 229920000460 Mitochondrial DNA Polymers 0.000 description 1
- 108020005196 Mitochondrial DNA Proteins 0.000 description 1
- ZTLGJPIZUOVDMT-UHFFFAOYSA-N N,N-dichlorotriazin-4-amine Chemical compound ClN(Cl)C1=CC=NN=N1 ZTLGJPIZUOVDMT-UHFFFAOYSA-N 0.000 description 1
- 102100000486 NECTIN2 Human genes 0.000 description 1
- 101710005673 NECTIN2 Proteins 0.000 description 1
- 102100012131 NOTCH1 Human genes 0.000 description 1
- 108060009214 NRK Proteins 0.000 description 1
- 108010019706 Nivolumab Proteins 0.000 description 1
- 229920000272 Oligonucleotide Polymers 0.000 description 1
- 241000283898 Ovis Species 0.000 description 1
- 239000012270 PD-1 inhibitor Substances 0.000 description 1
- 229940121655 PD-1 inhibitors Drugs 0.000 description 1
- 101700061424 POLB Proteins 0.000 description 1
- 101700044144 PTCRA Proteins 0.000 description 1
- 102100016187 PVR Human genes 0.000 description 1
- 102100016188 PVRIG Human genes 0.000 description 1
- 101700053733 PVRIG Proteins 0.000 description 1
- 241000282579 Pan Species 0.000 description 1
- 102000007497 Patched-2 Receptor Human genes 0.000 description 1
- 108010071083 Patched-2 Receptor Proteins 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 210000003819 Peripheral blood mononuclear cell Anatomy 0.000 description 1
- 239000004264 Petrolatum Substances 0.000 description 1
- 229940066842 Petrolatum Drugs 0.000 description 1
- BZQFBWGGLXLEPQ-REOHCLBHSA-N Phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 229950010773 Pidilizumab Drugs 0.000 description 1
- 210000002381 Plasma Anatomy 0.000 description 1
- 210000002706 Plastids Anatomy 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 229920002594 Polyethylene Glycol 8000 Polymers 0.000 description 1
- 229920002873 Polyethylenimine Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 229920001451 Polypropylene glycol Polymers 0.000 description 1
- 229920001214 Polysorbate 60 Polymers 0.000 description 1
- UVSMNLNDYGZFPF-UHFFFAOYSA-N Pomalidomide Chemical compound O=C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O UVSMNLNDYGZFPF-UHFFFAOYSA-N 0.000 description 1
- 229940071643 Prefilled Syringe Drugs 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 210000003324 RBC Anatomy 0.000 description 1
- 101700054624 RF1 Proteins 0.000 description 1
- 102200096758 RNF125 C40A Human genes 0.000 description 1
- 102100017730 RORA Human genes 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 102000007312 Recombinant Proteins Human genes 0.000 description 1
- 108010033725 Recombinant Proteins Proteins 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N Rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- OTJHLDXXJHAZTN-BYPYZUCNSA-N S-(2-boronoethyl)-L-cysteine Chemical compound OC(=O)[C@@H](N)CSCCB(O)O OTJHLDXXJHAZTN-BYPYZUCNSA-N 0.000 description 1
- 241000315672 SARS coronavirus Species 0.000 description 1
- 102100017643 SLAMF1 Human genes 0.000 description 1
- 102100017640 SLAMF7 Human genes 0.000 description 1
- 101710030435 SLAMF7 Proteins 0.000 description 1
- 229920000972 Sense strand Polymers 0.000 description 1
- 210000000717 Sertoli cell Anatomy 0.000 description 1
- 108010074687 Signaling Lymphocytic Activation Molecule Family Member 1 Proteins 0.000 description 1
- 210000002356 Skeleton Anatomy 0.000 description 1
- HVUMOYIDDBPOLL-XWVZOOPGSA-N Sorbitan monostearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O HVUMOYIDDBPOLL-XWVZOOPGSA-N 0.000 description 1
- 241000256251 Spodoptera frugiperda Species 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 206010042566 Superinfection Diseases 0.000 description 1
- 108091008149 TGN-1412 Proteins 0.000 description 1
- 102100006047 TIGIT Human genes 0.000 description 1
- 101700052319 TIGIT Proteins 0.000 description 1
- 101710030862 TNFRSF13C Proteins 0.000 description 1
- 102100009743 TNFRSF13C Human genes 0.000 description 1
- 101710040533 TNFRSF8 Proteins 0.000 description 1
- 102100009538 TNFRSF8 Human genes 0.000 description 1
- 102100009537 TNFRSF9 Human genes 0.000 description 1
- 101710040535 TNFRSF9 Proteins 0.000 description 1
- 101700050080 TRAT1 Proteins 0.000 description 1
- 229940113082 Thymine Drugs 0.000 description 1
- 231100000765 Toxin Toxicity 0.000 description 1
- 241000424123 Trachinotus baillonii Species 0.000 description 1
- 229950007217 Tremelimumab Drugs 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H Tricalcium phosphate Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 241000255993 Trichoplusia ni Species 0.000 description 1
- FPKOPBFLPLFWAD-UHFFFAOYSA-N Trinitrotoluene Chemical compound CC1=CC=C([N+]([O-])=O)C([N+]([O-])=O)=C1[N+]([O-])=O FPKOPBFLPLFWAD-UHFFFAOYSA-N 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 229940035893 Uracil Drugs 0.000 description 1
- 229950005972 Urelumab Drugs 0.000 description 1
- 102100015314 VSIR Human genes 0.000 description 1
- 101710036075 VSIR Proteins 0.000 description 1
- 210000003462 Veins Anatomy 0.000 description 1
- 206010058874 Viraemia Diseases 0.000 description 1
- 208000001756 Virus Disease Diseases 0.000 description 1
- 101700083482 ZAP70 Proteins 0.000 description 1
- BLVGFZFOWWBCCZ-YFKPBYRVSA-O [(5S)-5-azaniumyl-5-carboxypentyl]-trihydroxyboranuide Chemical compound OC(=O)[C@@H]([NH3+])CCCC[B-](O)(O)O BLVGFZFOWWBCCZ-YFKPBYRVSA-O 0.000 description 1
- PGUYAANYCROBRT-UHFFFAOYSA-K [O-]P([O-])([Se-])=[Se] Chemical compound [O-]P([O-])([Se-])=[Se] PGUYAANYCROBRT-UHFFFAOYSA-K 0.000 description 1
- 229960003697 abatacept Drugs 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M acetate Chemical class CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 230000003213 activating Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive Effects 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 108010093001 anti-IgG Proteins 0.000 description 1
- 230000000111 anti-oxidant Effects 0.000 description 1
- 230000000692 anti-sense Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000008135 aqueous vehicle Substances 0.000 description 1
- 125000000511 arginine group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 108010072668 atezolizumab Proteins 0.000 description 1
- 229960003852 atezolizumab Drugs 0.000 description 1
- 108010010826 avelumab Proteins 0.000 description 1
- 230000001580 bacterial Effects 0.000 description 1
- 244000052616 bacterial pathogens Species 0.000 description 1
- 229960005347 belatacept Drugs 0.000 description 1
- 150000001558 benzoic acid derivatives Chemical class 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 230000003115 biocidal Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 238000010504 bond cleavage reaction Methods 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 201000009030 carcinoma Diseases 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 230000034303 cell budding Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 229940081733 cetearyl alcohol Drugs 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 238000007374 clinical diagnostic method Methods 0.000 description 1
- 239000005515 coenzyme Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000001268 conjugating Effects 0.000 description 1
- 239000000599 controlled substance Substances 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 230000000139 costimulatory Effects 0.000 description 1
- 230000001808 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000010192 crystallographic characterization Methods 0.000 description 1
- 101700067609 ctx Proteins 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 230000002354 daily Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- NAGJZTKCGNOGPW-UHFFFAOYSA-K dioxido-sulfanylidene-sulfido-$l^{5}-phosphane Chemical compound [O-]P([O-])([S-])=S NAGJZTKCGNOGPW-UHFFFAOYSA-K 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 108010016436 durvalumab Proteins 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 239000008387 emulsifying waxe Substances 0.000 description 1
- 239000002532 enzyme inhibitor Substances 0.000 description 1
- 239000002095 exotoxin Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000033581 fucosylation Effects 0.000 description 1
- 101700062055 fyna Proteins 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000003500 gene array Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 150000002303 glucose derivatives Polymers 0.000 description 1
- 150000002304 glucoses Polymers 0.000 description 1
- 125000002791 glucosyl group Polymers C1([C@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- 150000004676 glycans Polymers 0.000 description 1
- PEDCQBHIVMGVHV-UHFFFAOYSA-N glycerol group Chemical group OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 1
- 125000003712 glycosamine group Chemical group 0.000 description 1
- 230000003394 haemopoietic Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- UBHWBODXJBSFLH-UHFFFAOYSA-N hexadecan-1-ol;octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO.CCCCCCCCCCCCCCCCCCO UBHWBODXJBSFLH-UHFFFAOYSA-N 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 150000003840 hydrochlorides Chemical class 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N hydrogen bromide Chemical class Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 230000000640 hydroxylating Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 230000032226 immune complex clearance Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 230000002998 immunogenetic Effects 0.000 description 1
- 102000029028 immunoglobulin binding proteins Human genes 0.000 description 1
- 108091008472 immunoglobulin binding proteins Proteins 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- APFVFJFRJDLVQX-UHFFFAOYSA-N indium Chemical compound [In] APFVFJFRJDLVQX-UHFFFAOYSA-N 0.000 description 1
- 229910052738 indium Inorganic materials 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002757 inflammatory Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- PNDPGZBMCMUPRI-UHFFFAOYSA-N iodine Chemical compound II PNDPGZBMCMUPRI-UHFFFAOYSA-N 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 239000011630 iodine Substances 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- 229960004942 lenalidomide Drugs 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting Effects 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 150000002690 malonic acid derivatives Chemical class 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 210000001806 memory B lymphocyte Anatomy 0.000 description 1
- 230000000813 microbial Effects 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- YNAVUWVOSKDBBP-UHFFFAOYSA-N morpholine Chemical group C1COCCN1 YNAVUWVOSKDBBP-UHFFFAOYSA-N 0.000 description 1
- 229940113083 morpholine Drugs 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 229960003301 nivolumab Drugs 0.000 description 1
- 238000010606 normalization Methods 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 229940060184 oil ingredients Drugs 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 230000003287 optical Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 125000000913 palmityl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 108010026276 pembrolizumab Proteins 0.000 description 1
- 229960002621 pembrolizumab Drugs 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 150000003905 phosphatidylinositols Chemical class 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-L phosphoramidate Chemical compound NP([O-])([O-])=O PTMHPRAIXMAOOB-UHFFFAOYSA-L 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000000865 phosphorylative Effects 0.000 description 1
- 108010051812 pidilizumab Proteins 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229920000747 poly(lactic acid) polymer Polymers 0.000 description 1
- 108010052044 polyclonal B cell activator Proteins 0.000 description 1
- 108091008117 polyclonal antibodies Proteins 0.000 description 1
- 239000001818 polyoxyethylene sorbitan monostearate Substances 0.000 description 1
- 235000010989 polyoxyethylene sorbitan monostearate Nutrition 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 150000004804 polysaccharides Polymers 0.000 description 1
- 229940113124 polysorbate 60 Drugs 0.000 description 1
- 229960000688 pomalidomide Drugs 0.000 description 1
- 230000001124 posttranscriptional Effects 0.000 description 1
- 230000003389 potentiating Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 125000001116 prolino group Chemical group [H]OC(=O)C1([H])N(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 230000001737 promoting Effects 0.000 description 1
- 230000000644 propagated Effects 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M propionate Chemical class CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- 230000002633 protecting Effects 0.000 description 1
- 238000001711 protein immunostaining Methods 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000002797 proteolythic Effects 0.000 description 1
- 230000002685 pulmonary Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000002510 pyrogen Substances 0.000 description 1
- 230000001105 regulatory Effects 0.000 description 1
- 231100000205 reproductive and developmental toxicity Toxicity 0.000 description 1
- 230000000717 retained Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 239000003419 rna directed dna polymerase inhibitor Substances 0.000 description 1
- 230000003248 secreting Effects 0.000 description 1
- JRPHGDYSKGJTKZ-UHFFFAOYSA-K selenophosphate Chemical compound [O-]P([O-])([O-])=[Se] JRPHGDYSKGJTKZ-UHFFFAOYSA-K 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 239000001587 sorbitan monostearate Substances 0.000 description 1
- 235000011076 sorbitan monostearate Nutrition 0.000 description 1
- 229940035048 sorbitan monostearate Drugs 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 150000003462 sulfoxides Chemical class 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 230000002459 sustained Effects 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 101710002920 tcrA Proteins 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 239000003104 tissue culture media Substances 0.000 description 1
- 239000012049 topical pharmaceutical composition Substances 0.000 description 1
- 230000002588 toxic Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N trans-L-hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 108010072993 tremelimumab Proteins 0.000 description 1
- 210000004881 tumor cells Anatomy 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 108010053952 urelumab Proteins 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 230000003442 weekly Effects 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 239000003871 white petrolatum Substances 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
- VWQVUPCCIRVNHF-UHFFFAOYSA-N yttrium Chemical compound [Y] VWQVUPCCIRVNHF-UHFFFAOYSA-N 0.000 description 1
- 229910052727 yttrium Inorganic materials 0.000 description 1
Abstract
The present disclosure relates to antibodies, and antigen binding fragments thereof, that can bind to the antigenic loop region of hepatitis B surface antigen (HBsAg) and can neutralize infection of both hepatitis B virus (HBV) and hepatitis delta virus (HDV). The present disclosure also relates to epitopes to which the antibodies and antigen binding fragments bind, as well as to fusion proteins that comprise the antigen binding fragments, and to nucleic acids that encode and cells that produce such antibodies and antibody fragments. In addition, the present disclosure relates to the use of the antibodies and antibody fragments of the present disclosure in the diagnosis, prophylaxis and treatment of hepatitis B and hepatitis D.
Description
ANTIBODIES THAT NEUTRALIZE HEPATITIS B VIRUS AND USES THEREOF
STATEMENT REGARDING SEQUENCE LISTING
The Sequence Listing associated with this application is provided in text format in lieu of a paper copy, and is hereby incorporated by reference into the spécification. The name of the text file containing the Sequence Listing is
930485_402WO_SEQUENCE_LISTING.txt. The text file is 109 KB, was created on
December 16, 2019, and is being submitted electronically via EFS-Web.
The présent disclosure relates to the field of immunotherapy for hepatitis B virus (HBV) and against hepatitis delta virus (HDV), and uses thereof. Anti-hepatitis B binding proteins described herein, e.g., antibodies and antigen binding fragments 15 thereof, are capable of binding to an epitope located in the antigenic loop région of the
S domain of the HBV envelope proteins (HBsAg). In certain embodiments, antihepatitis B binding proteins can bind to any or ail of the known HBsAg génotypes, as well as HBsAg variants, and can neutralize HBV infection. Nucleic acids that encode, and host cells that express, such binding proteins are also provided herein. In addition, 20 the présent disclosure provides methods of using the antibodies and antibody fragments described herein in the diagnosis, prophylaxis, and treatment of diseases, as well as in methods of screening.
By way of background, HBV consists of (i) an envelope containing three related surface 25 proteins (hepatitis B surface antigen, HBsAg) and lipid and (ii) an icosahedral nucleocapsid enclosing the viral DNA genome and DNA polymerase. The HBV capsid is formed in the cytosol of the infected cell during packaging of an RNA pregenome réplication complex and gains the ability to bud during synthesis of the viral DNA genome by reverse transcription of the pregenome in the lumen of the particle. The 30 three HBV envelope proteins S-HBsAg, Μ-HBsAg, and L-HBsAg shape a complex transmembrane fold at the endoplasmic réticulum, and form disulfide-linked homo- and heterodimers. During budding at an intracellular membrane, a short linear domain in the cytosolic preS région interacts with binding sites on the capsid surface. The virions are subsequently secreted into the blood. In addition, the surface proteins can bud in the absence of capsids and form subviral particles (SVPs) which are also secreted in 3-4 log excess over virions. High level of HBsAg can exhaust HBsAg-specific T-cell 5 response, and is proposed as an important factor for viral immunotolérance in patients with chronic hepatitis B (CHB) (Chisari FV, Isogawa M, Wieland SF, Pathologie Biologie, 2010;58:258-66).
Hepatitis B virus causes potentially life-threatening acute and chronic liver infections.
Acute hepatitis B is characterized by viremia, with or without symptoms, with the risk 10 of fulminant hepatitis occurrence (Liang TJ, Block TM, McMahon B J, Ghany MG,
Urban S, Guo JT, Locamini S, Zoulim F, Chang KM, Lok AS. Présent and future thérapies of hepatitis B: From discovery to cure. Hepatology. 2015 Aug 3. doi: 10.1002/hep.28025. [Epub ahead of print]). Despite an efficacious vaccine against hepatitis B being available since 1982, WHO reports that 240 million people are 15 chronically infected with hepatitis B and more than 780,000 people die every year due to hepatitis B complications. Approximately one third of chronic hepatitis B (CHB) patients develop cirrhosis, liver failure and hepatocellular carcinoma, accounting for 600,000 deaths per year (Liang TJ, Block TM, McMahon BJ, Ghany MG, Urban S, Guo JT, Locamini S, Zoulim F, Chang KM, Lok AS. Présent and future thérapies of 20 hepatitis B: From discovery to cure. Hepatology. 2015 Aug 3. doi: 10.1002/hep.28025.
[Epub ahead of print]).
For patients infected with HBV, severe complications can develop as a resuit of coinfection or superinfection with HDV. According to the WHO, hepatitis D infects 25 about 15 million people worldwide. HDV is considered a subviral satellite because it can propagate only in the presence of HBV. HDV is one of the smallest known animal viruses (40 nm), whereby its genome is only 1.6 kb and encodes for S and L HDAg. Ail other proteins needed for genome réplication of HDV, including the RNA polymerase, are provided by the host cell, and the HDV envelope is provided by HBV. 30 When introduced into permissive cells, the HDV RNA genome replicates and associâtes with multiple copies of the HDV-encoded proteins to assemble a ribonucleoprotein (RNP) complex. The RNP is exported from the cell by the HBV envelope proteins, which are able to assemble lipoprotein vesicles that bud into the lumen of a pre-Golgi compartment before being secreted. Moreover, the HBV envelope proteins also provide a mechanism for the targeting of HDV to an uninfected cell, thereby ensuring the spread of HDV.
Complications caused by HDV include a greater likelihood of experiencing liver failure in acute infections and a rapid progression to liver cirrhosis, with an increased chance of developing liver cancer in chronic infections. In combination with hepatitis B virus, hepatitis D has the highest fatality rate of ail the hepatitis infections, at 20% (Fattovich G, Giustina G, Christensen E, Pantalena M, Zagni I, Realdi G, Schalm SW. Influence of hepatitis delta virus infection on morbidity and mortality in compensated cirrhosis type B. Gut. 2000 Mar;46(3):420-6). The only approved therapy for chronic HDV infection is interferon-alpha. However, treatment of HDV with interferon-alpha is relatively inefficient and is not well-tolerated. Treatment with interferon-alpha results in sustained virological response six months post-treatment in one-fourth of the patients. Also, nucleos(t)ide analogs (NAs) hâve been widely tested in hepatitis delta, but they appear to be ineffective. Combination treatment using NAs with interferon also proved to be disappointing (Zaigham Abbas, Minaam Abbas Management of hepatitis delta: Need for novel therapeutic Options. World J Gastroenterol 2015 August 28; 21(32): 9461-9465). Accordingly, new therapeutic options are needed.
BRIEF DESCRIPTION OF THE DRAWINGS
The figures provided herein are intended to illustrate subject matter included in the présent disclosure in more detail. The figures are not intended to limit the disclosure in any way.
Figure 1 shows binding of HBC34-V7 and two engineered antibodies of the présent disclosure (HBC34-V34; HBC34-V35) at the indicated concentrations to HBsAg adw (top panel) and HBsAg adr (bottom panel), as determined in direct antigen-based ELISA assays. Ail antibodies were produced as IgGl (glml7, 1 allotype).
Figures 2A-2K show binding of HBC34-V7, HBC34-V34, and HBC34-V35 to ali known HBsAg génotypes ((A)-(J), respectively) and to mock control (K). Genotyperepresentative sequences representing the HBsAg antigenic outer loop, as shown in 5 Example 5 of PCT Publication No. WO 2017/060504, were used. Staining was performed by FACS. Antibody concentrations were as indicated on the x-axis of the graphs.
Figures 3A-3V show in vitro binding (3A-3R) and neutralization (3S-3V) of certain 10 HBC antibodies to HBsAg. Figures 3A and 3B show binding of HBC34-V7 and
HBC34-V35 with wild type or variant Fc régions to HBsAg adw in a direct antigenbased ELISA assay (2 experiments; data from Experiment 1 is shown in Figure 3A, and data from Experiment 2 is shown in Figure 3B). Antigen-binding curves are shown in the top panel of each Figure. ECso values (determined by fitting the curves 15 using Graphpad prism) are shown in the middle panel of each Figure. Binding to uncoated plates (control) is shown in the bottom panel of each Figure. Fc régions: HBC34v7 and HBC34-V35 = wild-type Fc; HBC34-V35-MLNS = Fc with M428L/N434S. HBC34-V35-MLNS-GAALIE = Fc with
M428L/N434S/G236A/A330L/I332E. Three lots of HBC34-V35 were tested. Two 20 lots of HBC34-V35-MLNS, and two lots of HBC34-v35-MLNS-GAALIE were tested.
One lot of HBC34-V7 was used. Figures 3C-3H show binding of HBC34-V35, HBC34-V35-MLNS, and HBC34-V35-MLNS-GAALIE to Expi293 cells expressing HBsAg from ail ten known HBV génotypes or mock control. Binding was determined by flow cytometry. Data are expressed as the mean fluorescence intensity (y-axis) of 25 the transfected populations as defined by gating out the signal obtained with mocktransfected cells. For each HbsAg, serial dilutions of the three test articles were tested (12 points, 1 in 3, starting from 10 gg/ml). Figures 3I-3R show binding of HBC34V35, HBC34-V35-MLNS, and HBC34-V35-MLNS-GAALIE to Expi293 cells expressing HBsAg from nineteen (19) HBsAg variants or mock control. Binding was 30 determined by flow cytometry. Data are expressed as the mean fluorescence intensity of the transfected populations as defined by gating out the signal obtained with mocktransfected cells. For each HBsAg, serial dilutions of the three test articles were tested (12 points, 1 in 3, starting from 10 gg/ml). Antibody concentration was as shown on the x-axis. Figures 3S and 3U show neutralizing capacity of the indicated HBC antibodies against HBV génotype D as assessed by measuring levels of HBsAg (top) and HbeAg (bottom) in the cell culture supematant of HBVD-infected HepG2 cells expressing NTCP. Data represent the means ± SD from one of two independent experiments. Figures 3T and 3V show EC5o values. The géométrie mean and range (in brackets) of EC5o values were determined from two independent experiments.
Figure 4 shows neutralization (EC50 value), by HBC34-V35-MLNS-GAALIE, of individual HBV génotypes using an HDV pseudotyping system.
Figures 5-8 show the effect of HBC34-V35 on sérum HBAg levels in an in vivo mouse model of HBV infection. HBV génotype C-infected SCID mice were transplanted with primary human hépatocytes and administered HBC34-V35 at 1, 5, or 15 mg/kg, or PBS (control), as described in Example 5. Figure 5 shows sérum HBV DNA concentration before and after treatment. Figure 6 shows sérum HBsAg concentration before and after treatment. Figure 7 shows sérum HBeAg concentration before and after treatment. Figure 8 shows sérum HBcrAg concentration before and after treatment. Tmt — Treament.
Figures 9A-9F show binding of HBC34-V35-MLNS and HBC34-V35-MLNSGAALIE to human FcRs. (A)-(E) Binding to FcyRs, as assessed by biolayer interferometry (BLI). His-tagged human FcyRs ((A) FcyRIIa allele H131; (B) FcyRIIa allele R131; (C) FcyRIIIa allele F158; (D) FcyRIIIa allele V158; (E) FcyRIIb) at 2 pg/ml were captured onto anti-penta-His sensors for 6 minutes. FcyR-loaded sensors were then exposed for 5 minutes to a solution of kinetics buffer (pH 7.1) containing 2 gg/ml of each mAb (left part ofthe plot) in the presence 1 gg/ml of affmiPure F(ab')2 Fragment Goat Anti-Human IgG, F(ab')2 fragment spécifie (to cross-link human mAbs through the Fab fragment), followed by a dissociation step in the same buffer for additional 4 minutes (right part of the plot). Association and dissociation profiles were measured in real time as change in the interférence pattern using an Octet® RED96 (FortéBio). (F) In vitro binding of HBC34 antibodies to FcRn at different pHs, as determined using Bio-Layer interferometry (BLI). The time point 0 seconds represents switch from base line buffer to buffer containing antibodies. Time point 300 seconds (dotted vertical line) represents switch to blank buffer at the corresponding pH. Curves indicate association and dissociation profiles of change in the interférence patterns.
Figure 10 shows binding of HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE to human Clq, as measured by Octet®. Anti-human Fab (CH1) sensors were used to capture, through the Fab fragment, the full IgGl of HBC34v35-MLNS and HBC34V35-MLNS-GAALIE mAbs at 10 pg/ml for 10 minutes. IgG-loaded sensors were then 10 exposed for 4 minutes to a solution of kinetics buffer (pH 7.1) containing 3 pg/ml of purified human Clq (left part of the plot), followed by a dissociation step in the same buffer for additional 4 minutes (right part of the plot). Association and dissociation profiles were measured in real time as change in the interférence pattern using an Octet® RED96 (FortéBio).
Figures 11A and 11B show in vitro activation of human FcyRIIIa using receptor-linked activation of a NFAT-mediated Luciferase reporter in engineered Jurkat cells. FcyRIIIa activation was tested using a validated, commercially available bioreporter assay in which recombinant HBsAg (Engerix B) is used as target antigen. Serial 20 dilutions of HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE and a control (Ctr) mAb were incubated with 0.2 pg/ml of HBsAg at 37 °C for 25 min. Jurkat effector cells (Promega) expressing either FcyRIIIa low affinity allele F158 (A) or FcyRIIIa high affinity allele VI58 (B) were resuspended in assay buffer and then added to assay plates. After incubation at 37 °C for 24 hours, Bio-Glo-™ Luciferase Assay Reagent 25 (Promega) was added, and luminescence was quantified using luminometer (Bio-Tek).
Figures 12A and 12B show in vitro activation of human FcyRIIa using receptor-linked activation of a NFAT-mediated luciferase reporter in engineered Jurkat cells. Activation of human FcyRIIa was determined using a validated, commercially available 30 bioreporter assay in which recombinant HBsAg (Engerix B) was used as target antigen.
Serial dilutions of HBC34v35-MLNS and HBC34-V35-MLNS-GAALIE and a control mAb (Ctr) were incubated with 2 pg/ml (A) or 0.2 pg/ml (B) of HBsAg at 37 °C for 25 min. Jurkat effector cells (Promega) expressing FcyRIIa high affinity allele H131 were resuspended in assay buffer and then added to assay plates. After incubation at 37 °C for 23 hours, Bio-Glo-™ Luciferase Assay Reagent (Promega) was added, and luminescence was quantified using luminometer (Bio-Tek).
Figures 13A-13B show in vitro activation of human FcyRIIb using receptor-linked activation of a NFAT-mediated luciferase reporter in engineered Jurkat cells. Activation of human FcyRIIb was tested using a validated, commercially available bioreporter assay in which recombinant HBsAg (Engerix B) is used as target antigen.
Serial dilutions of HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE and a control mAb (Ctr) were incubated with 1 pg/ml of HBsAg at 37 °C for 15 min. Jurkat effector cells (Promega) expressing FcyRIIb were resuspended in assay buffer and then added to assay plates. After incubation at 37 °C for 20 hours, Bio-Glo-™ Luciferase Assay Reagent (Promega) was added, and luminescence was quantified using luminometer (Bio-Tek). In Figure 13B, the control mAb from Figure 13A is designated Ctr mAbl.
A second control mAb, designated Ctr mAb2, is a version of HBC34-V35 including IgGl Fc with the following mutations that enhance binding to FcyRIIb: G237D/P238D/H268D/P271G/A330R (Mimoto et al., Prot Eng Des Sel. 26(10):589598 (2013)).
Figures 14A and 14B show in vitro killing of PLC/PRF/5 human hepatoma cells by human primary NK cells in the presence of HBC34-V35-MLNS and HBC34-V35MLNS-GAALIE. (A) ADCC was tested using freshly isolated NK cells from one donor previously genotyped for expressing heterozygous high (VI5 8) and low (F 15 8) 25 affinity FcyRIIIa (F/V). Serial dilutions of HBC34-V35, HBC34-V35-MLNS, HBC34V35-MLNS-GAALIE, anti-HBV mAb 17.1.41, and a control mAb were added to the HBsAg-secreting hepatoma cell line PLC/PRF/5 (also referred to as Alexander cells). PLC/PRF/5 cells were incubated together with antibodies at room température for 10 min. NK cells were added to assay plates (effector cells to target cells ratio of 10:1) and 30 incubated at 37 °C for 4 hours. Cell death was determined by measuring lactate dehydrogenase (LDH) release. (B) Staining of PLC/PRF/5 human hepatoma cells by HBC34-V35 and 17.1.41 mAbs as assessed by flow cytometry. Cells were extensively washed, fixed with formaldéhyde (4%) or fixed and permeabilized (saponin 0.5%) before staining with different concentrations of HBC34-V35 and 17.1.41 mAbs. Binding of these human (in the case of HBC34-V35, engineered human) mAbs was detected by flow-cytometry using an Alexa Fluor® 647 AffmiPure F(ab')2 Fragment Goat Anti-Human IgG, Fcy Fragment Spécifie antibody.
Figures 15A and 15B show in vitro activation of primary human NK cells in the presence of HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE and HBsAg. Activation of NK cells was tested using freshly isolated cells from two donors previously genotyped for expressing (A) homozygous high (VI58) or (B) low (F 158) affmity FcyRIIIa. Serial dilutions of HBC34-V35, HBC34-V35-MLNS-GAALIE, and HBC34v35-LALA mAbs were incubated with NK cells for 4 hours. Activation of NK cells was measured by flow cytometry by staining NK cells with anti-CD107a mAb, as a functional marker for the identification ofNK cell activity.
CD 107a, also known as LAMP-1, is a marker for degranulation of NK cells.
Figure 16 shows results from in vitro drug interaction studies between HBC34-V35MLNS-GAALIE and polymerase/reverse transcriptase inhibitor Entecavir (ETV).
DETAILED DESCRIPTION
Unless defined otherwise, ail technical and scientific terms used herein hâve the same meaning as commonly understood by one of ordinary skill in the art.
Throughout this disclosure, unless the context requires otherwise, the term comprise, and variations thereof, such as comprises, and comprising, is used synonymously with, e.g. having, has, including, includes, or the like, and will be understood to imply the inclusion of a stated member, ratio, integer (including, where appropriate, a fraction thereof; e.g., one tenth and one hundredth of an integer), concentration, or step but not the exclusion of any other non-stated member, ratio, integer, concentration, or step. Any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated. Also, any number range recited herein relating to any physical feature, such as polymer subunits, size or thickness, are to be understood to 5 include any integer within the recited range, unless otherwise indicated. The term consists of ' refers to an embodiment of the term comprise, wherein any other nonstated member, integer or step is excluded. In the context of the présent disclosure, the term comprise encompasses the term consist of'. The term consisting essentially of ' is not équivalent to comprising and refers to the specified materials or steps of a 10 claim, or to those that do not materially affect the basic characteristics of a claimed subject matter.
In addition, it should be understood that the individual compounds, or groups of compounds, derived from the various combinations of the structures and substituents described herein, are disclosed by the présent application to the same extent as if each 15 compound or group of compounds was set forth individually. Thus, sélection of particular structures or particular substituents is within the scope of the présent disclosure.
The terms a and an and the and similar reference used in the context of describing 20 the disclosure (including in the context of the claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. The use ofthe alternative (e.g., or) should be understood to mean either one, both, or any combination of the alternatives. Recitation of ranges of values herein is intended to serve as a shorthand method of referring individually to each separate value 25 falling within the range. Unless otherwise indicated herein, each individual value is incorporated into the disclosure as if it were individually recited herein. No language in the spécification should be construed as indicating any non-claimed element as essential to the practice ofthe subject matter disclosed herein.
The word substantially does not exclude completely; e.g., a composition which is substantially free from Y may be completely free from Y. In certain embodiments, substantially refers to a given amount, effect, or activity of a composition, method, or
use of the présent disclosure as compared to that of a reference composition, method, or use, and describes a réduction in the amount, effect, or activity of no more than 50%, such as no more than 40%, 30%, 25%, 20%, 15%, 10%, 5%, or 1%, or less, of the amount, effect, or activity of the reference composition, method, or use.
As used herein, the term about means ± 20% of the indicated range, value, or structure, unless otherwise indicated.
Optional or optionally means that the subsequently described element, component, 10 event, or circumstance may or may not occur, and that the description includes instances in which the element, component, event, or circumstance occurs and instances in which they do not.
The term disease as used herein is intended to be generally synonymous, and is used 15 interchangeably with, the terms disorder and condition (as in medical condition), in that ail reflect an abnormal condition of the human or animal body or of one of its parts that impairs normal functioning, is typically manifested by distinguishing signs and symptoms, and causes the affected human or animal to hâve a reduced duration or quality of life.
As used herein, reference to treatment of a subject or patient is intended to include prévention, prophylaxis, atténuation, amelioration and therapy. Benefits of treatment include improved clinical outcome; lessening or alleviation of symptoms associated with a disease; decreased occurrence of symptoms; improved quality of life; longer 25 disease-free status; diminishment of extent of disease; stabilization of disease state;
delay of disease progression; remission; survival; prolonged survival; or any combination thereof. The terms subject or patient are used interchangeably herein to mean ail mammals, including humans. Examples of subjects include humans, cows, dogs, cats, horses, goats, sheep, pigs, and rabbits. In one embodiment, the patient is a 30 human.
As used herein, amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., 5 hydroxyproline, γ-carboxyglutamate, and O-phosphoserine. Amino acid analogs refer to compounds that hâve the same basic Chemical structure as a naturally occurring amino acid, i.e., an α-carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, méthionine sulfoxide, méthionine methyl sulfonium. Such analogs hâve modified R groups (e.g., norleucine) or modified 10 peptide backbones, but retain the same basic Chemical structure as a naturally occurring amino acid. Amino acid mimetics refer to Chemical compounds that hâve a structure that is different from the general Chemical structure of an amino acid, but that function in a manner similar to a naturally occurring amino acid.
As used herein, the terms peptide, polypeptide, and protein, and variations of these terms, refer to a molécule that comprises at least two amino acids joined to each other by a (normal or modified) peptide bond. For example, a peptide, polypeptide or protein may comprise or be composed of a plurality of amino acids selected from the 20 amino acids defined by the genetic code or an amino acid analog or mimetic, each being 20 linked to at least one other by a peptide bond. A peptide, polypeptide or protein can comprise or be composed of L-amino acids and/or D-amino acids (or analogs or mimetics thereof). The terms peptide, polypeptide, protein also include peptidomimetics which are defined as peptide analogs containing non-peptidic structural éléments, which peptides are capable of mimicking or antagonizing the 25 biological action(s) of a natural parent peptide. In certain embodiments, a peptidomimetic lacks characteristics such as enzymatically scissile peptide bonds.
A peptide, polypeptide or protein may comprise amino acids other than the 20 amino acids defined by the genetic code in addition to these amino acids, or it can be 30 composed of amino acids other than the 20 amino acids defined by the genetic code. In certain embodiments, a peptide, polypeptide or protein in the context of the présent disclosure can comprise amino acids that are modified by natural processes, such as post-translational maturation processes, or by Chemical processes (e.g., synthetic processes), which are known in the art and include those described herein. Such modifications can appear anywhere in the polypeptide; e,g., in the peptide skeleton; in the amino acid chain; or at the carboxy- or amino-terminal ends. A peptide or 5 polypeptide can be branched, such as following an ubiquitination, or may be cyclic, with or without branching. The terms peptide, polypeptide, and protein also include modifîed peptides, polypeptides and proteins. For example, peptide, polypeptide or protein modifications can include acétylation, acylation, ADPribosylation, amidation, covalent fixation of a nucléotide or of a nucléotide dérivative, 10 covalent fixation of a lipid or of a lipidic dérivative, the covalent fixation of a phosphatidylinositol, covalent or non-covalent cross-linking, cyclization, disulfide bond formation, déméthylation, glycosylation including pegylation, hydroxylation, iodization, méthylation, myristoylation, oxidation, proteolytic processes, phosphorylation, prénylation, racemization, seneloylation, sulfatation, amino acid 15 addition such as arginylation or ubiquitination. Such modifications hâve been described in the literature (see Proteins Structure and Molecular Properties (1993) 2nd Ed., T. E. Creighton, New York; Post-translational Covalent Modifications of Proteins (1983) B. C. Johnson, Ed., Academie Press, New York; Seifter et al. (1990) Analysis for protein modifications and nonprotein cofactors, Meth. Enzymol. 182: 626-646 and Rattan et al., 20 (1992) Protein Synthesis: Post-translational Modifications and Aging, Ann NY Acad
Sci, 663: 48-62). Accordingly, the terms peptide, polypeptide, protein can include for example lipopeptides, lipoproteins, glycopeptides, glycoproteins and the like. Variants of proteins, peptides, and polypeptides of this disclosure are also contemplated. In certain embodiments, variant proteins, peptides, and polypeptides 25 comprise or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identical to an amino acid sequence of a defined or reference amino acid sequence as described herein.
As used herein, (poly)peptide and protein may be used interchangeably in reference 30 to a polymer of amino acid residues, such as a plurality of amino acid monomers linked by peptide bonds.
Nucleic acid molécule or polynucleotide or nucleic acid refers to a polymeric compound including covalently linked nucléotides, which can be made up of natural subunits (e.g., purine or pyrimidine bases) or non-natural subunits (e.g., morpholine ring). Purine bases include adenine, guanine, hypoxanthine, and xanthine, and pyrimidine bases include uracil, thymine, and cytosine. Nucleic acid monomers can be linked by phosphodiester bonds or analogs of such linkages. Analogs of phosphodiester linkages include phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phosphoranilidate, phosphoramidate, or the like.
Nucleic acid molécules include polyribonucleic acid (RNA), polydeoxyribonucleic acid (DNA), which includes cDNA, genomic DNA, and synthetic DNA, any of which may be single or double-stranded. If single-stranded, the nucleic acid molécule may be the coding strand or non-coding (anti-sense strand). Polynucleotides (including oligonucleotides), and fragments thereof may be generated, for example, by polymerase chain reaction (PCR) or by in vitro translation, or generated by any of ligation, scission, endonuclease action, or exonuclease action.
A nucleic acid molécule encoding an amino acid sequence includes ail nucléotide sequences that encode the same amino acid sequence. Some versions of the nucléotide sequences may also include intron(s) to the extent that the intron(s) may be removed through co- or post-transcriptional mechanisms. Different nucléotide sequences may encode the same amino acid sequence as the resuit of the redundancy or degeneracy of the genetic code, or by splicing, or both.
Variants of nucleic acid molécules of this disclosure are also contemplated. Variant nucleic acid molécules are at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.9% identical a nucleic acid molécule of a defined or reference polynucleotide as described herein, or that hybridize to a polynucleotide under stringent hybridization conditions of 0.015M sodium chloride, 0.0015M sodium citrate at about 65-68°C or 0.015M sodium chloride, 0.0015M sodium citrate, and 50% formamide at about 42°C. Nucleic acid molécule variants retain the capacity to encode a fusion protein or a binding domain thereof having a functionality described herein, such as specifically binding a target molécule.
As used herein, the term sequence variant refers to any sequence having one or more alterations in comparison to a reference sequence, whereby a reference sequence is any 5 published sequence and/or of the sequences listed in the Table of Sequences and SEQ
ID Numbers (sequence listing), i.e. SEQ ID NO: 1 to SEQ ID NO: 139. Thus, the term sequence variant includes nucléotide sequence variants and amino acid sequence variants. In certain embodiments, a sequence variant in the context of a nucléotide sequence, the reference sequence is also a nucléotide sequence, whereas in certain 10 embodiments for a sequence variant in the context of an amino acid sequence, the reference sequence is also an amino acid sequence. A sequence variant as used herein can be at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the reference sequence.
Percent sequence identity refers to a relationship between two or more sequences, as determined by comparing the sequences. Methods to détermine sequence identity can be designed to give the best match between the sequences being compared. For example, the sequences may be aligned for optimal comparison purposes (e.g., gaps 20 can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment). Further, non-homologous sequences may be disregarded for comparison purposes. The percent sequence identity referenced herein is calculated over the length of the reference sequence, unless indicated otherwise. Methods to détermine sequence identity and similarity can be found in publicly 25 available computer programs. Sequence alignments and percent identity calculations may be performed using a BLAST program (e.g., BLAST 2.0, BLASTP, BLASTN, or BLASTX). The mathematical algorithm used in the BLAST programs can be found in Altschul et al., Nucleic Acids Res. 25:3389-3402, 1997. Within the context of this disclosure, it will be understood that where sequence analysis software is used for 30 analysis, the results of the analysis are based on the default values of the program referenced. Default values mean any set of values or parameters which originally load with the software when first initialized.
A sequence variant in the context of a nucleic acid (nucléotide) sequence has an altered sequence in which one or more of the nucléotides in the reference sequence is deleted, or substituted, or one or more nucléotides are inserted into the sequence of the reference nucléotide sequence. Nucléotides are referred to herein by the standard oneletter désignation (A, C, G, or T). Due to the degeneracy of the genetic code, a sequence variant of a nucléotide sequence can either resuit in a change in the respective reference amino acid sequence, i.e. in an amino acid sequence variant or not. In certain embodiments, a nucléotide sequence variant does not resuit in an amino acid sequence variant (e.g, a silent mutation). In some embodiments, a nucléotide sequence variant that results in one or more non-silent mutation is contemplated. In some embodiments, a nucléotide sequence variant of the présent disclosure encodes an amino acid sequence that is at least 80%, at least 85 %, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a reference amino acid sequence. Nucléotide and amino sequences as disclosed herein refer also to codon-optimized versions of a reference or wild-type nucléotide or amino acid sequence. In any of the embodiments described herein, a polynucleotide of the présent disclosure may be codon-optimized for a host cell containing the polynucleotide (see, e.g, Scholten et al., Clin. Immunol. 119:135-145 (2006). Codon optimization can be performed using known techniques and tools, e.g., using the GenScript® OptimumGene™ tool, or the GeneArt Gene Synthesis Tool (Thermo Fisher Scientific). Codon-optimized sequences include sequences that are partially codon-optimized (i.e., at least one codon is optimized for expression in the host cell) and those that are fully codon-optimized.
A sequence variant in the context of an amino acid sequence has an altered sequence in which one or more of the amino acids is deleted, substituted, or inserted in comparison to a reference amino acid sequence. As a resuit of the alterations, such a sequence variant has an amino acid sequence which is at least 80%, at least 85 %, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98%, or at least 99% identical to the reference amino acid sequence. For example, per 100 amino acids of the reference sequence a variant sequence that has no more than 10 alterations, i.e. any combination of délétions, insertions or substitutions, is at least 90% identical to the reference sequence.
A conservative substitution refers to amino acid substitutions that do not significantly affect or alter binding characteristics of a particular protein. Generally, conservative substitutions are ones in which a substituted amino acid residue is replaced with an amino acid residue having a similar side chain. Conservative substitutions include a 10 substitution found in one of the following groups: Group 1 : Alanine (Ala or A), Glycine (Gly or G), Serine (Ser or S), Threonine (Thr or T); Group 2: Aspartic acid (Asp or D), Glutamic acid (Glu or Z); Group 3: Asparagine (Asn or N), Glutamine (Gin or Q); Group 4: Arginine (Arg or R), Lysine (Lys or K), Histidine (His or H); Group 5: Isoleucine (Ile or I), Leucine (Leu or L), Méthionine (Met or M), Valine (Val or V); and 15 Group 6: Phenylalanine (Phe or F), Tyrosine (Tyr or Y), Tryptophan (Trp or W).
Additionally or alternatively, amino acids can be grouped into conservative substitution groups by similar function, Chemical structure, or composition (e.g., acidic, basic, aliphatic, aromatic, or sulfur-containing). For example, an aliphatic grouping may include, for purposes of substitution, Gly, Ala, Val, Leu, and Ile. Other conservative 20 substitutions groups include: sulfur-containing: Met and Cysteine (Cys or C); acidic:
Asp, Glu, Asn, and Gin; small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro, and Gly; polar, negatively charged residues and their amides: Asp, Asn, Glu, and Gin; polar, positively charged residues: His, Arg, and Lys; large aliphatic, nonpolar residues: Met, Leu, Ile, Val, and Cys; and large aromatic residues: Phe, Tyr, and Trp. 25 Additional information can be found in Creighton (1984) Proteins, W.H. Freeman and
Company.
Amino acid sequence insertions can include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more 30 residues, as well as intrasequence insertions of single or multiple amino acid residues.
Examples of terminal insertions include the fusion to the N- or C-terminus of an amino acid sequence to a reporter molécule or an enzyme.
In general, alterations in the sequence variants do not abolish or significantly reduce a desired functionality of the respective reference sequence. For example, it is preferred that a variant sequence of the présent disclosure does not significantly reduce or 5 completely abrogate the functionality of a sequence of an antibody, or antigen binding fragment thereof, to bind to the same epitope and/or to sufficiently neutralize infection of HBV and HDV as compared to antibody or antigen binding fragment having (or encoded by) the reference sequence. Guidance in determining which nucléotides and amino acid residues, respectively, may be substituted, inserted or deleted without 10 abolishing a desired structure or functionality can be found by using, e.g., known computer programs.
As used herein, a nucleic acid sequence or an amino acid sequence derived from a designated nucleic acid, peptide, polypeptide or protein refers to the origin of the 15 nucleic acid, peptide, polypeptide or protein. A nucleic acid sequence or amino acid sequence which is derived from a particular sequence may hâve an amino acid sequence that is essentially identical to that sequence or a portion thereof, from which it is derived, whereby essentially identical includes sequence variants as defined above. A nucleic acid sequence or amino acid sequence which is derived from a particular 20 peptide or protein, may be derived from the corresponding domain in the particular peptide or protein. In this context, corresponding refers to possession of a same functionality or characteristic of interest. For example, an extracellular domain corresponds to another extracellular domain (of another protein), or a transmembrane domain corresponds to another “transmembrane domain” (of another 25 protein). Corresponding parts of peptides, proteins and nucleic acids are thus easily identifiable to one of ordinary skill in the art. Likewise, a sequence derived from another (e.g., source) sequence can be identified by one of ordinary skill in the art as having its origin in the source sequence.
A nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may be identical to the starting nucleic acid, peptide, polypeptide or protein (from which it is derived). However, a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may also hâve one or more mutations relative to the starting nucleic acid, peptide, polypeptide or protein (from which it is derived), in particular a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, 5 polypeptide or protein may be a functional sequence variant as described above of the starting nucleic acid, peptide, polypeptide or protein (from which it is derived). For example, in a peptide/protein, one or more amino acid residues may be substituted with other amino acid residues, or one or more amino acid residue insertions or délétions may occur.
As used herein, the term mutation relates to a change in a nucleic acid sequence and/or in an amino acid sequence in comparison to a reference sequence, e.g. a corresponding genomic, wild type, or reference sequence. A mutation, e.g. in comparison to a reference genomic sequence, may be, for example, a (naturally 15 occurring) somatic mutation, a spontaneous mutation, an induced mutation, e.g. induced by enzymes, Chemicals or radiation, or a mutation obtained by site-directed mutagenesis (molecular biology methods for making spécifie and intentional changes in the nucleic acid sequence and/or in the amino acid sequence). Thus, the terms mutation or mutating shall be understood to also include physically making or inducing a 20 mutation, e.g. in a nucleic acid sequence or in an amino acid sequence. A mutation includes substitution, délétion and insertion of one or more nucléotides or amino acids as well as inversion of several successive nucléotides or amino acids. To achieve a mutation in an amino acid sequence, a mutation may be introduced into the nucléotide sequence encoding said amino acid sequence in order to express a (recombinant) 25 mutated polypeptide. A mutation may be achieved, for example, by altering (e.g., by site-directed mutagenesis) a codon (e.g., by alteming one, two, or three nucléotide bases therein) of a nucleic acid molécule encoding one amino acid to provide a codon that encodes a different amino acid, or that encodes a same amino acid, or by synthesizing a sequence variant.
The term introduced in the context of inserting a nucleic acid molécule into a cell, means transfection, or transformation or transduction and includes reference to the incorporation of a nucleic acid molécule into a eukaryotic or prokaryotic cell wherein the nucleic acid molécule may be incorporated into the genome of a cell (e.g., chromosome, plasmid, plastid, or mitochondrial DNA), converted into an autonomous replicon, or transiently expressed (e.g., transfected mRNA).
The term recombinant, as used herein (e.g. a recombinant antibody, a recombinant protein, a recombinant nucleic acid, or the like, refers to any molécule (antibody, protein, nucleic acid, or the like) which is prepared, expressed, created or isolated by recombinant means, and which is not naturally occurring. Recombinant can be used 10 synonymously with engineered or non-natural and can refer to to an organism, microorganism, cell, nucleic acid molécule, or vector that includes at least one genetic alteration or has been modified by introduction of an exogenous nucleic acid molécule, wherein such alterations or modifications are introduced by genetic engineering (i.e., human intervention). Genetic alterations include, for example, modifications 15 introducing expressible nucleic acid molécules encoding proteins, fusion proteins or enzymes, or other nucleic acid molécule additions, délétions, substitutions or other functional disruption of a cell’s genetic material. Additional modifications include, for example, non-coding regulatory régions in which the modifications alter expression of a polynucleotide, gene or operon.
As used herein, heterologous or non-endogenous or exogenous refers to any gene, protein, compound, nucleic acid molécule, or activity that is not native to a host cell or a subject, or any gene, protein, compound, nucleic acid molécule, or activity native to a host cell or a subject that has been altered. Heterologous, non-endogenous, or exogenous includes genes, proteins, compounds, or nucleic acid molécules that hâve 25 been mutated or otherwise altered such that the structure, activity, or both is different as between the native and altered genes, proteins, compounds, or nucleic acid molécules. In certain embodiments, heterologous, non-endogenous, or exogenous genes, proteins, or nucleic acid molécules may not be endogenous to a host cell or a subject, but instead nucleic acids encoding such genes, proteins, or nucleic acid molécules may hâve been 30 added to a host cell by conjugation, transformation, transfection, electroporation, or the like, wherein the added nucleic acid molécule may integrate into a host cell genome or can exist as extra-chromosomal genetic material (e.g., as a plasmid or other selfreplicating vector). The term homologous or homolog refers to a gene, protein, compound, nucleic acid molécule, or activity found in or derived from a host cell, species, or strain. For example, a heterologous or exogenous polynucleotide or gene encoding a polypeptide may be homologous to a native polynucleotide or gene and encode a homologous polypeptide or activity, but the polynucleotide or polypeptide may hâve an altered structure, sequence, expression level, or any combination thereof. A non-endogenous polynucleotide or gene, as well as the encoded polypeptide or activity, may be from the same species, a different species, or a combination thereof.
As used herein, the term endogenous or native refers to a polynucleotide, gene, protein, compound, molécule, or activity that is normally présent in a host cell or a subject.
As used herein, the terms cell, cell line, and cell culture are used interchangeably and ail such désignations include progeny. Thus, the words transformants and transformed cells include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that ail progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Variant progeny that hâve the same or substantially the same function, phenotype, or biological activity as screened for in the originally transformed cell are included. Where distinct désignations are intended, it will be clear from the context.
The présent disclosure provides, in part, on antibodies, antigen binding fragments, and fusion proteins that are capable of neutralizing hepatitis B and hepatitis delta viruses. Embodiments of the antibodies, antigen binding fragments, and fusion proteins according to the présent description may be used in methods of preventing, treating, or attenuating, or diagnosing HBV and HDV. In particular embodiments, the antibodies, antigen binding fragments, and fusion proteins described herein bind to two or more different génotypes of hepatitis B virus surface antigen and to two or more different infectious mutants of hepatitis B virus surface antigen. In spécifie embodiments, the
antibodies, antigen binding fragments, and fusion proteins described herein bind to ail known génotypes of hepatitis B virus surface antigen and to ail known infectious mutants of hepatitis B virus surface antigen.
Antibodies and antigen-binding fragments
In one aspect, the présent disclosure provides an isolated antibody, or an antigen binding fragment thereof, that is capable of binding to the antigenic loop région of HBsAg and is capable of neutralizing infection with hepatitis B virus and hepatitis delta 10 virus.
As used herein, and unless the context clearly indicates otherwise, antibody refers to an intact antibody comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds (though it will be understood that heavy chain 15 antibodies, which lack light chains, are still encompassed by the term antibody), as well as any antigen-binding portion or fragment of an intact antibody that has or retains the ability to bind to the antigen target molécule recognized by the intact antibody, such as, for example, a scFv, Fab, or F(ab')2 fragment. Thus, the term antibody herein is used in the broadest sense and includes polyclonal and monoclonal antibodies, 20 including intact antibodies and functional (antigen-binding) antibody fragments thereof, including fragment antigen-binding (Fab) fragments, F(ab')2 fragments, Fab' fragments, Fv fragments, recombinant IgG (rlgG) fragments, single chain antibody fragments, including single chain variable fragments (scFv), and single domain antibodies (e.g., sdAb, sdFv, nanobody) fragments. The term encompasses genetically engineered 25 and/or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, fully human antibodies, humanized antibodies, and heteroconjugate antibodies, multispecific, e.g., bispecific, antibodies, diabodies, triabodies, and tetrabodies, tandem di-scFv, tandem tri-scFv. Unless otherwise stated, the term antibody should be understood to encompass functional antibody fragments 30 thereof. The term also encompasses intact or full-length antibodies, including antibodies of any class or sub-class thereof, including IgG and sub-classes thereof, IgM, IgE, IgA, and IgD.
As used herein, the terms antigen binding fragment, fragment, and antibody fragment are used interchangeably to refer to any fragment of an antibody of the disclosure that retains the antigen-binding activity of the antibody. Examples of antibody fragments include, but are not limited to, a single chain antibody, Fab, Fab’, F(ab')2, Fv or scFv.
Human antibodies are known (e.g., van Dijk, M. A., and van de Winkel, J. G., Curr. Opin. Chem. Biol. 5 (2001) 368-374). Human antibodies can be produced in transgenic animais (e.g., mice) that are capable, upon immunization, of producing a full répertoire or a sélection of human antibodies in the absence of endogenous immunoglobulin production. Transfer of the human germ-line immunoglobulin gene array in such germline mutant mice will resuit in the production of human antibodies upon antigen challenge (see, e.g., Jakobovits, A., et al., Proc. Natl. Acad. Sci. USA 90 (1993) 25512555; Jakobovits, A., et al., Nature 362 (1993) 255-258; Bruggemann, M., et al., Year Immunol. Ί (1993) 3340). Human antibodies can also be produced in phage display libraries (Hoogenboom, H. R., and Winter, G., J. Mol. Biol. 227 (1992) 381-388; Marks, J. D., et al., J. Mol. Biol. 222 (1991) 581-597). The techniques of Cole et al. and Boemer et al. are also available for the préparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); and Boemer, P., et al., J. Immunol. 147 (1991) 86-95). Human monoclonal antibodies may be prepared by using improved EBV-B cell immortalization as described in Traggiai E, Becker S, Subbarao K, Kolesnikova L, Uematsu Y, Gismondo MR, Murphy BR, Rappuoli R, Lanzavecchia A. (2004): An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus. Nat Med. 10(8):871-5. The tenu human antibody as used herein also comprises such antibodies which are modifîed, e.g., in the variable région, to generate properties according to the antibodies and antibody fragments of the présent disclosure.
As used herein, the term variable région (variable région of a light chain (Vl), variable région of a heavy chain (Vh)) dénotés each variable région polypeptide of the pair of light and heavy chains which, in most instances, is involved directly in binding the antibody to the antigen.
Antibodies according to the présent disclosure can be of any isotype (e.g., IgA, IgG, 5 IgM, IgE, IgD; i.e., comprising a α, γ, μ, ε, or δ heavy chain). Within the IgG isotype, for example, antibodies may be IgGl, IgG2, IgG3 or IgG4 subclass. In spécifie embodiments, an antibody of the présent disclosure is an IgGl antibody. Antibodies or antigen binding fragments provided herein may include a κ or a λ light chain. In certain embodiments, HBsAg-specific antibodies described herein are of the IgG isotype and 10 may block the release of HBV and HBsAg from infected cells. Accordingly, in certain embodiments, an antibody according to the présent description can bind intracellularly and thereby block the release of HBV virions and HBsAg.
The terms VL and VH refer to the variable binding région from an antibody light 15 and heavy chain, respectively. The variable binding régions are made up of discrète, well-defined sub-regions known as complementarity determining régions (CDRs) and framework régions (FRs). The terms complementarity determining région and CDR are synonymous with hypervariable région or HVR, and are known in the art to refer to sequences of amino acids within TCR or antibody variable régions, which 20 confer antigen specificity and/or binding affinity and are separated by framework sequence. In general, there are three CDRs in each variable région of an immunoglobulin binding protein; e.g., for antibodies, the VH and VL régions comprise six CDRs HCDR1, HCDR2, HCDR3; LCDR1, LCDR2, LCDR3; also referred to herein as CDRH1, CDRH2, CDRH3,CDRL1, CDRL2, and CDRL3, respectively). As 25 used herein, a variant of a CDR refers to a functional variant of a CDR sequence having up to 1 -3 amino acid substitutions, délétions, or combinations thereof.
Immunoglobulin sequences can be aligned to a numbering scheme (e.g., Kabat, EU, International Immunogenetics Information System (IMGT) and Aho), which can allow 30 équivalent residue positions to be annotated and for different molécules to be compared using Antigen receptor Numbering And Receptor Classification (ANARCI) software tool (2016, Bioinformatics 15:298-300). It will be understood that in certain embodiments, an antibody or antigen binding fragment of the present disclosure can comprise ail or part of a heavy chain (HC), a light chain (LC), or both. For example, a full-length intact IgG antibody monomer typically includes a VH, a CH1, a CH2, a CH3, a VL, and a CL. Fc components are described further herein. In certain 5 embodiments, an antibody or antigen binding fragment of the present disclosure comprises a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3 according to any one ofthe presently disclosed VH and VL sequences, respectively.
Table 1 shows the amino acid sequences of heavy chain variable régions (VH), light 10 chain variable régions (VL), CDRs, heavy chains (HC), and light chains (LC) of certain exemplary antibodies according to the present disclosure.
Antibody sequence description | SEQ IDNO: | Amino acid sequence |
HBC34-V35 VH; HBC34-V34 VH; HBC23-LC40A VH; HBC23-LC40S VH; HBC34-LC40A VH; HBC34-LC40S VH | 41 | ELQLVESGGGWVQPGGSQRLSCAAS GRIFRSFYMSWVRQAPGKGLEWVATI NQDGSEKLYVDSVKGRFTISRDNAKN SLFLQMNNLRVEDTAVYYCAAWSGN SGGMDVWGQGTTVSVSS |
HBC34v31LC40A VH HBC34v31_LC40S VH HBC34v32_LC40A VH HBC34v32_LC40S VH HBC34v33_LC40A VH HBC34v32_LC40S VH | 67 | EVQLVESGGGLVQPGGSLRLSCAASG RIFRSFYMSWVRQAPGKGLEWVANIN QDGSEKLYVDSVKGRFTISRDNAKNS LFLQMNNLRVEDTAVYYCAAWSGNS GGMDVWGQGTTVTVSS |
HBC34-V35 VL | 89 | SYELTQPPSVSVSPGQTVSIPCSGDKL GNKNVAWFQHKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEAAYFCQTFDSTTVVFGGGTRLTV L |
HBC34-V34 VL | 90 | SYELTQPPSVSVSPGQTVSIPCSGDKL |
Antibody sequence description | SEQ ID NO: | Amino acid sequence |
GNKNVSWFQHKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEAAYFCQTFDSTTVVFGGGTRLTV L | ||
HBC34-V23-VL _C40S | 110 | SYELTQPPSVSVSPGQTASITCSGDKL GNKNASWYQQKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEADYYCQTFDSTTVVFGGGTKLT VL |
HBC34-V23-VL C40A | 111 | SYELTQPPSVSVSPGQTASITCSGDKL GNKNAAWYQQKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEADYYCQTFDSTTVVFGGGTKLT VL |
HBC34-V31-VL _C40S | 112 | SYELTQPPSVSVSPGQTVSIPCSGDKL GNKNVSWFQHKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEAAYFCQTWDSTTWFGGGTRLT VL |
HBC34-V31-VLC40A | 113 | SYELTQPPSVSVSPGQTVSIPCSGDKL GNKNVAWFQHKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEAAYFCQTWDSTTWFGGGTRLT VL |
HBC34-V32-VL_C40S | 114 | SYELTQPPSVSVSPGQTVSIPCSGDKL GNKNVSWFQHKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEAAYFCQTFDSTTVVFGGGTRLTV L |
HBC34-V32-VL _C40A | 115 | S YELTQPPS VS VSPGQTVSIPC SGDKL |
Antibody sequence description | SEQ ID NO: | Amino acid sequence |
GNKNVAWFQHKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEAAYFCQTFDSTTVVFGGGTRLTV L | ||
HBC34-V33-VL_C40S | 116 | SYELTQPPSVSVSPGQTASITCSGDKL GNKNASWYQQKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEADYYCQTFDSTTVVFGGGTKLT VL |
HBC34-V33-VL _C40A | 117 | SYELTQPPSVSVSPGQTASITCSGDKL GNKNAAWYQQKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEADYYCQTFDSTTVVFGGGTKLT VL |
HBC34-VL_C40S | 118 | SYELTQPPSVSVSPGQTVSIPCSGDKL GNKNVSWFQHKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEAAYFCQTWDSTTVVFGGGTRLT VL |
HBC34-VL_C40A | 119 | SYELTQPPSVSVSPGQTVSIPCSGDKL GNKNVAWFQHKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEAAYFCQTWDSTTVVFGGGTRLT VL |
HBC34-V35CDRH1; HBC34-V34 CDRH1; HBC34-V23LC40S CDRH1; HBC34-V23_LC40A CDRH1; HBC34-V31_LC40S CDRH1; HBC34-V31_LC40A CDRH1; | 34 | GRIFRSFY |
Antibody sequence description | SEQ ID NO: | Amino acid sequence |
HBC34-V32_LC40S CDRH1; HBC34-V32LC40A CDRH1; HBC34-V33_LC40S CDRH1; HBC34-V33 LC40A CDRH1; HBC34_LC40S CDRH1; HBC34_LC40A CDRH1 | ||
HBC34-V35 CDRH2; HBC34-V34 CDRH2; HBC34-V23_LC40S CDRH2; HBC34-V23LC40A CDRH2; HBC34-V31LC40S CDRH2; HBC34-V31LC40A CDRH2; HBC34-V32_LC40S CDRH2; HBC34-V32_LC40A CDRH2; HBC34-V33_LC40S CDRH2; HBC34-V33_LC40A CDRH2; HBC34 LC40S CDRH2; HBC34_LC40A CDRH2 (short CDRH2) | 35 | NQDGSEK |
HBC34-V35 CDRH2; HBC34-V34 CDRH2; HBC34-V23_LC40S CDRH2; HBC34-V23_LC40A CDRH2; HBC34-V31_LC40S CDRH2; HBC34-V31LC40A CDRH2; HBC34-V32 LC40S CDRH2; HBC34-V32_LC40A CDRH2; HBC34-V33_LC40S CDRH2; HBC34-V33_LC40A CDRH2; HBC34 LC40S CDRH2; | 66 | INQDGSEK |
Antibody sequence description | SEQ ID NO: | Amino acid sequence |
HBC34_LC40A CDRH2 (long CDRH2) | ||
HBC34-V35 CDRH3; HBC34-V34 CDRH3; HBC34-V23_LC40S CDRH3; HBC34-V23_LC40A CDRH3; HBC34-V31LC40S CDRH3; HBC34-V31_LC40A CDRH3; HBC34-V32LC40S CDRH3; HBC34-V32_LC40A CDRH3; HBC34-V33_LC40S CDRH3; HBC34-V33 LC40A CDRH3; HBC34_LC40S CDRH3; HBC34 LC40A CDRH3 | 36 | AAWSGNSGGMDV |
HBC34-V35 CDRL1; HBC34-V34 CDRL1; HBC34-V23_LC40S CDRL1; HBC34-V23 LC40A CDRL1; HBC34-V31_LC40S CDRL1; HBC34-V31LC40A CDRL1; HBC34-V32_LC40S CDRL1; HBC34-V32 LC40A CDRL1; HBC34-V33_LC40S CDRL1; HBC34-V33_LC40A CDRL1; HBC34_LC40S CDRL1; HBC34_LC40A CDRL1 | 37 | KLGNKN |
HBC34-V35 CDRL2; HBC34-V34 CDRL2; HBC34-V23_LC40S CDRL2; HBC34-V23 LC40A CDRL2; | 38 | EVK |
Antibody sequence description | SEQ ID NO: | Amino acid sequence |
HBC34-V31LC40S CDRL2; HBC34-V31_LC40A CDRL2; HBC34-V32LC40S CDRL2; HBC34-V32LC40A CDRL2; HBC34-V33_LC40S CDRL2; HBC34-V33_LC40A CDRL2; HBC34LC40S CDRL2; HBC34LC40A CDRL2 (short CDRL2) | ||
HBC34-V35 CDRL2; HBC34-V34 CDRL2; HBC34-V23LC40S CDRL2; HBC34-V23_LC40A CDRL2; HBC34-V31LC40S CDRL2; HBC34-V31_LC40A CDRL2; HBC34-V32 LC40S CDRL2; HBC34-V32_LC40A CDRL2; HBC34-V33_LC40S CDRL2; HBC34-V33 LC40A CDRL2; HBC34 LC40S CDRL2; HBC34 LC40A CDRL2 (long LCDR2) | 39 | VIYEVKYRP |
HBC34-V35 CDRL3; HBC34-V34 CDRL3; HBC34-V23_LC40S CDRL3; HBC34-V23_LC40A CDRL3; HBC34-V32 LC40S CDRL3; HBC34-V32_LC40A CDRL3; HBC34-V33_LC40S CDRL3; HBC34-V33_LC40A CDRL3; | 58 | QTFDSTTVV |
Antibody sequence description | SEQ ID NO: | Amino acid sequence |
HBC34LC40S CDRL3; HBC34LC40A CDRL3; HBC34-V31LC40S CDRL3; HBC34-V31LC40A CDRL3; | 40 | QTWDSTTVV |
HC of HBC34-V35-MLNS- GAALIE and HBC34-V34- MLNS-GAALIE (glM17, 1) | 91 | ELQLVESGGGWVQPGGSQRLSCAAS GRIFRSFYMSWVRQAPGKGLEWVATI NQDGSEKLYVDSVKGRFTISRDNAKN SLFLQMNNLRVEDTAVYYCAAWSGN SGGMDVWGQGTTVSVSSASTKGPSV FPLAPSSKSTSGGTAALGCLVKDYFPE PVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHK PSNTKVDKKVEPKSCDKTHTCPPCPA PELLAGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPLPEEKTI SKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVLHEALHSHYTQKS LSLSPGK |
HC of HBC34-V35-MLNS and HBC34-V34-MLNS | 92 | ELQLVESGGGWVQPGGSQRLSCAAS GRIFRSFYMSWVRQAPGKGLEWVATI NQDGSEKLYVDSVKGRFTISRDNAKN SLFLQMNNLRVEDTAVYYCAAWSGN SGGMDVWGQGTTVSVSSASTKGPSV FPLAPS SKSTSGGTAALGCL VKDYFPE PVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHK |
Antibody sequence description | SEQ ID NO: | Amino acid sequence |
PSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVLHEALHSHYTQKS LSLSPGK | ||
LC ofHBC34-V35 | 93 | SYELTQPPSVSVSPGQTVSIPCSGDKL GNKNVAWFQHKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEAAYFCQTFDSTTVVFGGGTRLTV LGQPKAAPSVTLFPPSSEELQANKATL VCLISDFYPGAVTVAWKADSSPVKAG VETTTPSKQSNNKYAASSYLSLTPEQ WKSHRSYSCQVTHEGSTVEKTVAPTE CS |
LC of HBC34-V34 | 94 | S YELTQPPS VS VSPGQTVSIPC SGDKL GNKNVSWFQHKPGQSPVLVIYEVKY RPSGIPERFSGSNSGNTATLTISGTQA MDEAAYFCQTFDSTTVVFGGGTRLTV LGQPKAAPSVTLFPPSSEELQANKATL VCLISDFYPGAVTVAWKADSSPVKAG VETTTPSKQSNNKYAAS S YLSLTPEQ WKSHRSYSCQVTHEGSTVEKTVAPTE CS |
HBC24 VH | 95 | EVQLLESGGGLVQPGGSLRLSCAASG STFTKYAMSWVRQAPGKGLEWVASI |
Antibody sequence description | SEQ ID NO: | Amino acid sequence |
SGSVPGFGIDTYYADSVKGRFTISRDT SKNTLYLQMNSLRAEDTALYYCAKD VGVIGSYYYYAMDVWGQGTAVTVSS | ||
HBC24 VL | 96 | EIVLTQSPGTLSLSPGERATLSCRASQ GLSSSYLAWYQQKPGQAPRLLIYSAS TRATGIPDRFSGSGSGTDFTLTISRLEP EDFAVYYCQQYAYSPRWTFGQGTKV EIK |
HBC24 CDRH1 | 97 | GSTFTKYA |
HBC24 CDRH2 | 98 | ISGSVPGF |
HBC24 CDRH3 | 99 | LYYCAKDVGVIGSYYYYAMDV |
HBC24 CDRL1 | 100 | QGLSSSY |
HBC24 CDRL2 | 101 | SAS |
HBC24 CDRL3 | 102 | QQYAYSPRWT |
HBC34-V7, HBC34-V34, HBC34-V35 HC (VH-hinge-CH 1-CH2- CH3) (wild-type) | 129 | ELQLVESGGGWVQPGGSQRLSCAAS GRIFRSFYMSWVRQAPGKGLEWVATI NQDGSEKLYVDSVKGRFTISRDNAKN SLFLQMNNLRVEDTAVYYCAAWSGN SGGMDVWGQGTTVSVSSASTKGPSV FPLAPSSKSTSGGTAALGCLVKDYFPE PVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHK PSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDK |
Antibody sequence description | SEQ ID NO: | Amino acid sequence |
SRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK | ||
WT hlgGl Fc | 137 | APELLGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPGK |
HBC34-V7, HBC34-V23, HBC34-V34, HBC34-V35, HBC34_C40S, HBC34_C40A, HBC34-V23_C40S, HBC34-V23C40A HC with GAALIE mutation in hlgGl Fc | 138 | ELQLVESGGGWVQPGGSQRLSCAAS GRIFRSFYMSWVRQAPGKGLEWVATI NQDGSEKLYVDSVKGRFTISRDNAKN SLFLQMNNLRVEDTAVYYCAAWSGN SGGMDVWGQGTTVSVSSASTKGPSV FPLAPSSKSTSGGTAALGCLVKDYFPE PVTVSWNSGALTSGVHTFPAVLQSSG L YSLSS V VTVPS S SLGTQTYICNVNHK PSNTKVDKKVEPKSCDKTHTCPPCPA PELLAGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPLPEEKTI SKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK |
Fragments of the antibodies described herein can be obtained from the antibodies by methods that include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by Chemical réduction. Altematively, fragments of the antibodies can be obtained by cloning and expression of part of the sequences of the heavy or light chains. The présent disclosure encompasses single-chain Fv fragments (scFv) derived from the heavy and light chains of an antibody as described herein, including, for example, an scFv comprising the CDRs from an antibody according to the présent description, heavy or light chain monomers and dimers, single domain heavy chain antibodies, single domain light chain antibodies, as well as single chain antibodies, in which the heavy and light chain variable domains are joined by a peptide linker.
In certain embodiments, an antibody according to the présent disclosure, or an antigen binding fragment thereof, comprises a purified antibody, a monoclonal antibody, a single chain antibody, Fab, Fab’, F(ab')2, Fv or scFv.
Antibodies and antigen binding fragments of the présent disclosure may, in embodiments, be multispecific (e.g., bispecific, trispecific, tetraspecific, or the like), and may be provided in any multispecific format, as disclosed herein. In certain embodiments, an antibody or antigen-binding fragment of the présent disclosure is a multispecific antibody, such as a bispecific or trispecific antibody. Formats for bispecific antibodies are disclosed in, for example, Spiess et al., Mol. Immunol. 67(2):95 (2015), and in Brinkmann and Kontermann, mAbs 9(2):182-212 (2017), which bispecific formats and methods of making the same are incorporated herein by reference and include, for example, Bispecific T cell Engagers (BiTEs), DARTs, Knobs-Into-Holes (KIH) assemblies, scFv-CH3-KIH assemblies, K.IH Common LightChain antibodies, TandAbs, Triple Bodies, TriBi Minibodies, Fab-scFv, scFv-CH-CLscFv, F(ab')2-scFv2, tetravalent HCabs, Intrabodies, CrossMabs, Dual Action Fabs (DAFs) (two-in-one or four-in-one), DutaMabs, DT-IgG, Charge Pairs, Fab-arm Exchange, SEEDbodies, Triomabs, LUZ-Y assemblies, Fcabs, κλ-bodies, orthogonal Fabs, DVD-IgGs, IgG(H)-scFv, scFv-(H)IgG, IgG(L)-scFv, scFv-(L)IgG, IgG(L,H)-Fv,
IgG(H)-V, V(H)-IgG, IgG(L)-V, V(L)-IgG, KIH IgG-scFab, 2scFv-IgG, IgG-2scFv, scFv4-Ig, Zybody, and DVI-IgG (four-in-one). A bispecific or multispecific antibody may comprise a HBV- and/or HDV-specific binding domain of the instant disclosure in combination with another HBV- and/or HDV-specific binding domain of the instant disclosure, or in combination with a different binding domain that specifically binds to HBV and/or HDV (e.g., at a same or a different epitope), or with a binding domain that specifically binds to a different antigen.
Antibody fragments of the disclosure may impart monovalent or multivalent interactions and be contained in a variety of structures as described above. For instance, scFv molécules may be synthesized to create a trivalent triabody or a tetravalent tetrabody. The scFv molécules may include a domain of the Fc région resuiting in bivalent minibodies. In addition, the sequences of the disclosure may be a component of multispecific molécules in which the sequences of the disclosure target the epitopes of the disclosure and other régions of the molécule bind to other targets. Exemplary molécules include, but are not limited to, bispecific Fab2, trispecific Fab3, bispecific scFv, and diabodies (Holliger and Hudson, 2005, Nature Biotechnology 9: 1126-1136).
Antibodies or antigen-binding fragments thereof such as those described herein, including but not limited to scFv, may, in certain embodiments, be comprised in a fusion protein that is capable of specifically binding to an antigen as described herein. As used herein, fusion protein refers to a protein that, in a single chain, has at least two distinct domains or motifs, wherein the domains or motifs are not naturally found together, or in the given arrangement, in a protein. A polynucleotide encoding a fusion protein may be constructed using PCR, recombinantly engineered, or the like, or such fusion proteins can be synthesized.
In some embodiments, a fusion protein is capable of expression at a surface of a host cell, e.g., a T cell, NK cell, or NK-T cell. In certain embodiments, a fusion protein comprises (i) an extracellular component comprising the antibody or antigen binding fragment thereof (e.g., a scFv); (ii) a transmembrane component (e.g., a transmembrane domain from CD4, CD8, CD27, CD28, or a functional variant or portion thereof, or any combination thereof); and (iii) an intracellular component comprising a signaling domain from a costimulatory protein, or a functional variant or portion thereof (e.g., a signaling domain from from CD27, CD28, 4-1BB (CD137), 0X40 (CD134), CD2, CD5, ICAM-1 (CD54), LFA-1 (CDlla/CD18), ICOS (CD278), GITR, CD30, CD40, BAFF-R, HVEM, LIGHT, MKG2C, SLAMF7, NKp80, CD160, B7-H3, a ligand that specifically binds with CD83, or a functional variant thereof, or any combination thereof), and/or an effector domain (e.g., from CD3a, CD3ô, CD3ζ, CD25, CD79A, CD79B, CARD 11, DAP10, FcRa, FcRp, FcRy, Fyn, HVEM, ICOS, Lck, LAG3, LAT, LRP, NKG2D, NOTCH1, NOTCH2, NOTCH3, NOTCH4, Wnt, ROR2, Ryk, SLAMF1, Slp76, pTa, TCRa, TCRP, TRIM, Zap70, PTCH2, or any combination thereof).
In certain embodiments, a fusion protein comprising an antibody or antigen binding fragment comprises a chimeric antigen receptor molécule (CAR), which may be expressed on a cell surface of a host cell such as a T cell, a NK cell, or a NK-T cell for use in a cellular immunotherapy. CAR molécules and principles of design are described in, for example: Sadelain et al., Cancer Discov., 3(4):388 (2013); Harris and Kranz, Trends Pharmacol. Sci., 37(3):220 (2016); Stone et al., Cancer Immunol. Immunother., 63(11):1163 (2014); Xu et al., 2018 Oncotarget 9:13991; Androulla et al., 2018 Curr. Pharm. Biotechnol. Volume 19 (April 2018); Wu et al., 2016 Expert Opin. Biol. Ther. 16:1469; Ren et al., 2017 Protein Cell 8:634; which CAR molécules, CAR designs, and CAR design principles are herein incorporated by reference in their entirety.
Throughout this disclosure, antibodies, antigen binding fragments thereof, and fusion proteins may individually or collectively (e.g., in any combination) be referred to as binding proteins
Binding proteins according to the present disclosure may be provided in purified form. For example, an antibody may be present in a composition that is substantially free of other polypeptides e.g., where less than 90% (by weight), usually less than 60% and more usually less than 50% of the composition is made up of other polypeptides.
Binding proteins according to the présent disclosure may be immunogenic in human and/or in non-human (or heterologous) hosts; e.g., in mice. For example, an antibody may hâve an idiotope that is immunogenic in non-human hosts, but not in a human host. Antibodies of the disclosure for human use include those that are not typically isolated from hosts such as mice, goats, rabbits, rats, non-primate mammals, or the like, and in some instances are not obtained by humanization or from xeno-mice. Also contemplated herein are variant forms of the disclosed antibodies, which are engineered so as to reduce known or potential immunogenicity and/or other potential liabilities, or to confer a desired structure and/or functionality of the antibody in a non-human animal, such as a mouse (e.g., a murinized antibody wherein one or more human amino acid residue, sequence, or motif is repiaced by a residue, sequence, or motif that has reduced or abrogated immunogenicity or other liability, or has a desired structure and/or function, in a mouse; e.g., for model studies using a mouse).
Amino acid sequences of exemplary murinized antibodies of the présent disclosure are provided in Table 2.
Murinized antibody sequence description | SEQID NO. | Amino acid sequence |
HBC34-V7-mu (IgG2a) HC | 122 | ELQL VESGGG WVQPGG SQRLSC AASGRIFRSF Y MSWVRQAPGKGLEWVATINQDGSEKLYVDSV KGRFTISRDNAKNSLFLQMNNLRVEDTAVYYC AAWSGNSGGMDVWGQGTTVSVSSAKTTAPSV YPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLT WNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSS TWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPC PPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIV |
TCVWDVSEDDPDVQISWFVNNVEVHTAQTQT HREDYNSTLRVVSALPIQHQDWMSGKEFKCKV NNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEE MTKKQVTLTCMVTDFMPEDIYVEWTNNGKTE LNYKNTEPVLDSDGSYFMYSKLRVEKKNWVE RNSYSCSVVHEGLHNHHTTKSFSRTPGK | ||
HBC34-V7-mu (IgG2a) LC | 123 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVC WFQHKPGQSPVLVIYEVKYRPSGIPERFSGSNS GNTATLTISGTQAMDEAAYFCQTFDSTTVVFG GGTRLTVLGQPKSSPSVTLFPPSSEELETNKATL VCTITDFYPGVVTVDWKVDGTPVTQGMETTQP SKQSNNKYMASSYLTLTARAWERHSSYSCQVT HEGHTVEKSLSRADCS |
HBC34-V35-mu (IgG2a) HC | 124 | ELQLVESGGGWVQPGGSQRLSCAASGRIFRSFY MSWVRQAPGKGLEWVATINQDGSEKLYVDSV KGRFTISRDNAKNSLFLQMNNLRVEDTAVYYC AAWSGNSGGMDVWGQGTTVSVSSAKTTAPSV YPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLT WNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSS TWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPC PPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIV TCVVVDVSEDDPDVQISWFVNNVEVHTAQTQT HREDYNSTLRVVSALPIQHQDWMSGKEFKCKV NNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEE MTKKQVTLTCMVTDFMPEDIYVEWTNNGKTE LNYKNTEPVLDSDGSYFMYSKLRVEKKNWVE RNSYSCSVVHEGLHNHHTTKSFSRTPGK |
HBC34-V35-mu (IgG2a) LC | 125 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVA WFQHKPGQSPVLVIYEVKYRPSGIPERFSGSNS GNTATLTISGTQAMDEAAYFCQTFDSTTVVFG GGTRLTVLGQPKSSPSVTLFPPSSEELETNKATL |
VCTITDFYPGVVTVDWKVDGTPVTQGMETTQP SKQSNNK YMAS S YLTLTARA WERHS S YSCQ VT HEGHTVEKSLSRADC S | ||
HBC24-mu (IgG2a) HC | 126 | EVQLLESGGGLVQPGGSLRLSCAASGSTFTKYA MSWVRQAPGKGLEWVASISGSVPGFGIDTYYA DSVKGRFTISRDTSKNTLYLQMNSLRAEDTAL YYCAKDVGVIGSYYYYAMDVWGQGTAVTVS SAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKG YFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTL SSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDV LMISLSPIVTCVWDVSEDDPDVQISWFVNNVE VHTAQTQTHREDYNSTLRVVSALPIQHQDWMS GKEFKCKVNNKDLPAPIERTISKPKGSVRAPQV YVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVE WTNNGKTELNYKNTEPVLDSDGSYFMYSKLR VEKKNWVERNSYSCSVVHEGLHNHHTTKSFSR TPGK |
HBC24-mu (IgG2a) LC | 127 | EIVLTQSPGTLSLSPGERATLSCRASQGLSSSYL AWYQQKPGQAPRLLIYSASTRATGIPDRFSGSG SGTDFTLTISRLEPEDFAVYYCQQYAYSPRWTF GQGTKVEIKADAAPTVSIFPPSSEQLTSGGASV VCFLNNFYPKDINVKWKIDGSERQNGVLNSWT DQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA THKTSTSPIVKSFNRNEC |
As used herein, a neutralizing antibody (or antigen binding fragment, or fusion protein) is one that can neutralize, i.e., prevent, inhibit, reduce, impede or interfère with, the ability of a pathogen to initiate and/or perpetuate an infection in a host (e.g., host organism or host cell). The terms neutralizing antibody and an antibody that neutralizes or antibodies that neutralize are used interchangeably herein. These antibodies can be used alone, or in combination (e.g., two or more of the presently disclosed antibodies in a combination, or an antibody of the présent disclosure in combination with another agent, which may or may not be an antibody agent, including an antibody that is capable of neutralizing an HBV B and/or D infection), as prophylactic or therapeutic agents upon appropriate formulation, in association with active vaccination, as a diagnostic tool, or as a production tool as described herein.
As used herein, specifically binds or spécifie for refers to an association or union of a binding protein (e.g., an antibody or antigen binding fragment thereof) or a binding domain to a target molécule with an affinity or Ka (i.e., an equilibrium association constant of a particular binding interaction with units of 1/M) equal to or greater than 105 M’1 (which equals the ratio of the on-rate [Kon] to the off rate [Koff] for this association reaction), while not significantly associating or uniting with any other molécules or components in a sample. Binding proteins or binding domains may be classified as high-affinity binding proteins or binding domains or as low-affinity binding proteins or binding domains. High-affinity binding proteins or binding domains refer to those binding proteins or binding domains having a Ka of at least 107 M'1, at least 108 M'1, at least 109 M’1, at least 1010 M'1, at least 1011 M’1, at least 1012 M' or at least 1013 M’1. Low-affinity binding proteins or binding domains refer to those binding proteins or binding domains having a Ka of up to 107 M’1, up to 106 M’1, or up to 105 M’1. Altematively, affinity may be defined as an equilibrium dissociation constant (Kd) of a particular binding interaction with units of M (e.g., ΙΟ’5 M to 10'13 M). The terms binding and specifically binding and similar references do not encompass non-specific sticking.
Binding of a binding protein can be determined or assessed using an appropriate assay, such as, for example, Surface Plasmon Résonance (SPR) methods, e.g., a Biacore™ system; kinetic exclusion assays such as KinExA®; and BioLayer interferometry (e.g., using the ForteBio® Octet platform); isothermal titration calorimetry (ITC), or the like, an antigen-binding ELISA (e.g., direct or indirect) with imaging by, e.g., optical density at 450nm, or by flow cytometry, or the like.
In certain embodiments, binding proteins according to the présent disclosure can bind to the antigenic loop région of HBsAg. The envelope of the hepatitis B virus generally contains three HBV envelope proteins (also known as HBsAg, hepatitis B surface antigen): S protein (for small, also referred to as S-HBsAg), M protein (for middle, also referred to as M-HBsAg) and L protein (for large, also referred to as L-HBsAg). S-HBsAg, Μ-HBsAg and L-HBsAg share the same C-terminal extremity (also referred to as S domain, 226 amino acids), which corresponds to the S protein (S-HBsAg) and which is crucial for virus assembly and infectivity. S-HBsAg, Μ-HBsAg and L-HBsAg are synthesized in the endoplasmic réticulum (ER), assembled, and secreted as particles through the Golgi apparatus. The S domain comprises four predicted transmembrane (TM) domains, whereby both the N-terminus as well as the C-terminus of the S domain are exposed to the lumen. The transmembrane domains TM1 and TM2 are both believed necessary for cotranslational protein intégration into the ER membrane and the transmembrane domains TM3 and TM4 are located in the C-terminal third of the S domain. The antigenic loop région of HBsAg is located between the predicted TM3 and TM4 transmembrane domains of the S domain of HBsAg, whereby the antigenic loop région comprises amino acids 101 - 172 of the S domain, which contains 226 amino acids in total (Salisse J. and Sureau C., 2009, Journal of Virology 83: 93219328). A déterminant of infectivity résides in the antigenic loop région of HBV envelope proteins. In particular, residues between 119 and 125 ofthe HBsAg contain a CXXC motif, which is considered to be important for the infectivity of HBV and HDV (Jaoude GA, Sureau C, Journal of Virology, 2005;79:10460-6).
When positions in the amino acid sequence of the S domain of HbsAg are referred to herein, such positions are made with reference to the amino acid sequence as set forth in SEQ ID NO: 3 (shown below) or to natural or artificial sequence variants thereof.
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQS PTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG SSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWA SARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFF CLWVYI (SEQ ID NO: 3; amino acids 101 - 172 are shown underlined)
For example, the expression amino acids 101 - 172 of the S domain refers to the amino acid residues from positions 101 - 172 of the polypeptide according to SEQ ID NO: 3. However, a person skilled in the art understands that mutations or variations (including, but not limited to, substitution, délétion and/or addition, for example, HBsAg of a different génotype or a different HBsAg mutant as described herein) may occur naturally in the amino acid sequence of the S domain of HBsAg or be introduced artificially into the amino acid sequence of the S domain of HBsAg without affecting its biological properties. Therefore, as used herein, the term S domain of HBsAg encompasses ail such polypeptides including, for example, the polypeptide according to SEQ ID NO: 3 and its natural or artificial mutants. In addition, when sequence fragments of the S domain of HBsAg are described herein (e.g. amino acids 101 - 172 or amino acids 120 -130 of the S domain of HBsAg), they include not only the corresponding sequence fragments of SEQ ID NO: 3, but also the corresponding sequence fragments of its natural or artificial mutants. For example, the phrase amino acid residues from positions 101 - 172 ofthe S domain ofHBsAg encompasses amino acid residues from positions 101 - 172 of SEQ ID NO: 3 and the corresponding fragments of its mutants (natural or artificial mutants). As used herein, the phrases corresponding sequence fragments and corresponding fragments referto fragments that are located in equal positions of sequences when the sequences are subjected to optimized alignment, namely, the sequences are aligned to obtain a highest percentage of identity.
The M protein (Μ-HBsAg) corresponds to the S protein extended by an N-terminal domain of 55 amino acids called pre-S2. The L protein (L-HBsAg) corresponds to the M protein extended by an N-terminal domain of 108 amino acids called pre-Sl (génotype D). The pre-Sl and pre-S2 domains of the L protein can be présent either at the inner face of viral particles (on the cytoplasmic side of the ER), and is believed to play a crucial rôle in virus assembly, or on the outer face (on the luminal side of the ER), available for the interaction with target cells and important for viral infectivity. Moreover, HBV surface proteins (HBsAgs) are not only incorporated into virion envelopes but also can spontaneously bud from ER-Golgi intermediate compartment membranes to form empty subviral particles (SVPs) that are released from the cell by sécrétion.
In some embodiments, an antibody, antigen binding fragment, or fusion protein binds to the antigenic loop région of HBsAg, and is capable of binding to ail of S-HBsAg, MHBsAg and L-HBsAg.
In some embodiments, an antibody, an antigen binding fragment, or fusion protein neutralizes infection with hepatitis B virus and hepatitis delta virus. In some embodiments, the antibody, or the antigen binding fragment thereof, reduces viral infectivity of hepatitis B virus and hepatitis delta virus.
To study and quantitate virus infectivity (or neutralization) in the laboratory, standard neutralization assays may be utilized. For a neutralization assay, animal viruses are typically propagated in cells and/or cell lines. A neutralization assay wherein cultured cells are incubated with a fixed amount of HBV or HDV in the presence (or absence) of the antibody (or antigen-binding fragment or fusion protein) to be tested may be used. In such an assay, the levels of hepatitis B surface antigen (HBsAg) or hepatitis B e antigen (HBeAg) secreted into the cell culture supernatant may be used and/or HBeAg staining may be assessed to provide a readout. For HDV, for example, delta antigen immunofluorescence staining may be assessed.
In a particular embodiment of an HBV neutralization assay, cultured cells, for example HepaRG cells, such as differentiated HepaRG cells, are incubated with a fixed amount of HBV in the presence or absence of the antibody to be tested. In such and embodiment, incubation may be carried out, for example, for 16 hours at 37°C. That incubation may be performed in a medium (e.g. supplemented with 4% PEG 8000). After incubation, cells may be washed and further cultivated. To measure virus infectivity, the levels of hepatitis B surface antigen (HBsAg) and hepatitis B e antigen (HBeAg) secreted into the culture supernatant, e.g. from day 7 to day 11 post-infection, may be determined by enzyme-linked immunosorbent assay (ELISA). Additionally,
HBeAg staining may be assessed in an immunofluorescence assay. In an embodiment of a HDV neutralization assay, essentially the same assay as for HBV may be used, with the différence that sera from HDV carriers may be used as HDV infection inoculum on differentiated HepaRg cells (instead of HBV). For détection, delta antigen immunofluorescence staining may be used as a readout.
Embodiments of the binding proteins of the disclosure hâve high neutralizing potency.
In certain embodiments, the concentration of an antibody as described herein required for 50% neutralization of hepatitis B virus (HBV) and hepatitis delta virus (HDV), is, 10 for example, about 10 pg/ml or less. In other embodiments, the concentration of a binding protein required for 50% neutralization of HBV and HDV is about 5 pg/ml. In other embodiments, the concentration of a binding protein as described herein required for 50% neutralization of HBV and HDV is about 1 pg/ml. In still other embodiments, the concentration of a binding protein required for 50% neutralization of HBV and 15 HDV is about 750 ng/ml. In yet further embodiments, the concentration of a binding protein as described herein required for 50% neutralization of HBV and HDV is 500 ng/ml or less. In such embodiments, the concentration of abinding protein as described herein required for 50% neutralization of HBV and HDV may be selected from 450 ng/ml or less, 400 ng/ml or less, 350 ng/ml or less, 300 ng/ml or less, 250 ng/ml or less, 20 200 ng/ml or less, 175 ng/ml or less, 150 ng/ml or less, 125 ng/ml or less, 100 ng/ml or less, 90 ng/ml or less, 80 ng/ml or less, 70 ng/ml or less, 60 ng/ml or less or 50 ng/ml or less.
Antibodies or antigen binding fragments according to the présent disclosure, which can 25 neutralize both HBV and HDV, are useful in the prévention and treatment of hepatitis B and hepatitis D. Infection with HDV typically occurs simultaneously with or subséquent to infection by HBV (e.g., inoculation with HDV in the absence of HBV does not cause hepatitis D since HDV requires the support of HBV for its own réplication) and hepatitis D is typically observed in chronic HBV carriers.
Embodiments of the disclosed binding proteins promote clearance of HBsAg and HBV. In particular embodiments, binding proteins promote clearance of both HBV and subviral partides of hepatitis B virus (SVPs). Clearance of HBsAg or of subviral partides may be assessed by measuring the level of HBsAg for example in a blood sample, e.g. from a hepatitis B patient. Similarly, clearance of HBV may be assessed by measuring the level of HBV for example in a blood sample, e.g. from a hepatitis B patient.
In the sera of patients infected with HBV, in addition to infectious partides (HBV), there is typically an excess (typically 1,000- to 100,000-fold) of empty subviral partides (SVP) composed solely of HBV envelope proteins (HBsAg) in the form of relatively smaller spheres and filaments of variable length. Subviral partides hâve been shown to strongly enhance intracellular viral réplication and gene expression of HBV (Bruns M. et al. 1998 J Virol 72(2): 1462—1468). This is also relevant in the context of infectivity of sera containing HBV, since the infectivity dépends not only on the number of viruses but also on the number of SVPs (Bruns M. et al. 1998 J Virol 72(2): 1462-1468). Moreover, an excess of subviral partides can serve as a decoy by absorbing neutralizing antibodies and therefore delay the clearance of infection. Achievement of hepatitis B surface antigen (HBsAg) loss is considered in some instances to be an idéal endpoint of treatment and the closest outcome to cure chronic hepatitis B (CHB).
Embodiments of binding proteins of the présent disclosure may promote clearance of HbsAg. In certain embodiments, the binding proteins may promote clearance of subviral partides of hepatitis B virus. In some embodiments, the binding proteins may be used to treat chronic hepatitis B.
In any of the presently disclosed embodiments, a binding protein of the présent disclosure is capable of binding an HBsAg of a génotype selected from the HBsAg génotypes A, B, C, D, E, F, G, H, I, and J, or any combination thereof.
In certain embodiments, binding proteins of the présent disclosure are capable of binding to 1,2, 3, 4, 5, 6, 7, 8, 9 or 10 of the HBsAg génotypes A, B, C, D, E, F, G, H, I, and J. Examples of different HBsAg génotypes of include the following: GenBank accession number J02203 (HBV-D, ayw3); GenBank accession number FJ899792.1 (HBV-D, adw2); GenBank accession number AM282986 (HBV-A); GenBank accession number D23678 (HBV-B1 Japan); GenBank accession number AB117758 (HBV-C1 Cambodia); GenBank accession number AB205192 (HBV-E Ghana);
GenBank accession number X69798 (HBV-F4 Brazil); GenBank accession number AF160501 (HBV-G USA); GenBank accession number AY090454 (HBV-H Nicaragua); GenBank accession number AF241409 (HBV-I Vietnam); and GenBank accession number AB486012 (HBV-J Bornéo). Exemplary amino acid sequences of the antigenic loop région of the S domain of HBsAg of different génotypes are described 10 herein (e.g., SEQ ID NOs: 5-15).
In some embodiments, a binding protein is capable of binding to one or more, and in some cases at least 6 of the 10 HBsAg génotypes A, B, C, D, E, F, G, H, I, and J. In certain embodiments, a binding protein is capable of binding to at least 8 of the 10 15 HBsAg génotypes A, B, C, D, E, F, G, H, I, and J. In some embodiments, a binding protein is capable ofbinding to ail 10 ofthe 10 HBsAg génotypes A, B, C, D, E, F, G, H, I, and J. HBV is differentiated into several génotypes, according to genome sequence. To date, eight well-known génotypes (A-H) of the HBV genome hâve been defined. Moreover, two other génotypes, I and J, hâve also been identified (Sunbul M., 20 2014, World J Gastroenterol 20(18): 5427-5434). The génotype is known to affect the progression of the disease and différences between génotypes in response to antiviral treatment hâve been determined.
In some embodiments, a binding protein according to the présent disclosure is capable 25 of binding to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 or 18 ofthe HBsAg mutants having mutations in the antigenic loop région, with such mutant(s) being selected from one ore more of HBsAg Y100C/P120T, HBsAg P120T, HBsAg P120T/S143L, HBsAg C121S, HBsAg R122D, HBsAg R122I, HBsAg T123N, HBsAg Q129H, HBsAg Q129L, HBsAg M133H, HBsAg M133L, HBsAg M133T, HBsAg 30 K141E, HBsAg P142S, HBsAg S143K, HBsAg D144A, HBsAg G145R and HBsAg
N146A. These mutants are naturally occurring mutants based on the S domain of
HBsAg Génotype D, Genbank accession no. FJ899792 (SEQ ID NO: 4). The mutated amino acid residue(s) in each of the mutants noted herein are indicated in the name.
SEQ IDNO: 4:
MENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQ SPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIP GSSTTGTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEW ASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIF FCLWVYI (the antigenic loop région, i.e. amino acids 101 - 172, is shown underlined).
Amino acid sequences of the antigenic loop région of the S domain of HBsAg of different mutants are shown in SEQ ID NOs: 16 - 33.
In certain embodiments, a binding protein as disclosed herein is capable of binding to at one or more, and in some cases at least 12 infectious HBsAg mutants selected from HBsAg Y100C/P120T, HBsAg P120T, HBsAg P120T/S143L, HBsAg C121S, HBsAg R122D, HBsAg R122I, HBsAg T123N, HBsAg Q129H, HBsAg Q129L, HBsAg M133H, HBsAg M133L, HBsAg M133T, HBsAg K141E, HBsAg P142S, HBsAg
S143K, HBsAg D144A, HBsAg G145R and HBsAg N146A. In some such embodiments, a binding protein is capable of binding to at least 15 infectious HBsAg mutants selected from HBsAg Y100C/P120T, HBsAg P120T, HBsAg P120T/S143L, HBsAg C121S, HBsAg R122D, HBsAg R122I, HBsAg T123N, HBsAg Q129H, HBsAg Q129L, HBsAg M133H, HBsAg M133L, HBsAg M133T, HBsAg K141E,
HBsAg P142S, HBsAg S143K, HBsAg D144A, HBsAg G145R and HBsAg N146A. In some embodiments, a binding protein is capable of binding to each of the following infectious HBsAg mutants: HBsAg Y100C/P120T; HBsAg P120T; HBsAg P120T/S143L; HBsAg C121S; HBsAg R122D; HBsAg R122I; HBsAg T123N; HBsAg Q129H; HBsAg Q129L; HBsAg M133H; HBsAg M133L; HBsAg M133T; HBsAg
K141E; HBsAg P142S; HBsAg S143K; HBsAg D144A; HBsAg G145R; and HBsAg N146 A.
In certain embodiments, the binding protein (e.g., including an antibody or antigen binding fragment thereof) is capable of reducing a sérum concentration of HBV DNA in a mammal having an HBV infection. In certain embodiments, the binding protein is capable of reducing a sérum concentration of HBsAg in a mammal having an HBV infection. In certain embodiments, binding protein is capable of reducing a sérum concentration of HBeAg in a mammal having an HBV infection. In certain embodiments, the binding protein is capable of reducing a sérum concentration of HBcrAg in a mammal having an HBV infection. In some embodiments, the binding protein is capable of reducing the sérum concentration of HBV DNA, HBsAg, HBeAg, and/or HBcrAg in the mammal for about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more days following a single administration of the binding protein.
The term epitope or antigenic epitope includes any molécule, structure, amino acid sequence, or protein déterminant that is recognized and specifically bound by a cognate binding molécule, such as an immunoglobulin, chimeric antigen receptor, or other binding molécule, domain or protein. Epitopic déterminants generally contain chemically active surface groupings of molécules, such as amino acids or sugar side chains, and can hâve spécifie three dimensional structural characteristics, as well as spécifie charge characteristics.
In some embodiments, a binding protein is capable of binding to an epitope comprising at least one, at least two, at least three, or at least four amino acids of the antigenic loop région of HbsAg. In certain embodiments, a binding protein is capable of binding at least two amino acids selected from amino acids 115 - 133 ofthe S domain of HbsAg, amino acids 120 - 133 of the S domain of HbsAg, or amino acids 120 - 130 of the S domain of HbsAg. In certain embodiments, a binding protein is capable of binding at least three amino acids selected from amino acids 115 - 133 of the S domain of HbsAg, amino acids 120 - 133 of the S domain of HbsAg, or amino acids 120 - 130 of the S domain of HbsAg. In some embodiments, a binding protein is capable of binding at least four amino acids selected from amino acids 115 - 133 of the S domain of HbsAg, amino acids 120 - 133 of the S domain of HbsAg, or amino acids 120 - 130 of the S domain of HbsAg. As used herein, the position of the amino acids (e.g. 115 - 133, 120
- 133, 120 - 130) refers to the S domain of HBsAg as described above, which is présent in ali three HBV envelope proteins S-HBsAg, Μ-HBsAg, and L-HBsAg, whereby SHBsAg typically corresponds to the S domain of HBsAg.
The term formed by as used herein in the context of an epitope, means that the epitope to which binding protein binds to may be linear (continuous) or conformational (discontinuous). A linear or a sequential epitope is an epitope that is recognized by an antibody according to its linear sequence of amino acids, or primary structure. A conformational epitope may be recognized according to a three-dimensional shape and protein structure. Accordingly, if the epitope is a linear epitope and comprises more than one amino acid located at positions selected from amino acid positions 115 -133 or from amino acid positions 120 -133 of the S domain of HBsAg, the amino acids comprised by the epitope may be located in adjacent positions of the primary structure (e.g., are consecutive amino acids in the amino acid sequence). In the case of a conformational epitope (3D structure), the amino acid sequence typically forms a 3D structure as epitope and, thus, the amino acids forming the epitope may be or may be not located in adjacent positions of the primary structure (i.e. maybe or may be not consecutive amino acids in the amino acid sequence).
In certain embodiments, an epitope to which a binding protein binds to a conformational epitope. In some embodiments, a binding protein binds to an epitope comprising at least two amino acids of the antigenic loop région of HBsAg, wherein the at least two amino acids are selected from amino acids 120 - 133 or from from amino acids 120 - 130, of the S domain of HbsAg, and wherein the at least two amino acids are not located in adjacent positions (of the primary structure). In certain embodiments, a binding protein binds to an epitope comprising at least three amino acids of the antigenic loop région of HBsAg, wherein the at least three amino acids are selected from amino acids 120 - 133 or from from amino acids 120 - 130, of the S domain of HbsAg, and wherein at least two of the three amino acids are not located in adjacent positions (of the primary structure). In some embodiments, a binding protein binds to an epitope comprising at least four amino acids of the antigenic loop région of HBsAg, wherein the at least four amino acids are selected from amino acids 120 - 133 or from from amino acids 120 - 130, of the S domain of HbsAg, and wherein at least two of the four amino acids are not located in adjacent positions (of the primary structure).
Amino acids to which a presently disclosed antibody, antigen binding fragment, or fusion protein binds (i.e. the amino acids forming the epitope), which are not located in adjacent positions of the primary structure, are in some cases spaced apart by one or more amino acids, to which the antibody, antigen binding fragment, or fusion protein does not bind. In some embodiments, at least one, at least two, at least three, at least four, or at least five amino acids may be located between two of the amino acids not located in adjacent positions comprised by the epitope.
In certain embodiments, a binding protein binds to an epitope comprising at least amino acids P120, C121, R122 and C124 of the S domain of HBsAg. In other embodiments, a binding protein of the présent disclosure binds to an epitope comprising an amino acid sequence according to SEQ ID NO: 88:
PCRXC wherein X is any amino acid or no amino acid; X is any amino acid; X is T, Y, R, S, or F; X is T, Y or R; or X is T or R.
In other embodiments, a binding protein of the présent disclosure binds to an epitope comprising an amino acid sequence according to SEQ ID NO: 80:
TGPCRTC or to an amino acid sequence sharing at least 80%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 80.
In other embodiments, a binding protein of the présent disclosure binds to an epitope comprising an amino acid sequence according to SEQ ID NO: 85: STTSTGPCRTC or to an amino acid sequence sharing at least 80%, at least 90% or at least 95% sequence identity with SEQ ID NO: 85.
In certain embodiments, a binding protein of the présent disclosure binds to an epitope comprising an amino acid sequence comprising at least amino acids 145 - 151 of the S domain of HBsAg:
GNCTCIP (SEQ IDNO: 81).
In still other embodiments, a binding protein of the présent disclosure binds to an epitope comprising an amino acid sequence according to SEQ ID NO: 80 and an amino acid sequence according to SEQ ID NO: 81.
In other embodiments, a binding protein of the présent disclosure binds to an epitope comprising an amino acid sequence according to SEQ ID NO: 85 and/or an amino acid sequence according to SEQ ID NO: 87.
As described above, an epitope to which a binding protein of the présent disclosure binds may be linear (continuous) or conformational (discontinuous). In some embodiments, a binding protein ofthe disclosure binds to a conformational epitope, and in certain such embodiments, the conformational epitope is présent only under nonreducing conditions.
In certain embodiments, binding protein of the présent disclosure, binds to a linear epitope. In certain such embodiments, the the linear epitope is présent under both, nonreducing conditions and reducing conditions.
In particular embodiments, a binding protein of the présent disclosure binds to an epitope in the antigenic loop of HBsAg formed by an amino acid sequence according to SEQ ID NO: 1 :
Xi X2 X3 TC X4 X5 x6a x7g wherein Xi, X2, X3, X4, Xs, Xô and X7 may be any amino acid (SEQ ID NO: 1).
In some embodiments, Xb X2, X3, X4, X5, Xô and X7 are amino acids, which are conservatively substituted in comparison to amino acids 120 - 130 of SEQ ID NO: 3. In some embodiments, Xi, X2, X3, X4, X5, Xô and X7 are amino acids, which are conservatively substituted in comparison to amino acids 20 - 30 of any of SEQ ID NOs
5-33.
In specific embodiments, Xi of SEQ ID NO: 1 Xi is a small amino acid. A small amino acid, as used herein, refers to any amino acid selected from the group consisting of alanine, aspartic acid, asparagine, cysteine, glycine, proline, serine, threonine and valine. In certain such embodiments, Xi is proline, serine or threonine.
In certain embodiments, X2 of SEQ ID NO: 1 X2 is a small amino acid. In certain embodiments, X2 may be selected from cystein or threonine.
In some embodiments, X3of SEQ ID NO: 1 is a charged amino acid or an aliphatic amino acid. A charged amino acid, as used herein, refers to any amino acid selected from the group consisting of arginine, lysine, aspartic acid, glutamic acid and histidine. A aliphatic amino acid, as used herein, refers to any amino acid selected from the group consisting of alanine, glycine, isoleucine, leucine, and valine. In certain embodiments, X3 is selected from arginine, lysine, aspartic acid or isoleucine.
In some embodiments, X4 of SEQ ID NO: 1 is a small amino acid and/or a hydrophobie amino acid. A hydrophobie amino acid, as used herein, refers to any amino acid selected from the group consisting of alanine, isoleucine, leucine, phenylalanine, valine, tryptophan, tyrosine, méthionine, proline and glycine. In certain embodiments, X4 is selected from méthionine or threonine.
In some embodiments, X5 of SEQ ID NO: 1 X5 is a small amino acid and/or a hydrophobie amino acid. In certain embodiments, X5 is selected from threonine, alanine or isoleucine.
In some embodiments, Χδ of SEQ ID NO: 1 X6 is a small amino acid and/or a hydrophobie amino acid. In certain embodiments, Χδ is selected from threonine, proline or leucine.
In some embodiments, X? of SEQ ID NO: 1 is a polar amino acid or an aliphatic amino acid. A polar amino acid, as used herein, refers to any amino acid selected from the group consisting of aspartic acid, asparagine, arginine, glutamic acid, histidine, lysine, glutamine, tryptophan, tyrosine, serine, and threonine. In certain such embodiments, X? is glutamine, histidine or leucine.
In some embodiments, abinding protein according to the présent disclosure binds to an epitope in the antigenic loop of HBsAg formed by an amino acid sequence according to SEQIDNO: 2:
Xi X2 X3 TC X4 X5 XôA X7G wherein Xi is P, T or S, X2 is C or S,
X3 is R, K, D or I, X4 is M or T,
Xs is T, A or I,
Χδ is T, P or L, and
X7 is Q, H or L (SEQ ID NO: 2).
With regard to the epitopes formed by the amino acid sequences according to SEQ ID NO: 1 or 2, it is noted that the term formed by as used herein is not intended to imply that a disclosed binding protein necessarily binds to each and every amino acid of SEQ ID NO: 1 or 2. In particular, a binding protein may bind only to some of the amino acids of SEQ ID NO: 1 or 2, whereby other amino acid residues may act as spacers.
In particular embodiments, a binding protein according to the présent disclosure binds to an epitope in the antigenic loop of HBsAg formed by one or more, two or more, three or more, or four or more amino acids of an amino acid sequence selected from SEQ ID
NOs 5-33 shown below in Table 3.
In some embodiments, binding protein according to the présent disclosure binds to an 5 antigenic loop région of HBsAg having an amino acid sequence according to any one or more of SEQ ID NOs 5-33 shown below in Table 3, or to a sequence variant thereof. In certain embodiments, a binding protein according to the présent disclosure binds to ail ofthe antigenic loop variants of HBsAg having an amino acid sequence according to any of SEQ ID NOs 5-33 shown below in Table 3.
Table 3: Exemplary amino acid sequences of the antigenic loop région of the S domain of HBsAg (residues 101-172 of the S domain of HBsAg - except for SEQ ID NO: 16, which refers to residues 100-172 of the S domain of HBsAg in order to include the relevant mutation) of the different génotypes and mutants as used herein.
Name | SEQ ID NO. | Amino acid sequence |
J02203 (D, ayw3) | 5 | QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTS MYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWE WASARFSW |
FJ899792 (D, adw2) | 6 | QGMLPVCPLIPGSSTTGTGPCRTCTTP AQGTSMYPSCCCTKPSDGNCTCIPIPS SWAFGKFLWEWASARFSW |
AM282986 (A) | 7 | QGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNS MFPSCCCTKPSDGNCTCIPIPSSWAFAKYLWE WASVRFSW |
D23678 (Bl) | 8 | QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTS MFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWE WASVRFSW |
AB117758 (Cl) | 9 | QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTS MFPSCCCTKPSDGNCTCIPIPSSWAFARFLWE WASVRFSW |
Name | SEQ ID NO. | Amino acid sequence |
AB205192 (E) | 10 | QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTS MFPSCCCSKPSDGNCTCIPIPSSWAFGKFLWE WASARFSW |
X69798 (F4) | 11 | QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTS MFPSCCCSKPSDGNCTCIPIPSSWALGKYLWE WASARFSW |
AF160501 (G) | 12 | QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNS MYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWE WASVRFSW |
AY090454 (H) | 13 | QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTS MFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWE WASARFSW |
AF241409 (I) | 14 | QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNS MYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWE WASARFSW |
AB486012 (J) | 15 | QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTS MFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWE WASVRFSW |
HBsAg Y100C/P120T | 16 | CQGMLPVCPLIPGSSTTGTGTCRTCTTPAQGT SMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLW EWASARFSW |
HBsAg P120T | 17 | QGMLPVCPLIPGSSTTGTGTCRTCTTPAQGTS MYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWE WASARFSW |
HBsAg P120T/S143L | 18 | QGMLPVCPLIPGSSTTGTGTCRTCTTPAQGTS MYPSCCCTKPLDGNCTCIPIPSSWAFGKFLWE WASARFSW |
HBsAgC121S | 19 | QGMLPVCPLIPGSSTTGTGPSRTCTTPAQGTS MYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWE WASARFSW |
Naine | SEQ ID NO. | Amino acid sequence |
HBsAgR122D | 20 | QGMLPVCPLIPGSSTTGTGPCDTCTTPAQGTS MYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWE WASARFSW |
HBsAg R1221 | 21 | QGMLPVCPLIPGSSTTGTGPCITCTTPAQGTSM YPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEW ASARFSW |
HBsAg Tl23N | 22 | QGMLPVCPLIPGSSTTGTGPCRNCTTPAQGTS MYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWE WASARFSW |
HBsAg Q129H | 23 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAHGTS MYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWE WASARFSW |
HBsAg Q129L | 24 | QGMLPVCPLIPGSSTTGTGPCRTCTTPALGTS MYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWE WASARFSW |
HBsAg Ml33H | 25 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTS HYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWE WASARFSW |
HBsAg M133L | 26 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSL YPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEW ASARFSW |
HBsAg M133T | 27 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTST YPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEW ASARFSW |
HBsAg K141E | 28 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTS MYPSCCCTEPSDGNCTCIPIPSSWAFGKFLWE WASARFSW |
HBsAgP142S | 29 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTS MYPSCCCTKSSDGNCTCIPIPSSWAFGKFLWE WASARFSW |
Name | SEQ ID NO. | Amino acid sequence |
HBsAgS143K | 30 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTS MYPSCCCTKPKDGNCTCIPIPSSWAFGKFLWE WASARFSW |
HBsAg DI44A | 31 | QGMLPVCPLIPGS STTGTGPCRTCTTPAQGTS MYPSCCCTKPSAGNCTCIPIPSSWAFGKFLWE WASARFSW |
HBsAg G145R | 32 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTS MYPSCCCTKPSDRNCTCIPIPSSWAFGKFLWE WASARFSW |
HBsAg N146A | 33 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTS MYPSCCCTKPSDGACTCIPIPSSWAFGKFLWE WASARFSW |
In certain aspects, the présent disclosure provides an isolated antibody, or an antigen binding fragment thereof, comprising: (i) a heavy chain variable région (Vh) comprising at least 90% (i.e., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) identity to the amino acid sequence according to SEQ ID NO:41 or 67; and (ii) a light chain variable région (Vl) comprising at least 90% identity to the amino acid sequence according to any one of SEQ ID NOs:42; 59; 65; 89, 90, or 111-120, provided that the amino acid at position 40 of the VL according to IMGT numbering is not a cysteine, wherein the antibody or antigen binding fragment thereof binds to the antigenic loop région of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
In further embodiments, (i) the Vh comprises at least 95% identity to the amino acid 15 sequence according to SEQ ID NO:41 or 67; and/or (ii) the Vl comprises at least 95% identity to the amino acid sequence according to any one of SEQ ID NOs:42, 59, 65, 89, 90, or 111-120.
In certain embodiments, the amino acid at position 40 of the Vl is alanine. In other embodiments, the amino acid at position 40 of the Vl is serine. In still other embodiments, the amino acid at position 40 of the Vl is glycine.
In any of the embodiments disclosed herein, the antibody or antigen binding fragment can comprise CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 sequences according to SEQ ID NOs: (i) 34-36, 37, 38, and 40, respectively; (ii) 34, 66, 36, 37, 38, and 40, respectively; (iii) 34-36, 37, 39, and 40, respectively; (iv) 34, 66, 36, 37, 39, and 40, respectively; (v) 34-36, 37, 38, and 58, respectively; (vi) 34, 66, 36, 37, 38, and 58, respectively; (vii) 34-36, 37, 39, and 58, respectively; or (vii) 34, 66, 36, 37, 39, and 58, respectively.
In some embodiments, the Vl of the antibody or antigen binding fragment comprises or consists of the amino acid sequence according to SEQ ID NO:89. In some embodiments, the Vl of the antibody or antigen binding fragment comprises or consists of the amino acid sequence according to SEQ ID NO:90. In other embodiments, the Vl of the antibody or antigen binding fragment comprises or consists of the amino acid sequence according to any one of SEQ ID NOs: 111-120. In certain embodiments, the Vh comprises or consists of the amino acid sequence according to SEQ ID NO:41. In other embodiments, the Vh comprises or consists of the amino acid sequence according to SEQ ID NO:67.
In particular embodiments, the Vh comprises or consists of the amino acid sequence according to SEQ ID NO:41 and the Vl comprises or consists of the amino acid sequence according to SEQ ID NO:89. In other embodiments, the Vh comprises or consists of the amino acid sequence according to SEQ ID NO:41 and the Vl comprises or consists of the amino acid sequence according to SEQ ID NO:90. In certain embodiments, the the Vh comprises or consists of the amino acid sequence according to SEQ ID NO:41 and the Vl comprises or consists of the amino acid sequence according to any one of SEQ ID NOs:l 11-120. In other embodiments, the the Vh comprises or consists ofthe amino acid sequence according to SEQ ID NO:67 and the Vl comprises or consists of the amino acid sequence according to any one of SEQ ID NOs:89, 90, and
111-120.
In another aspect, the présent disclosure provides an isolated antibody, or an antigen binding fragment thereof, comprising: (i) a heavy chain variable région (Vu) comprising at least 90% identity to the amino acid sequence according to SEQ ID NO:95; and (ii) a light chain variable région (Vl) comprising at least 90% identity to the amino acid sequence according to SEQ ID NO:96, wherein the antibody or antigen binding fragment thereof binds to the antigenic loop région of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
In further embodiments, (i) the Vh comprises at least 95% identity to the amino acid sequence according to SEQ ID NO:95; and/or (ii) the Vl comprises at least 95% identity to the amino acid sequence according to SEQ ID NO:96.
In certain embodiments, the antibody or antigen binding fragment comprises CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 sequences according to SEQ ID NOs:97-102, respectively.
In particular embodiments, the Vh comprises or consists of the amino acid sequence according to SEQ ID NO:95; and the Vl comprises or consists of the amino acid sequence according to SEQ ID NO:96.
Fc Moiety
In some embodiments, a binding protein (e.g., antibody or an antigen binding fragment thereof) of the présent disclosure comprises an Fc moiety. In certain embodiments, the Fc moiety may be derived from human origin, e.g., from human IgGl, IgG2, IgG3, and/or IgG4, or from another Ig class or isotype. In spécifie embodiments, an antibody or antigen binding fragments can comprise an Fc moiety derived from human IgGl.
As used herein, the term Fc moiety refers to a sequence comprising, consisting, consisting essentially of, or derived from a portion of an immunoglobulin heavy chain beginning in the hinge région just upstream of the papain cleavage site (e.g., residue 216 in native IgG, taking the first residue of heavy chain constant région to be 114) and ending at the C-terminus of the immunoglobulin heavy chain. Accordingly, an Fc moiety may be a complété Fc moiety or a portion (e.g., a domain) thereof. In certain embodiments, a complété Fc moiety comprises a hinge domain, a CH2 domain, and a CH3 domain (e.g., EU amino acid positions 216-446). An additional lysine residue (K) is sometimes présent at the extreme C-terminus of the Fc moiety, but is often cleaved from a mature antibody. Amino acid positions within an Fc moiety hâve been numbered according to the EU numbering system of Kabat, see e.g, Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Dept. Health and Human Services, 1983 and 1987. Amino acid positions of an Fc moiety can also be numbered according to the IMGT numbering system (including unique numbering for the C-domain and exon numbering) and the Kabat numbering system.
In some embodiments, an Fc moiety comprises at least one of: a hinge (e.g., upper, middle, and/or lower hinge région) domain, a CH2 domain, a CH3 domain, or a variant, portion, or fragment thereof. In some embodiments, an Fc moiety comprises at least a hinge domain, a CH2 domain or a CH3 domain. In further embodiments, the Fc moiety is a complété Fc moiety. The amino acid sequence of an exemplary Fc moiety of human IgGl isotype is provided in SEQ ID NO: 137. The Fc moiety may also comprise one or more amino acid insertions, délétions, or substitutions relative to a naturally occurring Fc moiety. For example, at least one of a hinge domain, CH2 domain, or CH3 domain, or a portion thereof, may be deleted. For example, an Fc moiety may comprise or consist of: (i) hinge domain (or a portion thereof) fused to a CH2 domain (or a portion thereof), (ii) a hinge domain (or a portion thereof) fused to a CH3 domain (or a portion thereof), (iii) a CH2 domain (or a portion thereof) fused to a CH3 domain (or a portion thereof), (iv) a hinge domain (or a portion thereof), (v) a CH2 domain (or a portion thereof), or (vi) a CH3 domain or a portion thereof.
An Fc moiety of the présent disclosure may be modified such that it varies in amino acid sequence from the complété Fc moiety of a naturally occurring immunoglobulin molécule, while retaining or enhancing at least one désirable function conferred by the naturally occurring Fc moiety, and/or reducing an undesired function of a naturally occurring Fc moiety. Such functions include, for example, Fc receptor (FcR) binding, antibody half-life modulation (e.g., by binding to FcRn), ADCC function, protein A binding, protein G binding, and complément binding. Portions of naturally occurring Fc moieties which are involved with such functions hâve been described in the art.
For example, to activate the complément cascade, the Clq protein complex can bind to at least two molécules of IgGl or one molécule of IgM when the immunoglobulin molecule(s) is attached to the antigenic target (Ward, E. S., and Ghetie, V., Ther. Immunol. 2 (1995) 77-94). Burton, D. R., described (Mol. Immunol. 22 (1985) 161-206) that the heavy chain région comprising amino acid residues 318 to 337 is involved in complément fixation. Duncan, A. R., and Winter, G. (Nature 332 (1988) 738-740), using site directed mutagenesis, reported that Glu318, Lys320 and Lys322 form the binding site to Clq. The rôle of Glu318, Lys320 and Lys 322 residues in the binding of Clq was confirmed by the ability of a short synthetic peptide containing these residues to inhibit complément mediated lysis.
For example, FcR binding can be mediated by the interaction of the Fc moiety (of an antibody) with Fc receptors (FcRs), which are specialized cell surface receptors on cells including hematopoietic cells. Fc receptors belong to the immunoglobulin superfamily, and shown to médiate both the removal of antibody-coated pathogens by phagocytosis of immune complexes, and the lysis of érythrocytes and various other cellular targets (e.g. tumor cells) coated with the corresponding antibody, via antibody dépendent cell mediated cytotoxicity (ADCC; Van de Winkel, J. G., and Anderson, C. L., J. Leukoc. Biol. 49 (1991) 511-524). FcRs are defined by their specificity for immunoglobulin classes; Fc receptors for IgG antibodies are referred to as FcyR, for IgE as FcsR, for IgA as FcaR and so on and néonatal Fc receptors are referred to as FcRn. Fc receptor binding is described for example in Ravetch, J. V., and Kinet, J. P., Annu. Rev. Immunol. 9 (1991) 457-492; Capel, P. J., et al., Immunomethods 4 (1994) 25-34; de Haas, M., et al., J Lab. Clin. Med. 126 (1995) 330-341; and Gessner, J. E., et al., Ann. Hematol. 76 (1998) 231-248.
Cross-linking of receptors by the Fc domain of native IgG antibodies (FcyR) triggers a wide variety of effector functions including phagocytosis, antibody-dependent cellular cytotoxicity, and release of inflammatory mediators, as well as immune complex clearance and régulation of antibody production. Fc moieties providing cross-linking of receptors (e.g., FcyR) are contemplated herein. In humans, three classes of FcyR hâve been characterized to-date, which are: (i) FcyRI (CD64), which binds monomeric IgG with high affinity and is expressed on macrophages, monocytes, neutrophils and eosinophils; (ii) FcyRII (CD32), which binds complexed IgG with medium to low affinity, is widely expressed, in particular on leukocytes, is believed to be a central player in antibody-mediated immunity, and which can be divided into FcyRIIA, FcyRIIB and FcyRIIC, which perform different functions in the immune system, but bind with similar low affinity to the IgG-Fc, and the ectodomains of these receptors are highly homologuous; and (iii) FcyRIII (CD16), which binds IgG with medium to low affinity and has been found in two forms: FcyRIIIA, which has been found on NK cells, macrophages, eosinophils, and some monocytes and T cells, and is believed to médiate ADCC; and FcyRIIIB, which is highly expressed on neutrophils.
FcyRIIA is found on many cells involved in killing (e.g. macrophages, monocytes, neutrophils) and seems able to activate the killing process. FcyRIIB seems to play a rôle in inhibitory processes and is found on B-cells, macrophages and on mast cells and eosinophils. Importantly, it has been shown that 75% of ali FcyRIIB is found in the liver (Ganesan, L. P. et al., 2012: “FcyRIIb on liver sinusoïdal endothélium clears small immune complexes,” Journal of Immunology 189: 4981-4988). FcyRIIB is abundantly expressed on Liver Sinusoïdal Endothélium, called LSEC, and in Kupffer cells in the liver and LSEC are the major site of small immune complexes clearance (Ganesan, L. P. et aL, 2012: FcyRIIb on liver sinusoïdal endothélium clears small immune complexes. Journal of Immunology 189: 4981—4988).
In some embodiments, the antibodies disclosed herein and the antigen binding fragments thereof comprise an Fc moiety for binding to FcyRIIb, in particular an Fc région, such as, for example IgG-type antibodies. Moreover, it is possible to engineer the Fc moiety to enhance FcyRIIB binding by introducing the mutations S267E and
L328F as described by Chu, S. Y. et al., 2008: Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD19 and FcgammaRIIb with
Fc-engineered antibodies. Molecular Immunology 45, 3926-3933. Thereby, the clearance of immune complexes can be enhanced (Chu, S., et al., 2014: Accelerated
Clearance of IgE In Chimpanzees Is Mediated By Xmab7195, An Fc-Engineered
Antibody With Enhanced Affinity For Inhibitory Receptor FcyRIIb. Am J Respir Crit, American Thoracic Society International Conférence Abstracts). In some embodiments, the antibodies of the présent disclosure, or the antigen binding fragments thereof, comprise an engineered Fc moiety with the mutations S267E and L328F, in particular 10 as described by Chu, S. Y. et al., 2008: Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD19 and FcgammaRIIb with Fcengineered antibodies. Molecular Immunology 45, 3926-3933.
On B cells, FcyRIIB seems to function to suppress further immunoglobulin production 15 and isotype switching to, for example, the IgE class. On macrophages, FcyRIIB is thought to inhibit phagocytosis as mediated through FcyRIIA. On eosinophils and mast cells, the B form may help to suppress activation of these cells through IgE binding to its separate receptor.
Regarding FcyRI binding, modification in native IgG of at least one of E233-G236, P238, D265, N297, A327 and P329 reduces binding to FcyRI. IgG2 residues at positions 233-236, substituted into corresponding positions IgGl and IgG4, reduces binding of IgGl and IgG4 to FcyRI by 103-fold and eliminated the human monocyte response to antibody-sensitized red blood cells (Armour, K. L., et al. Eur. J. Immunol.
29(1999)2613-2624).
Regarding FcyRII binding, reduced binding for FcyRIIA is found, e.g., for IgG mutation of at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, R292 and K414.
Two allelic forms of human FcyRIIA are the Ή131 variant, which binds to IgGl Fc with high affmity, and the R131 variant, which binds to IgGl Fc with low affmity.
See, e.g., Bruhns et al., Blood 7/3:3716-3725 (2009).
Regarding FcyRIII binding, reduced binding to FcyRIIIA is found, e.g., for mutation of at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, S239, E269, E293, Y296, V303, A327, K338 and D376. Mapping of the binding sites on human IgGl for Fc receptors, the above-mentioned mutation sites, and methods for measuring binding to FcyRI and FcyRIIA, are described in Shields, R. L., et al., J. Biol. Chem. 276 (2001) 6591-6604.
Two allelic forms of human FcyRIIIA are the F158 variant, which binds to IgGl Fc with low affmity, and the VI58 variant, which binds to IgGl Fc with high affmity. See, e.g., Bruhns et al., Blood 773:3716-3725 (2009).
Regarding binding to FcyRII, two régions of native IgG Fc appear to be involved in interactions between FcyRIIs and IgGs, namely (i) the lower hinge site of IgG Fc, in particular amino acid residues L, L, G, G (234 - 237, EU numbering), and (ii) the adjacent région of the CH2 domain of IgG Fc, in particular a loop and strands in the upper CH2 domain adjacent to the lower hinge région, e.g. in a région of P331 (Wines, B.D., et al., J. Immunol. 2000; 164: 5313 — 5318). Moreover, FcyRI appears to bind to the same site on IgG Fc, whereas FcRn and Protein A bind to a different site on IgG Fc, which appears to be at the CH2-CH3 interface (Wines, B.D., et al., J. Immunol. 2000; 164: 5313-5318).
Also contemplated are mutations that increase binding affînity of an Fc moiety of the present disclosure to a (i.e., one or more) Fcy receptor (e.g., as compared to a reference Fc moiety or antibody containing the same that does not comprise the mutation(s)). See, e.g., Delillo and Ravetch, Cell 161(5):1035-1045 (2015) and Ahmed et al., J. Struc. Biol. 194(1):78 (2016), the Fc mutations and techniques of which are incorporated herein by reference.
In any of the herein disclosed embodiments, a binding protein can comprise a Fc moiety comprising a mutation selected from G236A; S239D; A330L; and I332E; or a combination comprising any two or more of the same; e.g., S239D/I332E;
S239D/A330L/I332E; G236A/S239D/I332E; G236A/A330L/I332E (also referred to herein as GAALIE); or G236A/S239D/A330L/I332E. In some embodiments, the Fc moiety does not comprise S239D.
In certain embodiments, the Fc moiety may comprise or consist of at least a portion of an Fc moiety that is involved in binding to FcRn binding. In certain embodiments, the
Fc moiety comprises one or more amino acid modifications that improve binding affinity for (e.g., enhance binding to) FcRn (e.g., at a pH of about 6.0) and, in some embodiments, thereby extend in vivo half-life of a molécule comprising the Fc moiety (e.g., as compared to a reference Fc moiety or antibody that is otherwise the same but does not comprise the modification(s)). In certain embodiments, the Fc moiety comprises or is derived from a IgG Fc and a half-life-extending mutation comprises any one or more of: M428L; N434S; N434H; N434A; N434S; M252Y; S254T; T256E; T250Q; P257I Q311I; D376V; T307A; E380A (EU numbering). In certain embodiments, a half-life-extending mutation comprises M428L/N434S (also referred to herein as MLNS). In certain embodiments, a half-life-extending mutation comprises
M252Y/S254T/T256E. In certain embodiments, a half-life-extending mutation comprises T250Q/M428L. In certain embodiments, a half-life-extending mutation comprises P257I/Q311I. In certain embodiments, a half-life-extending mutation comprises P257I/N434H. In certain embodiments, a half-life-extending mutation comprises D376V/N434H. In certain embodiments, a half-life-extending mutation comprises T307A/E380A/N434A.
In some embodiments, a binding protein includes a Fc moiety that comprises the substitution mtuations M428L/N434S. In some embodiments, a binding protein includes a Fc moiety that comprises the substitution mtuations G236A/A330L/I332E.
In certain embodiments, a binding protein includes a (e.g., IgG) Fc moiety that comprises a G236A mutation, an A330L mutation, and a I332E mutation (GAALIE), and does not comprise a S239D mutation (e.g., comprises a native S at position 239).
In particular embodiments, a binding protein includes an Fc moiety that comprises the substitution mutations: M428L/N434S and G236A/A330L/I332E, and optionally does not comprise S239D. In certain embodiments, a binding protein includes a Fc moiety that comprises the substitution mutations: M428L/N434S and
G236A/S239D/A330L/I332E.
In certain embodiments, a binding protein of the présent disclosure comprises: CDRs and/or a variable domain and/or a heavy chain and/or a light chain according to any one of the exemplary anti-HBV antibodies disclosed herein and/or in PCT Publication No. WO 2017/060504 (including antibodies HBC34, HBC34-V7, HBC34-V23, HBC34V31, HBC34-V32, HBC34-V33, HBC34-V34, HBC34-V35, (including herein disclosed variants of HBC antibodies which comprise a substitution mutation at position 40 in the light chain (e.g., a substitution of a native cysteine with an alanine, a serine, or the like) and HBC24); and a Fc moiety comprising a G236A mutation, an A330L mutation, and a I332E (GAALIE) mutation, wherein the Fc moiety optionally further comprises a M428L/N434S (MLNS) mutation. In certain embodiments, the Fc moiety does not comprise S239D.
In certain embodiments, a binding protein comprises: a CDRH1 amino acid sequence according to SEQ ID NO:34, a CDRH2 amino acid sequence according to SEQ ID NO:35 or 66, a CDRH3 amino acid sequence according to SEQ ID NO:36, a CDRL1 acid sequence according to SEQ ID NO:37, a CDRL2 acid sequence according to SEQ ID NO:38 or 39, and CDRL3 amino acid sequence according to SEQ ID NO:58 or 40; and a Fc moiety comprising a GAALIE mutation. In certain embodiments, the Fc moiety does not comprise a S239D mutation. In certain embodiments, the Fc moiety further comprises a MLNS mutation.
In certain embodiments, a binding protein comprises: a heavy chain variable domain (VH) amino acid sequence according to any one of SEQ ID NOs:41 or 67 and a light chain variable domain (VL) amino acid sequence according to any one of SEQ ID NOs:42, 59, 65, 89, 90, and 111-120; and a Fc moiety comprising a GAALIE mutation. In certain embodiments, the Fc moiety further comprises a MLNS mutation.
In certain embodiments, a binding protein comprises a heavy chain amino acid sequence according to SEQ ID NO: 138 or 91 or 92 and/or a light chain amino acid sequences according to any one of SEQ ID NOs:93 or 94. In certain embodiments, a binding protein comprises a heavy chain amino acid sequence according to SEQ ID NO: 91 and a light chain amino acid sequences according to SEQ ID NOs:93. In certain embodiments, a binding protein comprises a heavy chain amino acid sequence according to SEQ ID NO: 91 and a light chain amino acid sequences according to SEQ ID NOs:94. In certain embodiments, a binding protein comprises a heavy chain amino acid sequence according to SEQ ID NO: 92 and a light chain amino acid sequences according to SEQ ID NOs:93. In certain embodiments, a binding protein comprises a heavy chain amino acid sequence according to SEQ ID NO: 92 and a light chain amino acid sequences according to SEQ ID NOs:94.
In certain embodiments, a binding protein comprises: a CDRH1 amino acid sequence according to SEQ ID NO:97, a CDRH2 amino acid sequence according to SEQ ID NO:98, a CDRH3 amino acid sequence according to SEQ ID NO:99, a CDRL1 acid sequence according to SEQ ID NO: 100, a CDRL2 acid sequence according to SEQ ID NO: 100, and CDRL3 amino acid sequence according to SEQ ID NO: 102; and a Fc moiety comprising a GAALIE mutation. In certain embodiments, the Fc moiety further comprises a MLNS mutation.
In certain embodiments, a binding protein comprises: a heavy chain variable domain (VH) amino acid sequence according to SEQ ID NO:95 and a light chain variable domain (VL) amino acid sequence according to SEQ ID NO:96; and a Fc moiety comprising a GAALIE mutation. In certain embodiments, the Fc moiety further comprises a MLNS mutation.
In any of the presently disclosed embodiments, a binding protein of the présent disclosure includes a Fc moiety comprising a GAALIE mutation and has enhanced binding to a human FcyRIIa and/or a human FcyRIIIa, as compared to a reference polypeptide (i.e., a polypeptide, which may be a binding protein, that includes a Fc moiety that does not comprise the GAALIE mutation).
In certain embodiments, the reference polypeptide includes a Fc moiety that is a wild5 type Fc moiety (e.g., of the same isotype) or is a Fc moiety that comprises one or more substitution mutation (or insertion or délétion), provided that the substitution mutation is not or does not comprise GAALIE. In certain embodiments, a binding protein comprises HBC34-V35 antibody with a GAALIE mutation (and optionally other substitution mutations, such as, for example, MLNS), and a reference polypeptide is 10 HBC34-V35 (including a wild-type Fc moiety). In certain embodiments, the reference polypeptide does not comprise a substitution mutation that is known or believed to affect binding to a human FcyRIIa and/or to a human FcyRIIIa.
Binding between polypeptides, such as binding between a Fc moiety (or a binding 15 protein comprising the same) and a human Fcy Receptor, such as human FcyRIIA, human FcyRIIIA, or human Fc FcyRIIB, or a complément protein, such as Clq, can be determined or detected using methods known in the art. For example, a biolayer interferometry (BLI) assay can be performed using an Octet® RED96 (ForteBio, Fremont, California USA) instrument according to manufacturer’s instructions to 20 détermine real-time association and dissociation between a First polypeptide of interest (e.g., HBC34v35 comprising a GAALIE mutation) and a second polypeptide of interest (e.g., a FcyRIIA (H131), a FcyRIIA (RI31), a FcyRIIIA (F 158), a FcyRIIIA (VI58), or a FcyRIIb) that is captured on a sensor substrate.
In certain embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation and has enhanced binding to a human FcyRIIA (H131), a human FcyRIIA (R131), a human FcyRIIIA (F158), a human FcyRIIIA (V158), or any combination thereof, as compared to a reference polypeptide that includes a Fc moiety that does not comprise the GAALIE mutation. In certain embodiments, enhanced binding is 30 determined by an increase (e.g., one or more of: a higher peak signal; a greater rate of association; a slower rate of dissociation; a greater area under the curve) in signal shift versus the reference binding protein in a BLI assay. In certain embodiments, the BLI assay comprises use of Octet(R) RED96 (ForteBio, Fremont, California USA) instrument. In further embodiments, the BLI assay comprises a tagged human FcyR captured onto an anti-penta-tag sensor and exposed to the binding protein. In some embodiments, the binding protein comprises a IgG Fab and the BLI assay further comprises exposing the captured human FcyR to the binding protein in the presence of an anti-IgG Fab binding fragment to cross-link the binding proteins through the Fab fragment.
In certain embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation and has enhanced binding to a human FcyRIIA (H131), a human FcyRIIA (R131), a human FcyRIIIA (F158), and/or a human FcyRIIIA (V158) as compared to a reference polypeptide, wherein the enhanced binding can comprise a signal shift (nanometers) in a BLI assay of 1.5, 2, 2.5, 3, or more times greater than the signal shift observed using the reference binding protein.
In certain embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation and has enhanced binding to a human FcyRIIA (H131), a human FcyRIIA (R131), a human FcyRIIIA (F 158), and a human FcyRIIIA (V158), as compared to a reference polypeptide.
In any of the presently disclosed embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation and has reduced binding to a human FcyRIIB, as compared to a reference polypeptide. In certain embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation and does not bind to a human FcyRIIB, as determined, for example, by the absence of a statistically significant signal shift versus baseline in a BLI assay.
In any of the presently disclosed embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation and has reduced binding to a human Clq (complément protein), as compared to a reference polypeptide. In certain embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation and does not bind to a human Clq, as determined by the absence of a statistically significant signal shift versus baseline in a BLI assay.
In any of the presently disclosed embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation and activâtes a human FcyRIIA, a human FcyRIIIA, or both, to a greater degree than does a reference polypeptide, (i.e., a polypeptide, which may be a HbsAg-specific binding protein, that includes a Fc moiety that does not comprise the GAALIE mutation). In certain embodiments, the reference polypeptide includes a Fc moiety that is a wild-type Fc moiety or that comprises one or more substitution mutation, provided that the substitution mutation is not GAALIE. In certain embodiments, a binding protein comprises HBC34-V35 antibody with a GAALIE mutation (and optionally other substitution mutations, such as, for example, MLNS), and a reference polypeptide is HBC34-V35 with a wild-type Fc moiety.
Activation of a human FcyR can be determined or detected using methods known. in the art. For example, a well-validated, commercially available bioreporter assay involves incubating a HBsAg-specific binding protein with a recombinant HBsAg (Engerix B, GlaxoSmithKline) in the presence of Jurkat effector cells (Promega; Cat. no: G9798) stably expressing (i) a FcyR of interest and (ii) firefly luciferase reporter under the control of a NFAT response element. Binding of Fc to cell surface-expressed FcyR drives NFAT-mediated expression of luciferase reporter gene. Luminescence is then measured with a luminometer (e.g., Bio-Tek) using the Bio-Glo-™ Luciferase Assay Reagent (Promega) according to the manufacturer’s instructions. Activation is expressed as the average of relative luminescence units (RLU) over the background by applying the following formula: (RLU at concentration [x] of binding protein (e.g., mAbs) - RLU of background).
In certain embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation activâtes a human FcyRIIA (H131), a human FcyRIIA (R131), a human FcyRIIIA (F158), and/or a human FcyRIIIA (V158) to a greater degree than does a reference polypeptide. In certain embodiments, a greater degree of activation refers to a higher peak luminescence and/or a greater luminescence area under the curve, as determined using a luminescence bioreporter assay as described herein. In certain embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation and activâtes a human FcyRIIA (H131), a human FcyRIIA (RI 31), and a human FcyRIIIA (F 158) to a greater degree than does a reference polypeptide, wherein the greater degree of activation comprises to a peak RLU that is 1.5, 2, 2.5, 3, or more times greater than the peak RLU observed using the reference binding protein.
In any of the presently disclosed embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation does not activate a human FcyRIIB, as determined by the absence of a statistically significant and/or measurable RLU in a luminescence bioreporter assay as described above.
In any ofthe presently disclosed embodiments, a binding protein includes a Fc moiety comprising a GAALIE mutation and activâtes a human natural killer (NK) cell in the presence of HBsAg to a greater degree than does a reference polypeptide. In certain embodiments, activation of a NK cell is determined by CD107a expression (e.g., by flow cytometry). In certain embodiments, the NK cell comprises a cell that comprises V158/V158 homozygous, a F158/F158 homozygous, or a V158/F158 heterozygous FcyRIIIa génotype.
It will be appreciated that any binding protein including a Fc moiety comprising a GAALIE mutation according to the présent disclosure can perform or possess any one or more of the features described herein; e.g., enhanced binding to a human FcyRIIA and/or a human FcyRIIIA as compared to a reference polypeptide; reduced binding to a human FcyRIIB as compared to a reference polypeptide (and/or no binding to a human FcyRIIB); reduced binding to a human Clq as compared to a reference polypeptide (and/or no binding to a human Clq); activâtes a FcyRIIA, a human FcyRIIIA, or both, to a greater degree than does a reference polypeptide; does not activate a human FcyRIIB; and/or activâtes a human natural killer (NK) cell in the presence of HBsAg to a greater degree than does a reference polypeptide (e.g., an antibody that is spécifie for
HBsAg and includes a Fc moiety that does not comprise a GAALIE mutation).
In certain embodiments, a binding protein of the présent disclosure includes a Fc moiety comprising a GAALIE mutation and: (i) has enhanced binding to a human FcyRIIA, a human FcyRIIIA, or both, as compared to a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E, wherein the human FcyRIIA is optionally H131 or R131, and/or the human FcyRIIIA is optionally F158 or V158; (ii) has reduced binding to a human FcyRIIB, as compared to a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E; (iii) does not bind to a human FcyRIIB; (iv) has reduced binding to a human Clq, as compared to a reference polypeptide that includes a Fc moiety that does not comprise
G236A/A330L/I332E; (v) does not bind to a human Clq; (vi) activâtes a FcyRIIA, a human FcyRIIIA, or both, to a greater degree than does a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E, wherein the human FcyRIIA is optionally H131 or R131, and/or the human FcyRIIIA is optionally F158 or V158; (vii) does not activate a human FcyRIIB; (viii) activâtes a human natural killer (NK) cell in the presence of HBsAg to a greater degree than does a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E, wherein the reference polypeptide is optionally an antibody that binds to an HB Ag, optionally an HBsAg; (ix) has an HBsAg EC50 of from about 12.75 ng/mL to about 19.9 ng/mL, or from about 12.75 ng/mL to about 12.84 ng/mL, or about 12.79 ng/mL, or from about 16.22 ng/mL to about 19.9 ng/mL, or about 17.97 ng/mL, and/or (b) has an HBeAg EC50 about from about 10.78 ng/mL to about 13.72 ng/mL, or from about 10.78 ng/mL to about 10.93 ng/mL, or about 10.85 ng/mL, or from about 11.59 ng/mL to about 13.72 ng/mL, or about 12.61 ng/mL, wherein the HBV is optionally HBV Génotype D, and wherein the EC50 is optionally determined in vitro by measuring HBsAg or HBeAg, respectively, secreted by HepG2 cells overexpressing NTCP and infected with the HBV, at day 7 following administration of the antibody or antigen binding fragment to the HepG2 cells; (x) has an HBsAg EC50 of from about 10.43 ng/mL to about 22.41 ng/mL, or about 13.81 ng/mL to about 16.56 ng/mL, or about 15.12 ng/mL, or from about 12.24 ng/mL to about 22.41 ng/mL, or about 16.56 ng/mL, or from about 10.43 ng/mL to about 20.08 ng/mL, or about 14.47 ng/mL, nand/or (b) has an HBeAg EC50 about from about 10.39 ng/mL to about 13.99 ng/mL, or from about 10.63 ng/mL to about 10.66 ng/mL, or about 10.64 ng/mL, or from about 10.39 ng/mL to about 10.60 ng/mL, or about 10.49 ng/mL, or from about 13.25 ng/mL to about 13.99 ng/mL, or about 13.61 ng/mL, wherein the HBV is optionally HBV Génotype D, and wherein the EC50 is optionally determined in vitro by measuring HBsAg or HBeAg, respectively, secreted by HepG2 cells overexpressing NTCP and infected with the HBV, at day 7 following administration of the antibody or antigen binding fragment to the HepG2 cells; (xi) is capable of binding to an HBsAg variant comprising HBsAg-Y100C/P120T, HBsAg-P120T, HBsAg-P120S/S143L, HBsAgC121S, HBsAg-R122D, HBsAg-R122I, HBsAg-T123N, HBsAg-Q129H, HBsAgQ129L, HBsAg-M133H, HBsAg-M133L, HBsAg-M133T, HBsAg-K141E, HBsAgP142S, HBsAg-S143K, HBsAg-D144A, HBsAg-G145R, HBsAg-N146A, or any combination thereof; (xii) has improved binding to an HBsAg variant comprising HBsAg-Y100C/P120T, HBsAg-P120T, HBsAg-P120S/S143L, HBsAg-C121S, HBsAg-R122D, HBsAg-R122I, HBsAg-T123N, HBsAg-Q129H, HBsAg-Q129L, HBsAg-M133H, HBsAg-M133L, HBsAg-M133T, HBsAg-K141E, HBsAg-P142S, HBsAg-S143K, HBsAg-D144A, HBsAg-G145R, HBsAg-N146A, or any combination thereof, as compared to a reference antibody or antigen binding fragment that binds to HBsAg and that includes a Fc moiety that does not comprise G236A/A330L/I332E; and/or (xiii) is capable of neutralizing (a) an HBV of génotype A with an EC50 of about 2.34 ng/mL; (b) an HBV of génotype B with an EC50 of about 2.22 ng/mL; (c) an HBV of génotype C with an EC50 of about 0.92 ng/mL; (d) an HBV of génotype D with an EC50 of about 1.10 ng/mL; (e) an HBV of génotype E with an EC50 of about 1.12 ng/mL; (f) an HBV of génotype F with an EC50 of about 1.93 ng/mL; (g) an HBV of génotype G with an EC50 of about 1.43 ng/mL; and/or (h) an HBV of génotype H with an EC50 of about 1.93 ng/mL, wherein the EC50 is optionally determined using a recombinant HDV engineered to express an HBsAg of the HBV génotype.
Alternatively or additionally, the Fc moiety of a binding protein of the disclosure can comprise at least a portion known in the art to be required for Protein A binding; and/or the Fc moiety of an antibody of the disclosure comprises at least the portion of an Fc molécule known in the art to be required for protein G binding. In some embodiments, a retained function comprises the clearance of HBsAg and HBVg. Accordingly, in certain embodiments, an Fc moiety comprises at least a portion known in the art to be required for FcyR binding. As outlined above, an Fc moiety may thus at least comprise (i) the lower hinge site of native IgG Fc, in particular amino acid residues L, L, G, G (234 237, EU numbering), and (ii) the adjacent région of the CH2 domain of native IgG Fc, in particular a loop and strands in the upper CH2 domain adjacent to the lower hinge région, e.g. in a région of P331, for example a région of at least 3, 4, 5, 6, 7, 8, 9, or 10 consecutive amino acids in the upper CH2 domain of native IgG Fc around P331, e.g. between amino acids 320 and 340 (EU numbering) of native IgG Fc.
In some embodiments, a binding protein according to the présent disclosure comprises an Fc région. As used herein, the term Fc région refers to the portion of an immunoglobulin formed by two or more Fc moieties of antibody heavy chains. For example, an Fc région may be monomeric or single-chain Fc région (i.e., a scFc région). Single chain Fc régions are comprised of Fc moieties linked within a single polypeptide chain (e.g., encoded in a single contiguous nucleic acid sequence). Exemplary scFc régions are disclosed in WO 2008/143954 A2, and are incorporated by reference herein. The Fc région can be or comprise a dimeric Fc région. A dimeric Fc région or dcFc refers to the dimer formed by the Fc moieties of two separate immunoglobulin heavy chains. The dimeric Fc région may be a homodimer of two identical Fc moieties (e.g., an Fc région of a naturally occurring immunoglobulin) or a heterodimer of two non-identical Fc moieties (e.g., one Fc monomer of the dimeric Fc région comprises at least one amino acid modification (e.g., substitution, délétion, insertion, or Chemical modification) that is not présent in the other Fc monomer, or one Fc monomer may be truncated as compared to the other).
Particular embodiments include those antibodies and antigen binding fragments having a heavy chain (e.g., VH-hinge-CHl-CH2-CH3) according to SEQ ID NO:91 or SEQ ID NO:92 or SEQ ID NO: 138, and those having a light chain (i.e., VL-CL) according to SEQ ID NO:93 or SEQ ID NO:94. In certain embodiments, an antibody or antigen binding fragment comprises a heavy chain according to SEQ ID NO:91 and a light chain according to SEQ ID NO:93. In other embodiments, an antibody or antigen binding fragment comprises a heavy chain according to SEQ ID NO:92 and a light chain according to SEQ ID NO:94. In other embodiments, an antibody or antigen binding fragment comprises a heavy chain according to SEQ ID NO:91 and a light chain according to SEQ ID NO:94. In other embodiments, an antibody or antigen binding fragment comprises a heavy chain according to SEQ ID NO:92 and a light chain according to SEQ ID NO:93. In some embodiments, an antibody or antigen binding fragment comprises or consists of a heavy chain according to SEQ ID NO: 129. In some embodiments, an antibody or antigen binding fragment comprises or consists of a heavy chain according to SEQ ID NO:138, and optionally a light chain according to any one of SEQ ID NOs:93 or 94. These sequences are provided in the Sequence Listing.
Presently disclosed Fc moieties may comprise Fc sequences or régions of the same or different class and/or subclass. For example, Fc moieties may be derived from an immunoglobulin (e.g., a human immunoglobulin) of an IgGl, IgG2, IgG3 or IgG4 subclass, or from any combination thereof. In certain embodiments, the Fc moieties of Fc région are of the same class and subclass. However, the Fc région (or one or more Fc moieties of an Fc région) may also be chimeric, whereby a chimeric Fc région may comprise Fc moieties derived from different immunoglobulin classes and/or subclasses. For example, at least two of the Fc moieties of a dimeric or single-chain Fc région may be from different immunoglobulin classes and/or subclasses. In certain embodiments, a dimeric Fc région can comprise sequences from two or more different isotypes or subclasses; e.g., a SEEDbody (strand-exchange engineered domains), see Davis et al., Protein Eng. Des. Sel. 23(4):195 (2010).
Additionally or altematively, chimeric Fc régions may comprise one or more chimeric Fc moieties. For example, the chimeric Fc région or moiety may comprise one or more portions derived from an immunoglobulin of a first subclass (e.g., an IgGl, IgG2, or IgG3 subclass) while the remainder of the Fc région or moiety is of a different subclass. For example, an Fc région or moiety of an Fc polypeptide may comprise a CH2 and/or CH3 domain derived from an immunoglobulin of a first subclass (e.g., an IgGl, IgG2 or
IgG4 subclass) and a hinge région from an immunoglobulin of a second subclass (e.g., an IgG3 subclass). For example, the Fc région or moiety may comprise a hinge and/or CH2 domain derived from an immunoglobulin of a first subclass (e.g., an IgG4 subclass) and a CH3 domain from an immunoglobulin of a second subclass (e.g., an IgGl, IgG2, or IgG3 subclass). For example, the chimeric Fc région may comprise an Fc moiety (e.g., a complété Fc moiety) from an immunoglobulin for a first subclass (e.g., an IgG4 subclass) and an Fc moiety from an immunoglobulin of a second subclass (e.g., an IgGl, IgG2 or IgG3 subclass). For example, the Fc région or moiety may comprise a CH2 domain from an IgG4 immunoglobulin and a CH3 domain from an IgGl immunoglobulin. For example, the Fc région or moiety may comprise a CH1 domain and a CH2 domain from an IgG4 molécule and a CH3 domain from an IgGl molécule. For example, the Fc région or moiety may comprise a portion of a CH2 domain from a particular subclass of antibody, e.g., EU positions 292-340 of a CH2 domain. For example, an Fc région or moiety may comprise amino acids a positions 292-340 of CH2 derived from an IgG4 moiety and the remainder of CH2 derived from an IgGl moiety (altematively, 292-340 of CH2 may be derived from an IgGl moiety and the remainder of CH2 derived from an IgG4 moiety).
It will also be appreciated that any antibody, antigen-binding fragment, or Fc région or moiety of the présent disclosure can be of any allotype and/or haplotype. For example, human Immunoglobulin G allotypes include those disclosed in Jefferis and LeFranc, mAbs 7(4):1-7 (2009), which allotypes (including Glm (l(a); 2(x); 3(f); and 17(z)); G2m (23(n)); G3m (21(gl); 28(g5); 1 l(b0); 5(b2); 13(b3); 14(b4); 10(b5); 15(s); 16(t); 6(c3); 24(c5); 26(u); and 27(v)); A2m (1 and 2); and Km (1; 2; and 3) and haplotypes, and résultant amino acid sequences, and combinations thereof, are incorporated herein by reference. In certain embodiments, an antibody, antigen-binding fragment, or Fc région or moiety ofthe présent disclosure comprises a IgGl allotype glml7, kl.
Moreover, an Fc région or moiety may (additionally or altematively) for example comprise a chimeric hinge région. For example, the chimeric hinge may be derived, e.g. in part, from an IgGl, IgG2, or IgG4 molécule (e.g., an upper and lower middle hinge sequence) and, in part, from an IgG3 molécule (e.g., an middle hinge sequence). In another example, an Fc région or moiety may comprise a chimeric hinge derived, in part, from an IgGl molécule and, in part, from an IgG4 molécule. In another example, the chimeric hinge may comprise upper and lower hinge domains from an IgG4 molécule and a middle hinge domain from an IgGl molécule. Such a chimeric hinge may be made, for example, by introducing a proline substitution (Ser228Pro) at EU position 228 in the middle hinge domain of an IgG4 hinge région. In another embodiment, the chimeric hinge can comprise amino acids at EU positions 233-236 are from an IgG2 antibody and/or the Ser228Pro mutation, wherein the remaining amino acids of the hinge are from an IgG4 antibody (e.g., a chimeric hinge of the sequence ESKYGPPCPPCPAPPVAGP). Further chimeric hinges which may be used in the Fc moiety of the antibody according to the présent disclosure are described in US 2005/0163783 Al.
In some embodiments of the binding proteins disclosed herein, the Fc moiety, or the Fc région, comprises or consists of an amino acid sequence derived from a human immunoglobulin sequence (e.g., from an Fc région or Fc moiety from a human IgG molécule). However, polypeptides may comprise one or more amino acids from another mammalian species. For example, a primate Fc moiety or a primate binding site may be included in the subject polypeptides. Alternatively, one or more murine amino acids may be présent in the Fc moiety or in the Fc région.
Nucleic acid molécule
In another aspect, the disclosure provides a nucleic acid molécule comprising a polynucleotide encoding an antibody, antigen binding fragment, or fusion protein according to the présent disclosure
Table 4 shows exemplary Vh-, Vl-, CH-, CL-, HC-, and LC-encoding nucléotide sequences according to the présent disclosure:
Antibody nucléotide acid sequence description | SEQ IDNO: | nuclecotide sequence |
Antibody nucléotide acid sequence description | SEQ ID NO: | nuclecotide sequence |
VH of HBC34-V7, HBC34-V35, and HBC34- V34 (codon optimized) | 103 | GAGCTGCAGCTGGTGGAGTCCGGCGGC GGCTGGGTGCAGCCTGGCGGCTCCCAGA GGCTGAGCTGTGCCGCTTCTGGCAGGAT CTTCCGGTCCTTTTACATGTCTTGGGTGC GGCAGGCTCCAGGCAAGGGCCTGGAGT GGGTGGCTACCATCAACCAGGACGGCTC CGAGAAGCTGTATGTGGATAGCGTGAA GGGCAGATTCACAATCTCTCGCGACAAC GCCAAGAACTCCCTGTTTCTGCAGATGA ACAATCTGAGGGTGGAGGATACCGCCGT GTACTATTGCGCCGCTTGGTCTGGCAAT AGCGGCGGCATGGACGTGTGGGGACAG GGCACCACCGTGTCCGTGTCCAGC |
HBC34-V34 Vl (codon optimized) | 104 | AGCTACGAGCTGACACAGCCCCCTTCCG TGTCCGTGTCCCCTGGACAGACCGTGTC CATCCCATGCAGCGGCGACAAGCTGGGC AACAAGAACGTGTCCTGGTTTCAGCATA AGCCTGGCCAGTCCCCCGTGCTGGTCAT CTACGAGGTGAAGTATAGGCCCAGCGG CATCCCTGAGCGGTTCTCTGGCTCCAAC AGCGGCAATACAGCCACCCTGACAATCT CTGGCACACAGGCTATGGACGAGGCCG CTTATTTCTGCCAGACCTTTGATTCCACC ACAGTGGTGTTCGGCGGCGGCACCAGAC TGACAGTGCTG |
HBC34-V35 VL (codon optimized) | 105 | AGCTACGAGCTGACACAGCCCCCTTCCG TGTCCGTGTCCCCTGGACAGACCGTGTC CATCCCATGCAGCGGCGACAAGCTGGGC AACAAGAACGTGGCCTGGTTTCAGCATA |
Antibody nucléotide acid sequence description | SEQ ID NO: | nuclecotide sequence |
AGCCTGGCCAGTCCCCCGTGCTGGTCAT CTACGAGGTGAAGTATAGGCCCAGCGG CATCCCTGAGCGGTTCTCTGGCTCCAAC AGCGGCAATACAGCCACCCTGACAATCT CTGGCACACAGGCTATGGACGAGGCCG CTTATTTCTGCCAGACCTTTGATTCCACC ACAGTGGTGTTCGGCGGCGGCACCAGAC TGACAGTGCTG | ||
HBC34-V7 Vl (codon optimized) | 110 | AGCTACGAGCTGACACAGCCCCCTTCCG TGTCCGTGTCCCCTGGACAGACCGTGTC CATCCCATGCAGCGGCGACAAGCTGGGC AACAAGAACGTGTGCTGGTTTCAGCATA AGCCTGGCCAGTCCCCCGTGCTGGTCAT CTACGAGGTGAAGTATAGGCCCAGCGG CATCCCTGAGCGGTTCTCTGGCTCCAAC AGCGGCAATACAGCCACCCTGACAATCT CTGGCACACAGGCTATGGACGAGGCCG CTTATTTCTGCCAGACCTTTGATTCCACC ACAGTGGTGTTCGGCGGCGGCACCAGAC TGACAGTGCTG |
HBC24 Vh (wild type) | 106 | gaggtgcagttgttggagtctgggggaggcttggtacagcctgg ggggtccctgagactctcctgtgcagcctctGGATCCACT TTTACCAAATATGCCatgagctgggtccgtcaggct ccagggaaggggctggagtgggtcgcaagtATTAGTGG AAGTgttcctggttttGGTATTGACACAtactacgca gactccgttaagggccggttcaccatctccagagacacttccaag aacaccctgtatctgcaaatgaacagcctgagagccgaggacac ggccttatattactgtGCGAAAGATGTCGGGGTTA TCGGGTCATACTATTACTACGCTATGGA |
Antibody nucléotide acid sequence description | SEQ ID NO: | nuclecotide sequence |
CGTCtggggtcaa | ||
HBC24 VL (wild type) | 107 | aaattgtgttgacgcagtctccaggcaccctgtctttgtctccaggg gaaagagccaccctctcctgcagggccagtCAGGGTCTT AGCAGCAGTTACttagcctggtaccagcagaaacctg gccaggctcccaggctcctcatctatAGTGCGTCCaccag ggccactggcatcccagacaggttcagtggcagtgggtctggga cagacttcactctcaccatcagcagactggagcctgaagattttgc agtgtattactgtCAACAGTATGCTTACTCACCT CGGTGGACGttcggccaagggaccaaggtggagatcaa ac |
HBC24 VH (codon optimized) | 108 | GAGGTGCAGCTGCTGGAAAGCGGCGGC GGCCTGGTGCAGCCCGGCGGCTCCCTGA GGCTGTCTTGCGCCGCCTCTGGCAGCAC CTTCACAAAGTATGCAATGTCTTGGGTG CGCCAGGCACCAGGCAAGGGCCTGGAG TGGGTGGCCTCCATCTCTGGCAGCGTGC CTGGCTTCGGCATCGACACCTACTATGC CGATTCCGTGAAGGGCCGGTTTACAATC AGCAGAGACACCTCCAAGAACACACTG TATCTGCAGATGAATTCTCTGCGGGCCG AGGACACCGCCCTGTACTATTGTGCCAA GGATGTGGGCGTGATCGGCAGCTACTAT TACTATGCAATGGACGTGTGGGGACAGG GAACAGCAGTGACAGTGAGCTCC |
HBC24 Vl (codon optimized) | 109 | GAGATCGTGCTGACCCAGTCTCCTGGCA CACTGTCCCTGTCCCCTGGAGAGAGAGC CACCCTGTCCTGCAGAGCCTCTCAGGGC CTGAGCTCCTCTTACCTGGCCTGGTATC AGCAGAAGCCTGGACAGGCCCCTCGGCT |
Antibody nucléotide acid sequence description | SEQ ID NO: | nuclecotide sequence |
GCTGATCTACTCTGCCTCCACCAGAGCA ACAGGCATTCCTGACCGCTTCTCCGGAT CTGGAAGCGGCACAGACTTCACCCTGAC AATCAGCCGGCTGGAGCCTGAGGACTTC GCCGTGTACTATTGTCAGCAGTACGCCT ATTCCCCAAGGTGGACCTTTGGCCAGGG CACAAAGGTGGAGATCAAG | ||
HBC34-V7, HBC34-V34, HBC34-V35 CHl-hinge-CH2-CH3 (codon-optimized) | 130 | GCCTCCACAAAGGGCCCAAGCGTGTTTC CACTGGCTCCCTCTTCCAAGTCTACCTCC GGCGGCACAGCCGCTCTGGGATGTCTGG TGAAGGATTACTTCCCAGAGCCCGTGAC CGTGTCTTGGAACTCCGGCGCCCTGACC AGCGGAGTGCATACATTTCCAGCTGTGC TGCAGAGCTCTGGCCTGTACTCTCTGTC CAGCGTGGTGACCGTGCCCTCTTCCAGC CTGGGCACCCAGACATATATCTGCAACG TGAATCACAAGCCAAGCAATACAAAGG TGGACAAGAAGGTGGAGCCCAAGTCTT GTGATAAGACCCATACATGCCCTCCATG TCCAGCTCCAGAGCTGCTGGGCGGCCCA AGCGTGTTCCTGTTTCCACCCAAGCCTA AGGATACCCTGATGATCTCCAGAACCCC CGAGGTGACATGCGTGGTGGTGGACGTG AGCCACGAGGATCCTGAGGTGAAGTTCA ACTGGTACGTGGACGGCGTGGAGGTGC ATAATGCTAAGACCAAGCCCAGGGAGG AGCAGTACAACTCTACCTATCGGGTGGT GTCCGTGCTGACAGTGCTGCACCAGGAT TGGCTGAACGGCAAGGAGTATAAGTGC |
Antibody nucléotide acid sequence description | SEQ ID NO: | nuclecotide sequence |
AAGGTGTCTAATAAGGCCCTGCCCGCTC CTATCGAGAAGACCATCTCCAAGGCCAA GGGCCAGCCTAGAGAGCCACAGGTGTA CACACTGCCTCCATCTCGCGATGAGCTG ACCAAGAACCAGGTGTCCCTGACATGTC TGGTGAAGGGCTTCTATCCTTCCGACAT CGCTGTGGAGTGGGAGAGCAATGGCCA GCCAGAGAACAATTACAAGACCACACC CCCTGTGCTGGACAGCGATGGCTCTTTC TTTCTGTATAGCAAGCTGACCGTGGACA AGTCTCGCTGGCAGCAGGGCAACGTGTT TAGCTGTTCTGTGATGCATGAGGCCCTG CACAATCATTATACACAGAAGTCCCTGA GCCTGTCTCCTGGCAAG | ||
HBC34-V7, HBC34-V34, HBC34-V35 HC (VH-CHl-hinge-CH2- CH3) (codon-optimized) | 131 | GAGCTGCAGCTGGTGGAGTCCGGCGGC GGCTGGGTGCAGCCTGGCGGCTCCCAGA GGCTGAGCTGTGCCGCTTCTGGCAGGAT CTTCCGGTCCTTTTACATGTCTTGGGTGC GGCAGGCTCCAGGCAAGGGCCTGGAGT GGGTGGCTACCATCAACCAGGACGGCTC CGAGAAGCTGTATGTGGATAGCGTGAA GGGCAGATTCACAATCTCTCGCGACAAC GCCAAGAACTCCCTGTTTCTGCAGATGA ACAATCTGAGGGTGGAGGATACCGCCGT GTACTATTGCGCCGCTTGGTCTGGCAAT AGCGGCGGCATGGACGTGTGGGGACAG GGCACCACCGTGTCCGTGTCCAGCGCCT CCACAAAGGGCCCAAGCGTGTTTCCACT GGCTCCCTCTTCCAAGTCTACCTCCGGC |
Antibody nucléotide acid sequence description | SEQ IDNO: | nuclecotide sequence |
GGCACAGCCGCTCTGGGATGTCTGGTGA AGGATTACTTCCCAGAGCCCGTGACCGT GTCTTGGAACTCCGGCGCCCTGACCAGC GGAGTGCATACATTTCCAGCTGTGCTGC AGAGCTCTGGCCTGTACTCTCTGTCCAG CGTGGTGACCGTGCCCTCTTCCAGCCTG GGCACCCAGACATATATCTGCAACGTGA ATCACAAGCCAAGCAATACAAAGGTGG ACAAGAAGGTGGAGCCCAAGTCTTGTG ATAAGACCCATACATGCCCTCCATGTCC AGCTCCAGAGCTGCTGGGCGGCCCAAGC GTGTTCCTGTTTCCACCCAAGCCTAAGG ATACCCTGATGATCTCCAGAACCCCCGA GGTGACATGCGTGGTGGTGGACGTGAGC CACGAGGATCCTGAGGTGAAGTTCAACT GGTACGTGGACGGCGTGGAGGTGCATA ATGCTAAGACCAAGCCCAGGGAGGAGC AGTACAACTCTACCTATCGGGTGGTGTC CGTGCTGACAGTGCTGCACCAGGATTGG CTGAACGGCAAGGAGTATAAGTGCAAG GTGTCTAATAAGGCCCTGCCCGCTCCTA TCGAGAAGACCATCTCCAAGGCCAAGG GCCAGCCTAGAGAGCCACAGGTGTACA CACTGCCTCCATCTCGCGATGAGCTGAC CAAGAACCAGGTGTCCCTGACATGTCTG GTGAAGGGCTTCTATCCTTCCGACATCG CTGTGGAGTGGGAGAGCAATGGCCAGC CAGAGAACAATTACAAGACCACACCCC CTGTGCTGGACAGCGATGGCTCTTTCTTT |
Antibody nucléotide acid sequence description | SEQ IDNO: | nuclecotide sequence |
CTGTATAGCAAGCTGACCGTGGACAAGT CTCGCTGGCAGCAGGGCAACGTGTTTAG CTGTTCTGTGATGCATGAGGCCCTGCAC AATCATTATACACAGAAGTCCCTGAGCC TGTCTCCTGGCAAGTGATGAGGTACCGT GCGACGGCCGGCAAGCCCCCGCTCCCCG GGCTCTCGCGGTCGTACGAGGAAAGCTT | ||
HBC34-V7 CL (codon-optimized) | 132 | GGACAGCCAAAGGCTGCTCCATCTGTGA CCCTGTTTCCACCCTCTTCCGAGGAGCT GCAGGCCAACAAGGCCACCCTGGTGTGC CTGATCTCTGACTTCTACCCTGGAGCTGT GACAGTGGCTTGGAAGGCTGATAGCTCT CCCGTGAAGGCTGGCGTGGAGACAACA ACCCCTAGCAAGCAGTCTAACAATAAGT ACGCCGCTTCCAGCTATCTGTCTCTGAC ACCAGAGCAGTGGAAGTCCCACCGCTCT TATTCCTGCCAGGTGACCCATGAGGGCA GCACCGTGGAGAAGACAGTGGCCCCCA CCGAGTGTTCT |
HBC34-V7 LC (VL-CL) (codon- optimized) | 133 | AGCTACGAGCTGACACAGCCCCCTTCCG TGTCCGTGTCCCCTGGACAGACCGTGTC CATCCCATGCAGCGGCGACAAGCTGGGC AACAAGAACGTGTGCTGGTTTCAGCATA AGCCTGGCCAGTCCCCCGTGCTGGTCAT CTACGAGGTGAAGTATAGGCCCAGCGG CATCCCTGAGCGGTTCTCTGGCTCCAAC AGCGGCAATACAGCCACCCTGACAATCT CTGGCACACAGGCTATGGACGAGGCCG CTTATTTCTGCCAGACCTTTGATTCCACC |
Antibody nucléotide acid sequence description | SEQ ID NO: | nuclecotide sequence |
ACAGTGGTGTTCGGCGGCGGCACCAGAC TGACAGTGCTGGGACAGCCAAAGGCTG CTCCATCTGTGACCCTGTTTCCACCCTCT TCCGAGGAGCTGCAGGCCAACAAGGCC ACCCTGGTGTGCCTGATCTCTGACTTCTA CCCTGGAGCTGTGACAGTGGCTTGGAAG GCTGATAGCTCTCCCGTGAAGGCTGGCG TGGAGACAACAACCCCTAGCAAGCAGT CTAACAATAAGTACGCCGCTTCCAGCTA TCTGTCTCTGACACCAGAGCAGTGGAAG TCCCACCGCTCTTATTCCTGCCAGGTGA CCCATGAGGGCAGCACCGTGGAGAAGA CAGTGGCCCCCACCGAGTGTTCT | ||
HBC34-V34, HBC34V35 CL (codon-optimized) | 134 | GGACAGCCAAAGGCTGCTCCATCTGTGA CCCTGTTTCCACCCTCTTCCGAGGAGCT GCAGGCCAACAAGGCCACCCTGGTGTGC CTGATCTCTGACTTCTACCCTGGAGCTGT GACAGTGGCTTGGAAGGCTGATAGCTCT CCCGTGAAGGCTGGCGTGGAGACAACA ACCCCTAGCAAGCAGTCTAACAATAAGT ACGCCGCTTCCAGCTATCTGTCTCTGAC ACCAGAGCAGTGGAAGTCCCACCGCTCT TATTCCTGCCAGGTGACCCATGAGGGCA GCACCGTGGAGAAGACAGTGGCCCCCA CCGAGTGTTCT |
HBC34-V34 LC (VL-CL) (codon-optimized) | 135 | AGCTACGAGCTGACACAGCCCCCTTCCG TGTCCGTGTCCCCTGGACAGACCGTGTC CATCCCATGCAGCGGCGACAAGCTGGGC AACAAGAACGTGTCCTGGTTTCAGCATA |
Antibody nucléotide acid sequence description | SEQ ID NO: | nuclecotide sequence |
AGCCTGGCCAGTCCCCCGTGCTGGTCAT CTACGAGGTGAAGTATAGGCCCAGCGG CATCCCTGAGCGGTTCTCTGGCTCCAAC AGCGGCAATACAGCCACCCTGACAATCT CTGGCACACAGGCTATGGACGAGGCCG CTTATTTCTGCCAGACCTTTGATTCCACC ACAGTGGTGTTCGGCGGCGGCACCAGAC TGACAGTGCTGGGACAGCCAAAGGCTG CTCCATCTGTGACCCTGTTTCCACCCTCT TCCGAGGAGCTGCAGGCCAACAAGGCC ACCCTGGTGTGCCTGATCTCTGACTTCTA CCCTGGAGCTGTGACAGTGGCTTGGAAG GCTGATAGCTCTCCCGTGAAGGCTGGCG TGGAGACAACAACCCCTAGCAAGCAGT CTAACAATAAGTACGCCGCTTCCAGCTA TCTGTCTCTGACACCAGAGCAGTGGAAG TCCCACCGCTCTTATTCCTGCCAGGTGA CCCATGAGGGCAGCACCGTGGAGAAGA CAGTGGCCCCCACCGAGTGTTCT | ||
HBC34-V35 LC (VL-CL) (codon- optimized) | 136 | AGCTACGAGCTGACACAGCCCCCTTCCG TGTCCGTGTCCCCTGGACAGACCGTGTC CATCCCATGCAGCGGCGACAAGCTGGGC AACAAGAACGTGGCCTGGTTTCAGCATA AGCCTGGCCAGTCCCCCGTGCTGGTCAT CTACGAGGTGAAGTATAGGCCCAGCGG CATCCCTGAGCGGTTCTCTGGCTCCAAC AGCGGCAATACAGCCACCCTGACAATCT CTGGCACACAGGCTATGGACGAGGCCG CTTATTTCTGCCAGACCTTTGATTCCACC |
Antibody nucléotide acid sequence description | SEQ ID NO: | nuclecotide sequence |
ACAGTGGTGTTCGGCGGCGGCACCAGAC TGACAGTGCTGGGACAGCCAAAGGCTG CTCCATCTGTGACCCTGTTTCCACCCTCT TCCGAGGAGCTGCAGGCCAACAAGGCC ACCCTGGTGTGCCTGATCTCTGACTTCTA CCCTGGAGCTGTGACAGTGGCTTGGAAG GCTGATAGCTCTCCCGTGAAGGCTGGCG TGGAGACAACAACCCCTAGCAAGCAGT CTAACAATAAGTACGCCGCTTCCAGCTA TCTGTCTCTGACACCAGAGCAGTGGAAG TCCCACCGCTCTTATTCCTGCCAGGTGA CCCATGAGGGCAGCACCGTGGAGAAGA CAGTGGCCCCCACCGAGTGTTCT |
Due to the redundancy of the genetic code, the présent disclosure also comprises sequence variants of these nucleic acid sequences and in particular such sequence 5 variants, which encode the same amino acid sequences.
In certain embodiments, a polynucleotide or nucleic acid molécule comprises a nucléotide sequence sharing at least 80% identity to the nucléotide sequence according to any one of SEQ ID NOs: 103-110 and 130-136, wherein the nucléotide sequence is 10 codon optimized for expression by a host cell.
In particular embodiments, a nucleic acid molécule according to the présent disclosure comprises or consists of a nucleic acid sequence according to any one of SEQ ID NOs: 103-110 and 130-136.
In certain embodiments, a polynucleotide comprises a Vu-encoding nucléotide sequence according to SEQ ID NO: 103 and a VL-encoding nucléotide sequence according to SEQ ID NO: 105. In other embodiments, a polynucleotide comprises a Vhencoding nucléotide sequence according to SEQ ID NO:103, and a VL-encoding nucléotide sequence according to SEQ ID NO: 104. In other embodiments, a polynucleotide comprises a VH-encoding nucléotide sequence according to SEQ ID
NO: 108, and a VL-encoding nucléotide sequence according to SEQ ID NO: 109.
Also provided herein are polynucleotides that encode an antibody or antigen binding fragment, wherein the polynucleotide comprises or consists of a Vn-encoding nucléotide sequence according to SEQ ID NO: 103 and a Vt-encoding nucléotide sequence according to SEQ ID NO:110, wherein the encoded antibody or antigen binding fragment binds to the antigenic loop région of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
In any ofthe presently disclosed embodiments, a polynucleotide can comprise a CH1hinge-CH2-CH3-encoding nucléotide sequence according to SEQ ID NO: 130, and/or comprises a HC (VH-CHl-hinge-CH3-CH3)-encoding nucléotide sequence according to SEQ ID NO:131. In some embodiments, a polynucleotide comprises a CL-encoding nucléotide sequence according to SEQ ID NO: 132 and/or comprises a LC (VL-CL)encoding nucléotide sequence according to SEQ ID NO:133. In other embodiments, a polynucleotide comprises a CL-encoding nucléotide sequence according to SEQ ID NO: 134 and/or comprises a LC (VL-CL)-encoding nucléotide sequence according to SEQ ID NO: 135 or SEQ ID NO: 136.
Vectors
Further included within the scope of the disclosure are vectors, for example, expression vectors, that comprise a nucleic acid molécule according to the présent disclosure.
The term vector refers to a construct comprising a nucleic acid molécule. A vector in the context of the présent disclosure is suitable for incorporating or harboring a desired nucleic acid sequence. Such vectors may be storage vectors, expression vectors, cloning vectors, transfer vectors etc. A storage vector is a vector which allows the convenient storage of a nucleic acid molécule. Thus, the vector may comprise a sequence corresponding, e.g., to a desired antibody or antibody fragment thereof according to the présent description.
As used herein, expression vector refers to a DNA construct containing a nucleic acid molécule that is operably linked to a suitable control sequence capable of effecting the expression of the nucleic acid molécule in a suitable host. Such control sequences include a promoter (e.g., a heterologous promoter) to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites, and sequences which control termination of transcription and translation. Any ofthe éléments of an expression vector that contribute to transcription of a nucleic acid molécule of interest may be heterologous to the vector. The vector may be a plasmid, a phage particle, a virus, or simply a potential genomic insert. Once transformed into a suitable host, the vector may replicate and function independently of the host genome, or may, in some instances, integrate into the genome itself. In the présent spécification, plasmid, expression plasmid, virus and vector are often used interchangeably.
A cloning vector is typically a vector that contains a cloning site, which may be used to incorporate nucleic acid sequences into the vector. A cloning vector may be, e.g., a plasmid vector or a bactériophage vector.
A transfer vector may be a vector which is suitable for transferring nucleic acid molécules into cells or organisms, for example, viral vectors. A vector in the context of the présent disclosure may be, e.g., an RNA vector or a DNA vector. A vector may be a DNA molécule. For example, a vector in the sense of the présent application comprises a cloning site, a sélection marker, such as an antibiotic résistance factor, and a sequence suitable for multiplication of the vector, such as an origin of réplication. In some embodiments, a vector in the context of the présent application is a plasmid vector. In certain such embodiments, a vector comprises a lentiviral vector or a retroviral vector.
Cells
In a further aspect, the présent disclosure also provides a cell (also referred to as a host cell) expressing an antibody, antigen binding fragment, or fusion protein according to the présent disclosure; or comprising a vector or polynucleotide according the présent disclosure.
Examples of such cells include but are not limited to, eukaryotic cells, e.g., yeast cells, animal cells, insect cells, plant cells; and prokaryotic cells, including E. coli. In some embodiments, the cells are mammalian cells. In certain such embodiments, the cells are a mammalian cell line such as CHO cells (e.g., DHFR- CHO cells (Urlaub et al., PNAS 77:4216 (1980), CHO-KSV), human embryonic kidney cells (e.g., HEK293T cells), PER.C6 cells, Y0 cells, Sp2/0 cells. NS0 cells, human liver cells, e.g. Hepa RG cells, myeloma cells or hybridoma cells. Other examples of mammalian host cell lines include mouse sertoli cells (e.g., TM4 cells); monkey kidney CV1 line transformed by SV40 (COS-7); baby hamster kidney cells (BHK); African green monkey kidney cells (VERO-76); monkey kidney cells (CV1); human cervical carcinoma cells (HELA); human lung cells (W138); human liver cells (Hep G2); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); mouse mammary tumor (MMT 060562); TRI cells; MRC 5 cells; and FS4 cells. Mammalian host cell lines suitable for antibody production also include those described in, for example, Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J.), pp. 255268 (2003).
In certain embodiments, a host cell is a prokaryotic cell, such as an E. coli. The expression of peptides in prokaryotic cells such as E. coli is well established (see, e.g., Pluckthun, A. Bio/Technology 9:545-551 (1991). For example, antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed. For expression of antibody fragments and polypeptides in bacteria, see, e.g., U.S. Pat. Nos. 5,648,237; 5,789,199; and 5,840,523.
Insect cells useful expressing a binding protein of the présent disclosure are known in the art and include, for example, Spodoptera frugipera Sf9 cells, Trichoplusia ni BTI20238
TN5B1-4 cells, and Spodoptera frugipera SfSWTOl “MimicT ” cells. See, e.g.,
Palmberger et al., J. Biotechnol. 753(3-4):160-166 (2011). Numerous baculoviral strains hâve been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
Eukaryotic microbes such as filamentous fungi or yeast are also suitable hosts for cloning or expressing protein-encoding vectors, and include fungi and yeast strains with “humanized” glycosylation pathways, resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gemgross, Nat. Biotech. 22:14091414 (2004); Li et al., Nat. Biotech. 24:210-215 (2006).
Plant cells can also be utilized as hosts for expressing a binding protein of the présent disclosure. For example, PLANTIBODIES™ technology (described in, for example, U.S. Pat. Nos. 5,959,177; 6,040,498; 6,420,548; 7,125,978; and 6,417,429) employs transgenic plants to produce antibodies.
In some embodiments, a fusion protein is expressed at a cell surface by an immune cell, e.g., a T cell, NK cell, or NK-T cell, or any subtype thereof.
Any protein expression system compatible with the disclosure may be used to produce the disclosed binding proteins. Suitable expression Systems include transgenic animais described in Gene Expression Systems, Academie Press, eds. Fernandez et al., 1999.
In particular embodiments, the cell may be transfected with a vector according to the présent description with an expression vector. The term transfection refers to the introduction of nucleic acid molécules, such as DNA or RNA (e.g. mRNA) molécules, into cells, such as into eukaryotic cells. In the context of the présent description, the term “transfection” encompasses any method known to the skilled person for introducing nucleic acid molécules into cells, such as into eukaryotic cells, including into mammalian cells. Such methods encompass, for example, electroporation, lipofection, e.g., based on cationic lipids and/or liposomes, calcium phosphate précipitation, nanoparticle based transfection, virus based transfection, or transfection based on cationic polymers, such as DEAE-dextran or polyethylenimine etc. In certain embodiments, the introduction is non-viral.
Moreover, cells of the présent disclosure may be transfected stably or transiently with the vector according to the présent description, e.g. for expressing an antibody, or an antigen binding fragment thereof, according to the présent description. In such embodiments, the cells are stably transfected with the vector as described herein encoding a binding protein. Alternatively, cells may be transiently transfected with a vector according to the présent disclosure encoding a binding protein according to the présent description. In any of the presently disclosed embodiments, a polynucleotide may be heterologous to the host cell.
In a related aspect, the présent disclosure provides methods for producing an antibody, antigen binding fragment, or fusion protein, wherein the methods comprise culturing a host cell ofthe présent disclosure under conditions and for a time sufficient to produce the antibody, antigen binding fragment, or fusion protein.
Accordingly, the présent disclosure also provides recombinant host cells that heterologously express an antibody, antigen binding fragment, or fusion protein of the présent disclosure. For example, the cell may be of a species that is different to the species from which the antibody was fully or partially obtained (e.g., CHO cells expressing a human antibody or an engineered human antibody). In some embodiments, the cell type of the host cell does not express the antibody or antigen binding fragment in nature. Moreover, the host cell may impart a post-translational modification (PTM; e.g., glysocylation or fucosylation) on the antibody or antigen binding fragment that is not présent in a native State of the antibody or antigen binding fragment (or in a native state of a parent antibody from which the antibody or antigen binding fragment was engineered or derived). Such a PTM may resuit in a functional différence (e.g., reduced immunogenicity). Accordingly, an antibody or antigen binding fragment of the présent disclosure that is produced by a host cell as disclosed herein may include one or more post-translational modification that is distinct from the antibody (or parent antibody) in its native state (e.g., a human antibody produced by a
CHO cell can comprise a more post-translational modification that is distinct from the antibody when isolated from the human and/or produced by the native human B cell or plasma cell,
Optional additional features of the antibodies, antigen binding fragments, or fusion proteins
Antibodies, antigen binding fragments, and fusion proteins of the disclosure may be coupled, for example, to a drug for delivery to a treatment site or coupled to a détectable label to facilitate imaging of a site comprising cells of interest. Methods for coupling antibodies to drugs and détectable labels are well known in the art, as are methods for imaging using détectable labels. Labeled antibodies may be employed in a wide variety of assays, employing a wide variety of labels. Détection of the formation of an antibody-antigen complex between an antibody (or antigen binding fragment or fusion protein) of the disclosure and an epitope of interest on HBsAg, in particular on the antigenic loop région of HBsAg, can be facilitated by attaching a détectable substance to the antibody. Suitable détection means include the use of labels such as radionuclides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent materiai is luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin; and examples of suitable radioactive materiai include 1251, 1311, 35S, or 3H. Such labeled reagents may be used in a variety of well-known assays, such as radioimmunoassays, enzyme immunoassays, e.g., ELISA, fluorescent immunoassays, and the like. Labeled antibodies, antigen binding fragments, and fusion proteins according to the present disclosure may be thus be used in such assays for example as described in US 3,766,162; US 3,791,932; US 3,817,837; and US 4,233,402.
An antibody, antigen binding fragment, or fusion protein according to the présent disclosure may be conjugated to a therapeutic moiety such as a cytotoxin, a therapeutic agent, or a radioactive métal ion or radioisotope. Examples of radioisotopes include, but are not limited to, 1-131, 1-123, 1-125, Y-90, Re-188, Re-186, At-211, Cu-67, Bi212, Bi-213, Pd-109, Tc-99, In-111, and the like. Such antibody conjugales can be used for modifying a given biological response; the drug moiety is not to be construed as limited to classical Chemical therapeutic agents. For example, the drug moiety may be a protein or polypeptide possessing a desired biological activity. Such proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin.
Techniques for conjugating such therapeutic moiety to antibodies are well known. See, for example, Amon et al. (1985) Monoclonal Antibodies for Immunotargeting of Drugs in Cancer Therapy, in Monoclonal Antibodies and Cancer Therapy, ed. Reisfeld et al. (Alan R. Liss, Inc.), pp. 243-256; ed. Hellstrom et al. (1987) Antibodies for Drug Delivery, in Controlled Drug Delivery, ed. Robinson et al. (2d ed; Marcel Dekker, Inc.), pp. 623-653; Thorpe (1985) Antibody Carriers of Cytotoxic Agents in Cancer Therapy: A Review, in Monoclonal Antibodies '84: Biological and Clinical Applications, ed. Pinchera et al. pp. 475-506 (Editrice Kurtis, Milano, Italy, 1985); Analysis, Results, and Future Prospective of the Therapeutic Use of Radiolabeled Antibody in Cancer Therapy, in Monoclonal Antibodies for Cancer Détection and Therapy, ed. Baldwin et al. (Academie Press, New York, 1985), pp. 303-316; and Thorpe et al. (1982) Immunol. Rev. 62:119-158.
Alternatively, an antibody, antibody fragment, or fusion protein, can be conjugated to a second antibody, or antibody fragment thereof, (or second fusion protein) to form a heteroconjugate as described in US 4,676,980. In addition, linkers may be used between the labels and the antibodies of the description, e.g., as described in US 4,831,175. Antibodies, antigen-binding fragments, and fusion proteins may be directly labeled with radioactive iodine, indium, yttrium, or other radioactive particle known in the art, e.g., as described in US 5,595,721. Treatment may consist of a combination of treatment with conjugated and non-conjugated antibodies, antigen binding fragments, and/or fusion proteins, administered simultaneously or subsequently e.g., as described in WO00/52031; WO00/52473.
Antibodies, antigen binding fragments, and fusion proteins as described herein may also be attached to a solid support. Additionally, the antibodies of the présent disclosure, functional antibody fragments thereof, or fusion proteins, can be chemically modifîed by covalent conjugation to a polymer to, for example, increase their circulating halflife. Examples of polymers, and methods to attach them to peptides, are shown in US 4,766,106; US 4,179,337; US 4,495,285 and US 4,609,546. In some embodiments, the polymers may be selected from polyoxyethylated polyols and polyethylene glycol (PEG). PEG is soluble in water at room température and has the general formula: R(OCH2-CH2)nO-R, wherein R can be hydrogen, or a protective group such as an alkyl or alkanol group. In certain embodiments, the protective group may hâve between 1 and 8 carbons. For example, the protective group may be methyl. The symbol n is a positive integer. In one embodiment, n is between 1 and 1,000. In another embodiment n is between 2 and 500. In some embodments, the PEG has an average molecular weight selected from between 1,000 and 40,000, between 2,000 and 20,000, and between 3,000 and 12,000. Furthermore, PEG may hâve at least one hydroxy group, for example the PEG may hâve a terminal hydroxy group. For example, it is the terminal hydroxy group which is activated to react with a free amino group on the inhibitor. However, it will be understood that the type and amount of the reactive groups may be varied to achieve a covalently conjugated PEG/antibody of the présent description.
Water-soluble polyoxyethylated polyols may also be utlized in the context of the antibodies and antigen binding fragements described herein. They include polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG), and the like. In one embodiment, POG is used. Without being bound by any theory, because the glycerol backbone of polyoxyethylated glycerol is the same backbone occurring naturally in, for example, animais and humans in mono-, di-, triglycérides, this branching would not necessarily be seen as a foreign agent in the body. POG may hâve a molecular weight in the same range as PEG. Another drug delivery system that can be used for increasing circulatory half-life is the liposome. Methods of preparing liposome delivery Systems are known to one of skill in the art. Other drug delivery
Systems are known in the art and are described in, for example, referenced in Poznansky et al. (1980) and Poznansky (1984).
Antibodies, antigen binding fragments, and fusion proteins of the disclosure may be provided in purified form. Typically, the antibody, binding fragment, or fusion protein will be présent in a composition that is substantially free of other polypeptides e.g., where less than 90% (by weight), usually less than 60% and more usually less than 50% of the composition is made up of other polypeptides.
Antibodies, fusion proteins, or antigen binding fragments of the disclosure may be immunogenic in non-human (or heterologous) hosts e.g., in mice. In particular, the antibodies, antigen binding fragments, or fusion proteins may hâve an idiotope that is immunogenic in non-human hosts, but not in a human host. In particular, such molécules of the disclosure for human use include those that cannot be easily isolated from hosts such as mice, goats, rabbits, rats, non-primate mammals, etc. and cannot generally be obtained by humanization or from xeno-mice.
Production of antibodies, antigen binding fragments, and fusion proteins
Antibodies, antigen binding fragments, and fusion proteins according to the disclosure can be made by any method known in the art. For example, the general methodology for making monoclonal antibodies using hybridoma technology is well known (Kohler, G. and Milstein, C., 1975; Kozbar et al. 1983). In one embodiment, the alternative EBV immortalization method described in WO2004/076677 is used.
In one embodiment, antibodies are produced using a method described in WO 2004/076677. In such methods, B cells producing the antibody are transformed with EBV and a polyclonal B cell activator. Additional stimulants of cellular growth and différentiation may optionally be added during the transformation step to further enhance the efficiency. These stimulants may be cytokines such as IL-2 and IL-15. In one aspect, IL-2 is added during the immortalization step to further improve the efficiency of immortalization, but its use is not essential. The immortalized B cells produced using these methods can then be cultured using methods known in the art and antibodies isolated therefrom.
Another method for producing antibodies is described in WO 2010/046775. In such a method, plasma cells are cultured in limited numbers, or as single plasma cells in microwell culture plates. Antibodies can be isolated from the plasma cell cultures. Further, from the plasma cell cultures, RNA can be extracted and PCR can be performed using methods known in the art. The VH and VL régions of the antibodies can be amplified by RT-PCR (reverse transcriptase PCR), sequenced and cloned into an expression vector that is then transfected into HEK293T cells or other host cells. The cloning of nucleic acid in expression vectors, the transfection of host cells, the culture of the transfected host cells and the isolation of the produced antibody can be done using any methods known to one of skill in the art.
The antibodies may be further purified, if desired, using filtration, centrifugation and various chromatographie methods such as HPLC or affinity chromatography. Techniques for purification of antibodies, e.g., monoclonal antibodies, including techniques for producing pharmaceutical-grade antibodies, are well known in the art.
Standard techniques of molecular biology may be used to préparé DNA sequences encoding the antibodies, antibody fragments, or fusion proteins of the présent description. Desired DNA sequences may be synthesized completely or in part using oligonucleotide synthesis techniques. Site-directed mutagenesis and polymerase chain reaction (PCR) techniques may be used as appropriate.
Any suitable host cell/vector system may be used for expression of the DNA sequences encoding the antibody or fusion protein molécules of the présent disclosure or fragments thereof. Bacterial, for example E. coli, and other microbial Systems may be used, in part, for expression of antibody fragments such as Fab and F(ab’)2 fragments, and especially Fv fragments and single chain antibody fragments, for example, single chain Fvs. Eukaryotic, e.g., mammalian, host cell expression Systems may be used for production of larger antibody molécules, including complété antibody molécules.
Suitable mammalian host cells include, but are not limited to, those exemplary host cells and cell lines disclosed herein.
The présent disclosure also provides a process for the production of an antibody, antigen binding fragment, or fusion protein molécule according to the présent disclosure comprising culturing a host cell comprising a vector encoding a nucleic acid of the présent disclosure under conditions suitable for expression of protein from DNA encoding the antibody molécule of the présent description, and isolating the antibody molécule.
An antibody molécule or antibody fragment may comprise only a heavy or light chain polypeptide, in which case only a heavy chain or light chain polypeptide coding sequence needs to be used to transfect the host cells. For production of products comprising both heavy and light chains, the cell line may be transfected with two vectors, a first vector encoding a light chain polypeptide and a second vector encoding a heavy chain polypeptide. Alternatively, a single vector may be used, the vector including sequences encoding light chain and heavy chain polypeptides.
Alternatively, antibodies, antigen binding fragments, and fusion proteins according to the disclosure may be produced by (i) expressing a nucleic acid sequence according to the disclosure in a host cell, e.g. by use of a vector according to the présent description, and (ii) isolating the expressed desired product. Additionally, the method may include (iii) purifying the isolated antibody, antigen binding fragment, or fusion protein. Transformed B cells and cultured plasma cells may be screened for those producing antibodies, antigen binding fragments, or fusion proteins of the desired specificity or function.
Screening may be carried out by any immunoassay, e.g., ELISA, by staining of tissues or cells (including transfected cells), by neutralization assay or by one of a number of other methods known in the art for identifying desired specificity or function. The assay may select on the basis of simple récognition of one or more antigens, or may select on the additional basis of a desired function e.g., to select neutralizing antibodies rather than just antigen-binding antibodies, to select antibodies that can change characteristics of targeted cells, such as their signaling cascades, their shape, their growth rate, their capability of influencing other cells, their response to the influence by other cells or by other reagents or by a change in conditions, their différentiation status, or the like.
Individual transformed B cell clones may then be produced from the positive transformed B cell culture. The cloning step for separating individual clones from the mixture of positive cells may be carried out using limiting dilution, micromanipulation, single cell déposition by cell sorting or another method known in the art.
Nucleic acid from the cultured plasma cells can be isolated, cloned and expressed in HEK293T cells or other known host cells using methods known in the art.
The immortalized B cell clones or the transfected host-cells of described herein can be used in various ways e.g., as a source of monoclonal antibodies, as a source of nucleic acid (DNA or mRNA) encoding a monoclonal antibody of interest, for research, etc.
Pharmaceutical Compositions
The présent disclosure also provides a pharmaceutical composition comprising an antibody, antigen binding fragment, or fusion protein, according to the présent disclosure, a nucleic acid according to the présent disclosure, a vector according to the présent disclosure and/or a cell according to the présent disclosure.
Pharmaceutical compositions may also contain a pharmaceutically acceptable carrier, diluent and/or excipient. Although the carrier or excipient may facilitate administration, it should not itself induce the production of antibodies harmful to the individual receiving the composition. Nor should it be toxic. Suitable carriers may be large, slowly metabolized macromolecules such as proteins, polypeptides, liposomes, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino
100 acid copolymers and inactive virus particles. In general, pharmaceutically acceptable carriers in a pharmaceutical composition according to the présent disclosure may be active components or inactive components.
Pharmaceutically acceptable salts can be used, for example minerai acid salts, such as hydrochlorides, hydrobromides, phosphates and sulphates, or salts of organic acids, such as acétates, propionates, malonates and benzoates.
Pharmaceutically acceptable carriers in a pharmaceutical composition may additionally contain liquids such as water, saline, glyceroî and éthanol. Additionally, auxiliary substances, such as wetting or emulsifying agents or pH buffering substances, may be présent in such compositions. Such carriers enable the pharmaceutical compositions to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries and suspensions, for ingestion by the subject.
Pharmaceutical compositions of the disclosure may be prepared in various forms. For example, the compositions may be prepared as injectables, either as liquid solutions or suspensions. Solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared (e.g., a lyophilized composition, similar to Synagis™ and Herceptin™, for reconstitution with stérile water containing a preservative). The composition may be prepared for topical administration e.g., as an ointment, cream or powder. The composition may be prepared for oral administration e.g., as a tablet or capsule, as a spray, or as a syrup (optionally flavored). The composition may be prepared for pulmonary administration e.g., as an inhaler, using a fine powder or a spray. The composition may be prepared as a suppository or pessary. The composition may be prepared for nasal, aurai or ocular administration e.g., as drops. The composition may be in kit form, designed such that a combined composition is reconstituted just prior to administration to a subject. For example, a lyophilized antibody may be provided in kit form with stérile water or a stérile buffer.
In particular embodiments, the active ingrédient in a composition according to the présent disclosure is an antibody molécule, an antibody fragment or variant or
101 dérivative thereof, in particular the active ingrédient in the composition is an antibody, an antibody fragment, a fusion protein, or variants and dérivatives thereof, as described herein. As such, it may be susceptible to dégradation in the gastrointestinal tract. Thus, if the composition is to be administered by a route using the gastrointestinal tract, the composition may contain agents which protect the antibody from dégradation but which release the antibody once it has been absorbed from the gastrointestinal tract.
A thorough discussion of pharmaceutically acceptable carriers is available in Gennaro (2000) Remington: The Science and Practice of Pharmacy, 20th édition, ISBN: 0683306472.
Pharmaceutical compositions of the disclosure may hâve a pH between 5.5 and 8.5, and in some embodiments this may be between 6 and 8. In other embodiments, the pH of a pharmaceutical composition as described herein may be about 7. The pH may be maintained by the use of a buffer. The composition may be stérile and/or pyrogen free. The composition may be isotonie with respect to humans. In certain embodiments, pharmaceutical compositions of the disclosure are supplied in hermetically sealed containers.
Within the scope of the disclosure are compositions présent in several forms of administration; the forms include, but are not limited to, those forms suitable for parentéral administration, e.g., by injection or infusion, for example by bolus injection or continuous infusion. Where the product is for injection or infusion, it may take the form of a suspension, solution or émulsion in an oily or aqueous vehicle and it may contain formulatory agents, such as suspending, preservative, stabilizing and/or dispersing agents. Alternatively, the antibody molécule may be in dry form, for reconstitution before use with an appropriate stérile liquid. A vehicle is typically understood to be a material that is suitable for storing, transporting, and/or administering a compound, such as a pharmaceutically active compound, in particular the antibodies according to the présent description. For example, the vehicle may be a physiologically acceptable liquid, which is suitable for storing, transporting, and/or administering a pharmaceutically active compound, in particular the antibodies
102 according to the present description. Once formulated, the compositions of the present disclosure can be administered directly to the subject. In one embodiment the compositions are adapted for administration to mammalian, e.g., human subjects.
The pharmaceutical compositions described herein may be administered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intra-arterial, intramedullary, intraperitoneal, intrathecal, intraventricular, transdermal, transcutaneous, topical, subcutaneous, intranasal, enterai, sublingual, intravaginal or rectal routes. Hyposprays may also be used to administer the pharmaceutical compositions of the description. In spécifie embodiments, the pharmaceutical composition may be prepared for oral administration, e.g. as tablets, capsules and the like, for topical administration, or as injectable, e.g. as liquid solutions or suspensions. Solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be utilized, e.g. that the pharmaceutical composition is in lyophilized form.
For injection, e.g. intravenous, cutaneous or subcutaneous injection, or injection at the site of affliction, the active ingrédient can be provided be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Preservatives, stabilizers, buffers, antioxidants and/or other additives may be included, as required.
Whether it is a polypeptide, peptide, or nucleic acid molécule, cell, or other pharmaceutically useful compound according to the present disclosure that is to be given to an individual, administration is generally in a prophylactically effective amount or a therapeutically effective amount or an effective amount (as the case may be), this being suffîcient to show a benefit to the individual (e.g., improved clinical outcome; lessening or alleviation of symptoms associated with a disease; decreased occurrence of symptoms; improved quality of life; longer disease-free status; diminishment of extent of disease, stabilization of disease state; delay of disease progression; remission; survival; or prolonged survival in a statistically significant manner). The actual amount administered, and rate and time-course of administration, will dépend on the nature and severity of what is being treated. For injection, the
103 pharmaceutical composition according to the présent disclosure may be provided for example in a pre-filled syringe.
Pharmaceutical compositions as disclosed herein may also be administered orally in any 5 orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions. In the case of tablets for oral use, carriers commonly used include lactose and corn starch. Lubricating agents, such as magnésium stéarate, are also typically added. For oral administration in a capsule form, useful diluents include lactose and dried comstarch. When aqueous suspensions are required for oral use, the 10 active ingrédient, i.e. the inventive transporter cargo conjugate molécule as defined above, is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
The pharmaceutical compositions according to the présent description may also be 15 administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, e.g., including diseases of the skin or of any other accessible épithélial tissue. Suitable topical formulations are readily prepared for each of these areas or organs. For topical applications, the pharmaceutical composition may be formulated in a suitable ointment, containing the inventive pharmaceutical 20 composition, particularly its components as defined above, suspended or dissolved in one or more carriers. Carriers for topical administration include, but are not limited to, minerai oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water. Altematively, the pharmaceutical composition can be formulated in a suitable lotion or cream. In the 25 context of the présent description, suitable carriers include, but are not limited to, minerai oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2octyldodecanol, benzyl alcohol and water.
Doses may be expressed in relation to the bodyweight. Thus, a dose which is expressed 30 as [g, mg, or other unit]/kg (or g, mg etc.) usually refers to [g, mg, or other unit] per kg (or g, mg etc.) bodyweight, even if the term bodyweight is not explicitly mentioned.
104
In spécifie embodiments, in a single dose, e.g. a daily, weekly or monthly dose, the amount of the antibody, or the antigen binding fragment thereof, in the pharmaceutical compositiondoes not exceed 1 g. In certain such embodiments, the single dose does not exceed a dose selected from 500 mg, 250 mg, 100 mg, and 50 mg.
In some embodiments, a composition or kit as described herein further comprises (i) a polymerase inhibitor, wherein the polymerase inhibitor optionally comprises Lamivudine, Adefovir, Entecavir, Telbivudine, Tenofovir, or any combination thereof; (ii) an interferon, wherein the interferon optionally comprises IFNbeta and/or IFNalpha; (iii) a checkpoint inhibitor, wherein the checkpoint inhibitor optionally comprises an anti-PD-1 antibody or antigen binding fragment thereof, an anti-PD-Ll antibody or antigen binding fragment thereof, and/or an anti-CTLA4 antibody or antigen binding fragment thereof; (iv) an agonist of a stimulatory immune checkpoint molécule; or (v) any combination of (i)-(iv). In some embodiments, a kit comprises a composition or combination as described herein, and further comprises instructions for using the component to prevent, treat, attenuate, and/or diagnose a hepatitis B infection and/or a hepatitis D infection.
In certain embodiments, a composition of the présent disclosure (e.g., antibody, antigen-binding fragment, host cell, nucleic acid, vector, or pharmaceutical composition) is used in combination with a PD-1 inhibitor, for example a PD-1-spécifie antibody or binding fragment thereof, such as pidilizumab, nivolumab, pembrolizumab, MEDI0680 (formerly AMP-514), AMP-224, BMS-936558 or any combination thereof.
In certain embodiments, a composition of the présent disclosure is used in combination with a PD-L1 spécifie antibody or binding fragment thereof, such as BMS-936559, durvalumab (MEDI4736), atezolizumab (RG7446), avelumab (MSB0010718C), MPDL3280A, or any combination thereof.
In certain embodiments, an a composition of the présent disclosure is used in combination with a LAG3 inhibitor, such as LAG525, IMP321, IMP701, 9H12, BMS986016, or any combination thereof.
105
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of CTLA4. In particular embodiments, an a composition of the présent disclosure is used in combination with a CTLA4 specific antibody or binding fragment thereof, such as ipilimumab, tremelimumab, CTLA4-Ig fusion proteins (e.g., abatacept, belatacept), or any combination thereof.
In certain embodiments, a composition of the présent disclosure is used in combination with a B7-H3 specific antibody or binding fragment thereof, such as enoblituzumab (MGA271), 376.96, or both. A B7-H3 antibody binding fragment may be a scFv or fusion protein thereof, as described in, for example, Dangaj et al., Cancer Res. 73:4820, 2013, as well as those described in U.S. Patent No. 9,574,000 and PCT Patent Publication Nos. WO /201640724A1 and WO 2013/025779A1.
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of CD244.
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of BLTA, HVEM, CD 160, or any combination thereof. Anti CD-160 antibodies are described in, for example, PCT Publication No. WO 2010/084158.
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of TIM3.
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of Gal9.
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of adenosine signaling, such as a decoy adenosine receptor.
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of A2aR.
106
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of KIR, such as lirilumab (BMS-986015).
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of an inhibitory cytokine (typically, a cytokine other than TGFp) or Treg development or activity.
In certain embodiments, a composition ofthe présent disclosure is used in combination 10 with an IDO inhibitor, such as levo-l-methyl tryptophan, epacadostat (INCB024360;
Liu et al., Blood 115:3520-30, 2010), ebselen (Terentis et al., Biochem. 49:591-600, 2010), indoximod, NLG919 (Mautino et al., American Association for Cancer Research 104th Annual Meeting 2013; Apr 6-10, 2013), 1-methyl-tryptophan (l-MT)-tirapazamine, or any combination thereof.
In certain embodiments, a composition of the présent disclosure is used in combination with an arginase inhibitor, such as N(omega)-Nitro-L-arginine methyl ester (L-NAME), N-omega-hydroxy-nor-l-arginine (nor-NOHA), L-NOHA, 2(S)-amino-6boronohexanoic acid (ABH), S-(2-boronoethyl)-L-cysteine (BEC), or any combination 20 thereof.
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of VISTA, such as CA-170 (Curis, Lexington, Mass.).
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of TIGIT such as, for example, COM902 (Compugen, Toronto, Ontario Canada), an inhibitor of CD155, such as, for example, COM701 (Compugen), or both.
In certain embodiments, a composition of the présent disclosure is used in combination with an inhibitor of PVRIG, PVRL2, or both. Anti-PVRIG antibodies are described in,
107 for example, PCT Publication No. WO 2016/134333. Anti-PVRL2 antibodies are described in, for example, PCT Publication No. WO 2017/021526.
In certain embodiments, a composition of the présent disclosure is used in combination with a LAIR1 inhibitor.
In certain embodiments a composition of the présent disclosure is used in combination with an inhibitor of CEACAM-1, CEACAM-3, CEACAM-5, or any combination thereof.
In certain embodiments, a composition of the présent disclosure is used in combination with an agent that increases the activity (i.e., is an agonist) of a stimulatory immune checkpoint molécule. For example, a composition of the présent disclosure can be used in combination with a CD 137 (4-IBB) agonist (such as, for example, urelumab), a CD134 (OX-40) agonist (such as, for example, MEDI6469, MEDI6383, or MEDI0562), lenalidomide, pomalidomide, a CD27 agonist (such as, for example, CDX-1127), a CD28 agonist (such as, for example, TGN1412, CD80, or CD86), a CD40 agonist (such as, for example, CP-870,893, rhuCD40L, or SGN-40), a CD122 agonist (such as, for example, IL-2) an agonist of GITR (such as, for example, humanized monoclonal antibodies described in PCT Patent Publication No.
WO 2016/054638), an agonist of ICOS (CD278) (such as, for example, GSK3359609, mAb 88.2, JTX-2011, Icos 145-1, Icos 314-8, or any combination thereof). In any of the embodiments disclosed herein, a method may comprise administering a composition of the présent disclosure with one or more agonist of a stimulatory immune checkpoint molécule, including any of the foregoing, singly or in any combination.
An antibody, antigen binding fragment, or fusion protein according to the présent disclosure can be présent either in the same pharmaceutical composition as the additional active component or, the antibody, antigen binding fragment, or fusion protein according to the présent disclosure may be included in a first pharmaceutical composition and the additional active component may be included in a second pharmaceutical composition different from the first pharmaceutical composition.
108
Uses
In a further aspect, the présent disclosure provides methods for the use of an antibody, an antigen binding fragment, a fusion protein, a nucleic acid, a vector, a cell or a pharmaceutical composition, or kit according to the présent disclosure in the (i) prophylaxis, treatment or atténuation of hepatitis B and/or hepatitis D; or in (ii) diagnosis of hepatitis B and/or hepatitis D (e.g., in a human subject).
Methods of diagnosis (e.g., in vitro, ex vivo) may include contacting an antibody, antibody fragment (e.g., antigen binding fragment), or fusion protein with a sample. Such samples may be isolated from a subject, for example an isolated tissue sample taken from, for example, nasal passages, sinus cavities, salivary glands, lung, liver, pancréas, kidney, ear, eye, placenta, alimentary tract, heart, ovaries, pituitary, adrenals, thyroid, brain, skin or blood. The methods of diagnosis may also include the détection of an antigen/antibody or antigen/fusion protein complex, in particular following the contacting of an antibody, antibody fragment, or fusion protein with a sample. Such a détection step is typically performed at the bench, i.e. without any contact to the human or animal body. Examples of détection methods are well-known to the person skilled in the art and include, e.g., ELISA (enzyme-linked immunosorbent assay).
The disclosure also provides the use of (i) an antibody, an antibody fragment, fusion protein, or variants and dérivatives thereof according to the disclosure, (ii) host cell (which can be an immortalized B cell) according to the disclosure, (iii) a nucleic acid or a vector according to the présent disclosure or (iv) a pharmaceutical composition of the disclosure in (a) the manufacture of a médicament for the prévention, treatment or atténuation of hepatitis B and/or hepatitis D or for (b) diagnosis of hepatitis B and/or hepatitis D.
The disclosure also provides an antibody, antigen binding fragment, or fusion protein according to the présent disclosure, a nucleic acid according to the présent disclosure, a vector according to the présent disclosure, a cell according to the présent disclosure or
109 the pharmaceutical composition according to the présent disclosure for use as a médicament for the prévention or treatment of hepatitis B and/or hepatitis D. It also provides the use of an antibody, antigen binding fragment, or fusion protein of the disclosure in the manufacture of a médicament for treatment of a subject and/or diagnosis in a subject. It also provides a method for treating a subject (e.g., a human subject), comprising administering to the subject an effective amount of a composition as described herein. In some embodiments, the subject may be a human. One way of checking efficacy of therapeutic treatment involves monitoring disease symptoms after administration of the composition. Treatment can be a single dose schedule or a multiple dose schedule.
In one embodiment, an antibody, antibody fragment, fusion protein, host cell (e.g., immortalized B cell clone, or T cell, NK-T cell, or NK cell that expresses a fusion protein), or pharmaceutical composition according to the disclosure is administered to a subject in need of such treatment. Such a subject includes, but is not limited to, one who is particularly at risk of or susceptible to hepatitis B and/or hepatitis D.
Antibodies, antigen binding fragments, fusion proteins, polynucleotides, vectors, host cells, pharmaceutical compositions, and combinations of the same, according to the présent disclosure may also be used in a kit for the prévention, treatment, atténuation, and/or diagnosis of hepatitis B and/or hepatitis D. In some embodiments, a kit further comprises instructions for using the component to prevent, treat, attenuate, and/or diagnose a hepatitis B infection and/or a hepatitis D infection. Further, the epitope in the antigenic loop région of HBsAg, which is capable of binding an antibody, antigen binding fragment, or fusion protein of the disclosure as described herein may be used in a kit for monitoring the efficacy of application procedures by detecting the presence or determining the titer of protective anti-HBV antibodies.
In certain embodiments, a composition or a kit of this disclosure further comprises: a polymerase inhibitor, wherein the polymerase inhibitor optionally comprises Lamivudine, Adefovir, Entecavir, Telbivudine, Tenofovir, or any combination thereof; (ii) an interferon, wherein the interferon optionally comprises IFNbeta and/or IFNalpha;
110 (iii) a checkpoint inhibitor, wherein the checkpoint inhibitor optionally comprises an anti-PD-1 antibody or antigen binding fragment thereof, an anti-PD-Ll antibody or antigen binding fragment thereof, and/or an anti-CTLA4 antibody or antigen binding fragment thereof; (iv) an agonist of a stimulatory immune checkpoint molécule; or (v) any combination of (viii)-(xii).
In some embodiments, an antibody, an antigen binding fragment, or fusion protein according to the présent disclosure, a nucleic acid according to the présent disclosure, the vector according to the présent disclosure, the cell according to the présent disclosure or the pharmaceutical composition according to the présent disclosure is used in treatment or atténuation of chronic hepatitis B infection.
In particular embodiments, an antibody, antigen binding fragment, or fusion protein according to the présent disclosure (i) neutralizes HBV infection, (ii) binds to L-HBsAg (the large HBV envelope protein, which is présent in infectious HBV particles), thereby preventing spreading of HBV, (iii) binds to S-HBsAg, thereby promoting clearance of subviral particles (SVP) and/or (iv) can induce séroconversion, i.e. an active immune response to the virus.
In particular embodiments, antibody, antigen binding fragment, or fusion protein according to the présent disclosure, a nucleic acid according to the présent disclosure, a vector according to the présent disclosure, a cell according to the présent disclosure, or a pharmaceutical composition according to the présent disclosure, may be used in prévention of hepatitis B (re-)infection after liver transplantation in particular for hepatitis B induced liver failure.
In further embodiments an antibody, antigen binding fragment thereof, or fusion protein according to the présent disclosure, a nucleic acid according to the présent disclosure, a vector according to the description provided herein, a cell according to the présent disclosure, or a pharmaceutical composition according to the présent disclosure, may be used in prevention/prophylaxis of hepatitis B in non-immunized subjects. This is for example in case of (an assumed) accidentai exposure to HBV (post-exposure
111 prophylaxis). The term non-immunized subjects includes subjects, who never received a vaccination and are, thus, not immunized, and subjects, who did not show an immune response (e.g., no measurable anti-hepatitis B antibodies) after vaccination.
In some embodiments, an antibody, antigen binding fragment, or fusion protein according to the présent disclosure, the nucleic acid according to the présent disclosure, a vector according to the présent disclosure, a cell according to the présent disclosure, or a pharmaceutical composition according to the présent disclosure, is used in prophylaxis of hepatitis B in haemodialysed patients.
In some embodiments, an antibody, an antigen binding fragment, or fusion protein according to the présent disclosure, a nucleic acid according to the présent disclosure, a vector according to the présent disclosure, a cell according to the présent disclosure or a pharmaceutical composition according to the présent disclosure is used in prévention of hepatitis B in a newbom. In such embodiments, an antibody, or an antigen binding fragment thereof, according to the présent disclosure, a nucleic acid according to the présent disclosure, a vector according to the présent disclosure, a cell according to the présent disclosure or a pharmaceutical composition according to the présent disclosure may be administered at birth or as soon as possible after birth. The administration may be repeated until séroconversion following vaccination.
Moreover, the présent disclosure also provides the use of an antibody, antigen binding fragment, or fusion protein according to the présent disclosure, a nucleic acid according to the présent disclosure, a vector according to the présent disclosure, a cell according to the présent disclosure or a pharmaceutical composition according to the présent disclosure in the diagnosis (e.g. in vitro, ex vivo, or in vivo) of hepatitis B and/or hepatitis D.
In addition, the use of an antibody, antigen binding fragment, or fusion protein according to the présent disclosure, a nucleic acid according to the présent disclosure, a vector according to the présent disclosure, a cell according to the présent disclosure or a pharmaceutical composition according to the présent disclosure in determining whether
112 an isolated blood sample is infected with hepatitis B virus and/or hepatitis delta virus is provided.
As described above, methods of diagnosis may include contacting an antibody, antibody fragment, or fusion protein with a sample. Such samples may be isolated from a subject, for example an isolated tissue sample taken from, for example, nasal passages, sinus cavities, salivary glands, lung, liver, pancréas, kidney, ear, eye, placenta, alimentary tract, heart, ovaries, pituitary, adrenals, thyroid, brain, skin or blood. The methods of diagnosis may also include the détection of an antigen/antibody complex, in particular following the contacting of an antibody or an antibody fragment with a sample. Such a détection step is typically performed at the bench, i.e. without any contact to the human or animal body. Examples of détection methods are wellknown to the person skilled in the art and include, e.g., ELISA (enzyme-linked immunosorbent assay).
The présent disclosure also provides a method of treating, preventing and/or attenuating hepatitis B and/or hepatitis D in a subject, wherein the method comprises administering to the subject an antibody, antigen binding fragment, or fusion protein according to the présent disclosure, a nucleic acid according to the présent disclosure, a vector according to the présent disclosure, a cell according to the présent disclosure or a pharmaceutical composition according to the présent disclosure. In certain embodiments, a method further comprises administering to the subject one or more of: (vii) a polymerase inhibitor, wherein the polymerase inhibitor optionally comprises Lamivudine, Adefovir, Entecavir, Telbivudine, Tenofovir, or any combination thereof; (viii) an interferon, wherein the interferon optionally comprises IFNbeta and/or IFNalpha; (ix) a checkpoint inhibitor, wherein the checkpoint inhibitor optionally comprises an anti-PD-1 antibody or antigen binding fragment thereof, an anti-PD-Ll antibody or antigen binding fragment thereof, and/or an anti-CTLA4 antibody or antigen binding fragment thereof; (x) an agonist of a stimulatory immune checkpoint molécule; or (xi) any combination of (vii)-(x).
113
In some embodiments, the hepatitis B infection is a chronic hepatitis B infection. In some embodiments, the subject has received a liver transplant. In some embodiments, the subject is non-immunized against hepatitis B. In certain embodiments, the subject is a newbom. In some embodiments, the subject is undergoing or has undergone hemodialysis.
The présent disclosure also provides a method of treating a subject who has received a liver transplant comprising administering to the subject who has received the liver transplant an effective amount of an antibody, an antigen binding fragment, or fusion protein according to the présent disclosure, a nucleic acid according to the présent disclosure, a vector according to the présent disclosure, a cell according to the présent disclosure or a pharmaceutical composition according to the présent disclosure.
Also provided herein are methods for detecting the presence or absence of an epitope in a correct conformation in an anti-hepatitis-B and/or an anti-hepatitis-D vaccine, wherein the methods comprise: (i) contacting the vaccine with an antibody, antigenbinding fragment, or fusion protein of any one of the présent disclosure; and (ii) determining whether a complex comprising an antigen and the antibody, or comprising an antigen and the antigen binding fragment, or comprising an antigen and the fusion protein, has been formed.
The term vaccine as used herein is typically understood to be a prophylactic or therapeutic material providing at least one antigen, such as an immunogen. The antigen or immunogen may be derived from any material that is suitable for vaccination. For example, the antigen or immunogen may be derived from a pathogen, such as from bacteria particies, virus particies, a tumor (including a solid or liquid tumor), or other cancerous tissue. The antigen or immunogen stimulâtes the body’s adaptive immune system to provide an adaptive immune response. In certain embodiments, an antigen or an immunogen refers to a substance which may be recognized by the immune system, e.g. by the adaptive immune system, and which is capable of triggering an antigen-specific immune response, e.g. by formation of antibodies and/or antigenspecific T cells as part of an adaptive immune response. In some embodiments, an
114 antigen may be or may comprise a peptide or protein which may be presented by an
MHC complex (e.g., MHC class I; MHC class II) to T cells. In certain embodiments, the antigen comprises a HBV and/or HBD antigen; e.g., an HBsAg antigen.
In some instances, éléments of the of the antibodies, antibody fragments, fusion proteins, nucleic acids, cells, compositions, uses, and methods provided herein are described or listed with reference to embodiments or examples. However, it should be understood that the examples and embodiments described herein may be combined in various ways to create additional embodiments.
EXAMPLES
In the following, particular examples illustrating various embodiments and aspects of the disclosure are presented. However, the present disclosure shall not to be limited in scope by the spécifie embodiments described herein.
Example 1: Génération and Testing of Engineered Antibodies
Analysis of some HBC34 antibody variants from PCT Publication No. WO 2017/060504 revealed a cysteine amino acid at position 40 (IMGT numbering) in the light chain variable région that is unpaired and represents a potential liability. Without wishing to be bound by theory, unpaired cysteine residues are potentially reactive and can potentially trigger aggregation through intramolecular scrambling or intermolecular disulfide formation. Variants of HBC34-V7 (WO 2017/060504) were engineered in which the cysteine amino acid at position 40 ofthe light chain variable région was substituted with a serine (thereby generating HBC34-V34) or with an alanine (thereby generating HBC34-V35). The nucléotide sequences encoding these additional variant antibodies were codon-optimized, and antibodies were expressed as IgGl (glml7, 1 allotype) in ExpiCHO™ cells (ThermoFisher). Codon-optimized nucléotide sequences encoding the VH and VL domains of HBC34-V35 are provided in SEQ ID NOS: 103 and 104, respectively.
115
The ability of HBC34-V34 and HBC34-V35 to bind antigen was investigated using a direct antigen-binding ELISA. HBC34-V7 was used as a comparator. As shown in
Figure 1, both HBC34-V34 and HBC34-V35 bound effectively to two recombinant
HBsAg antigens (adw, top panel; adr, bottom panel), and HBC34-V35 had very similar binding as the parent HBC34-V7.
The variant antibodies were examined for binding to ail known HBsAg génotypes ((A)(J)). Briefly, human épithélial cells (Hep2 cells) were transfected with plasmids expressing the HBsAg of each ofthe 10 HBV génotypes A, B, C, D, E, F, G, H, I, and
J. Ail antibodies were tested at multiple concentrations for staining of transiently transfected permeabilized cells. Two days after transfection, Hep2 cells were collected, fixed and permeabilized with saponin for immunostaining with HBC34 and the five selected variants. HBC34-V7 was included as a comparator. Binding of antibodies to transfected cells was analysed using a Becton Dickinson FACSCanto2™ (BD
Biosciences) with FlowJo software (TreeStar). As shown in Figures 2A-2J, HBC34V34 and HBC34-V35 recognized ail 10 HBV HBsAg génotypes. HBC34-V35 showed somewhat stronger staining than HBC34-V34.
These data show that the antibody variants HBC34-V34 and HBC34-V35 broadly recognize and bind to HBsAG at levels comparable to HBC34-V7.
Example 2: Anti-HBsAg Antibodies with Modified Fc Régions Efficiently Bind to Antigen
Modifications in the Fc région may provide advantages to a therapeutic antibody. HBC34-V35 was expressed as IgGl with wild-type Fc, or with Fc containing a MLNS mutation (M428L/N434S) or with Fc containing MLNS in combination with a GAALIE mutation (G239A/A330L/I332E). Each construct was tested for binding to recombinant HBsAg (adw) in two separate antigen-binding ELISA experiments. Three (3) lots of HBC34-v35 (wild-type Fc) were tested. Two (2) lots of HBC34-V35-MLNS and two (2) lots of HBC34-V35-MLNS- GAALIE were tested. HBC34v7 (one lot) was tested as a comparator.
116
As shown in Figures 3A and 3B, the introduced Fc mutations did not affect antigenbinding activity of HBC34-V35. ECso values varied somewhat between the various constructs and the two experiments, and were generally low.
Binding of HBC34-V35 with MLNS or MLNS and GAALIE mutations to EXPI293 cells expressing HBsAg génotypes (A)-(J) or HBsAg variants was assessed. HBC34V35 with wild-type IgGl Fc was used as a comparator. Data showing binding to HBsAg génotypes are shown in Figures 3C-3H. Data showing binding to HBsAg variants are shown in Figures 3I-3R.
Example 3: In Vitro Neutralization Activity of Antibodies
The neutralizing capacity of HBC34, HBC34-V35, HBC34-V35-MLNS, and HBC34V35-MLNS-GAALIE was compared by measuring the levels of HBsAg (A) and HBeAg (B) in the cell culture supernatant of HBV infected HepG2 cells expressing NTCP. Data are shown in Figures 3S-3V, and represent the means ± SD from one of two independent experiments.
Example 4: Pan-Genotype Neutralization Capacity of HBC34-V35 MLNSGAALIE Assessed in an HDV Pseudosystem
To confirm the breadth of neutralization of HBC34-V35-MLNS-GAALIE against HBV virus, neutralization assays were conducted with HBC34-V35-MLNS-GAALIE against eight prévalent human HBV génotypes. An in vitro system that takes advantage of hepatitis D virus (HDV) engineered to express HBV HBsAg representing different génotypes was employed. Briefly, as both HBV and HDV share the same envelope proteins, their viral entry pathway via heparan sulfate proteoglycans and NTCP is identical, and HDV can be used as a model system to study HBsAg-mediated viral entry (Tu 2018; Lempp 2016). Further, HDV can be enveloped/pseudotyped with HBsAg of different HBV génotypes and subsequently be used in infection studies (Freitas 2014).
117
HBC34-V35-MLNS-GAALIE showed neutralizing capacity for ail tested génotypes with similar EC50 values, ranging from 0.92 ng/mL (génotype C) to 2.34 ng/mL (génotype A). These results show that HBC34-V35-MLNS-GAALIE is able to neutralize infectious virus carrying HBsAg from ail eight HBV génotypes tested, supporting in vivo pan-genotypic neutralization activity of HBC34-V35-MLNSGAALIE (Figure 4).
Example 5: Clearance of HB Antigens and Viral Entry Inhibition in an In Vivo Model
An immune-deficient mouse having transplanted human hépatocytes was used to test the effectiveness of anti-HBV antibodies of the présent disclosure in clearing HBsAg. Briefly, primary human hépatocytes were transplanted into SCID mice for which mouse hépatocytes had previously been destroyed enzymatically. The mice were T- and B-cell déficient. This model is useful for studying HBV infection including entry, spreading, cccDNA régulation, hepatocyte-intrinsic immune responses, and viral intégration into host genome.
Mice were inoculated via tail vein injection with HBV, génotype C, at 1.0X107 viral genomes per mouse at Day -28. Treatments at Day 0 following initial measurement of HBV. HBV-infected mice (n=4 per treatment group) were administered PBS (control) or HBC34-V35 (1, 5, or 15 mg/kg i.p., 2x/week). Antibodies were murinized with the exception of the antigen-binding Fab régions.
Plasma and sérum samples were collected periodically throughout the study, and viral loads, HBV DNA (by PCR), and HB Ag (HBsAg, HBeAg, HBcrAg) were measured. Mice were sacrificed at week 6.
As shown in Figures 5-8, treatment with the highest tested dose of HBC34-V35 reduced viral load and viral entry into hépatocytes.
118
Example 6: In Vitro Effector Function Studies
In vitro studies were performed to examine the ability of HBC34 antibodies with modified Fc to: (1) bind to human FcRs and to complément; (2) activate FcyRIIa, 5 FcyRIIb, and FcyRIIIa; and (3) promote ADCC and activate human Natural Killer (NK) cells. Test articles, cell lines, and reagents used were as described in Tables 5-7, below.
The following abbreviations are used in this Example: GLP = Good Laboratory Practice; ADCC = Antibody-dependent cellular cytotoxicity; ADCP =Antibodydependent cellular phagocytosis; Fc = Fragment crystallizable; HBsAg = Hepatitis B 10 surface Antigen; mAb = Monoclonal antibody; PBS = Phosphate-buffered saline;
UHPL-SEC = Ultra-high performance liquid size-exclusion chromatography; ATCC = American Type Culture Collection; FcyRs = Fc gamma receptor(s); CHO cells = Chinese hamster ovary cells; RLU = Relative luminescence units; BLI = Bio-layer interferometry.
Table 5. Test Articles.
Test Article | HBC34-V35-MLNS |
• Isotype | • IgGlL |
• Relative molecular weight | • -150 kDa |
• Concentration | • 3.47 mg/ml |
• Source | • In-house |
• Handling and storage conditions | • 4°C short term, -80°C long term storage |
• Formulation buffer | • PBS, pH 7.2 |
Test Article | HBC34-V35-MLNS-GAALIE |
• Isotype | • IgGlL |
• Relative molecular weight | • -150 kDa |
• Concentration | • 2.1 mg/ml / 0.86 mg/ml |
119
• Source | • In-house |
• Handling and storage conditions | • 4°C short term, -80°C long term storage |
• Formulation buffer | • PBS, pH 7.2 |
Test Article | HBC34-V35-LALA |
• Isotype | • IgGlÀ |
• Relative molecular weight | • ~150 kDa |
• Concentration | • 1.2 mg/ml |
• Source | • In-house |
• Handling and storage conditions | • 4°C short term, -80°C long term storage |
• Formulation buffer | • PBS, pH 7.2 |
Test Article | mAb 17.1.41 |
• Isotype | • IgGlK |
• Relative molecular weight | • —150 kDa |
• Concentration | • 4.4 mg/ml |
• Source | • In-house |
• Handling and storage conditions | • 4°C short term, -80°C long term storage |
• Formulation buffer | • PBS, pH 7.2 |
Table 6. Cell Lines
Cell Line | PLC/PRF/5 |
• Catalogue number | • #4325-FC-050 |
• Concentration | • 100 pg/ml |
• Source | • R&D Systems, mouse myeloma cell line, NSO-derived, with a |
120
C-terminal 6-His tag | |
• Stability | • Stable at -20 to 80°C |
• Handling and storage conditions | • Store at -80°C until use, 1 month, 2 to 8°C under stérile conditions after reconstitution |
• Formulation buffer | • PBS |
Cell Line | Jurkat-FcyRIIIA (F158) |
• Tissue origin | • Immortalized line of human T lymphocyte cells; Jurkat cells stably expressing the FcyRIIIa receptor, F158 (low affmity) variant, and an NFAT response element driving expression of firefly luciferase as effector cells |
• Source | • Promega (Cat. Nr.: G9798) |
• Assay media | • RPMI1640 supplemented with 4% low IgG sérum |
Cell line | Jurkat-FcyRIIIA (V158) |
• Tissue origin | • Immortalized line of human T lymphocyte cells; Jurkat cells stably expressing the FcyRIIIa receptor, V158 (high affmity) variant, and an NFAT response element driving expression of firefly luciferase as effector cells |
• Source | • Promega (Cat. Nr.: G7018) |
• Assay media | • RPMI 1640 supplemented with 4% low IgG sérum |
Cell line | Jurkat-FcyRIIA (H131) |
• Tissue origin | • Immortalized line of human T lymphocyte cells; Jurkat cells stably expressing the FcyRIIa receptor, H131 (high affmity) variant, and an NFAT response ________element driving expression of |
121
firefly luciferase as effector cells | |
• Source | • Promega (Cat. Nr.: G9995) |
• Assay media | • RPMI1640 supplemented with 4% low IgG fêtai bovine sérum |
Cell line | Jurkat-FcyRIIB |
• Tissue origin | • Immortalized line of human T lymphocyte cells; Jurkat cells stably expressing the FcyRIIb receptor, and an NFAT response element driving expression of firefly luciferase as effector cells |
• Source | • Promega (Cat. Nr.: CS1781E02) |
• Assay media | • RPMI1640 supplemented with 4% low IgG fêtai bovine sérum |
Cell line | Freshly isolated human NK cells |
• Tissue origin | • Whole blood (EDTA) from donor HMWB019 (genotyped for FcgRIIIa F/V), purified with MACSxpress® NK Isolation Kit from Miltenyi Biotec (#130098-185) |
• Source | • In-house |
• Assay media | • AIM-V |
• Growth media | • RPMI1640 supplemented with 10% low IgG fêtai bovine sérum, Glutamax |
• Growth conditions | • 37°C, 5% CO2 |
Cell line | Freshly isolated human NK cells |
• Tissue origin | • Whole blood (EDTA) from donor HM WB002 (genotyped for FcgRIIIa V/V), purified with MACSxpress® NK Isolation Kit from Miltenyi Biotec (#130- |
122
098-185) | |
• Source | • In-house |
• Assay media | • AIM-V |
• Growth media | • RPMI 1640 supplemented with 10% low IgG fêtai bovine sérum, Glutamax |
• Growth conditions | • 37°C, 5% CO2 |
Cell line | Freshly isolated human NK cells |
• Tissue origin | • Whole blood (EDTA) from donor HM WB018 (genotyped for FcgRIIIa F/F), purified with MACSxpress® NK Isolation Kit from Miltenyi Biotec (#130098-185) |
• Source | • In-house |
• Assay media | • AIM-V |
• Growth media | • RPMI1640 supplemented with 10% low IgG fêtai bovine sérum, Glutamax |
• Growth conditions | • 37°C, 5% CO2 |
Table 7. Other Reagents
Reagent | Recombinant human FcyRIIIa (V158) |
• Catalogue number | • #4325-FC-050 |
• Concentration | • 100 pg/ml |
• Source | • R&D Systems, mouse myeloma cell line, NSO-derived, with a C-terminal 6-His tag |
• Stability | • Stable at -20 to 80°C |
123
• Handling and storage conditions | • Store at -80°C until use, 1 month, 2 to 8°C under stérile conditions after reconstitution |
• Formulation buffer | • PBS |
Reagent | Recombinant human FcyRIIIa (F158) |
• Catalogue number | • 10389-H08H |
• Concentration | • 200 gg/ml (when reconstituted) |
• Source | • Sino Biological, HEK293-derived, with a C-terminal 6-His tag |
• Stability | • Stable at -20 to 80°C |
• Handling and storage conditions | • Store at -80°C until use |
• Formulation buffer | • PBS |
Reagent | Recombinant human FcyRIIa (H131) |
• Catalogue number | • 10374-H08C1 |
• Concentration | • 200 gg/ml (when reconstituted) |
• Source | • Sino Biological, CHO-derived, with a C-terminal 6-His tag |
• Stability | • Stable at -20 to 80°C |
• Handling and storage conditions | • Store at -80°C until use |
• Formulation buffer | • PBS |
Reagent | Recombinant human FcyRIIa (H131) |
• Catalogue number | • 10374-H08B |
• Concentration | • 200 gg/ml (when reconstituted) |
• Source | • Sino Biological, insect cells-derived, with a C-terminal 6-His tag |
124
• Stability | • Stable at -20 to 80°C |
• Handling and storage conditions | • Store at -80°C until use |
• Formulation buffer | • PBS |
Reagent | Recombinant human FcyRIIb |
• Catalogue number | • 10259-H08C |
• Concentration | • 200 pg/ml (when reconstituted) |
• Source | • Sino Biological, CHO-derived, with a C-terminal 6-His tag |
• Stability | • Stable at -20 to 80°C |
• Handling and storage conditions | • Store at -80°C until use |
Reagent | Human complément component Clq |
• Catalogue number | • 204873 |
• Concentration | • 1.17 mg/ml |
• Source | • Sigma-Aldrich, prepared from human sérum |
• Stability | • Stable at -80°C |
• Handling and storage conditions | • Store at -80°C until use |
• Formulation buffer | • 10 mM HEPES with 0.3 M NaCl, pH 7.2 |
Reagent | Source |
PBS | Sigma-Aldrich Chemie GmbH, Switzerland |
AIM-V media | Gibco |
Ham’s F-12K Medium | Gibco |
MACSxpress® NK Isolation Kit | Miltenyi Biotec GmbH, Germany |
Cytotoxicity Détection Kit (LDH) | Roche Diagnostics GmbH, Switzerland |
125
96-well round bottom plates | Corning |
white fiat bottom 96-well plate | PerkinElmer |
384-well round bottom plates | Corning |
384-well fiat bottom plates | Corning |
Spectrophotometer | Bio-Tek |
RMPI medium | Gibco |
DMEM High Glucose with stable Glutamine | Bioconcept |
FBS | GE Healthcare |
Glutamax | Gibco |
Trypsin-EDTA (0.05%), phénol red | Gibco |
Prism7 Software Graph | Pad Software, Inc., La Jolla, CA |
Triton X-100 | Sigma |
ADCC Assay buffer | Promega |
Bio-Glo-TM Luciferase Assay Reagent | Promega |
ADCC Bioassay | Promega |
Wash buffer | PBS, 1%FBS |
Formaldéhyde solution, conc. 37% | Sigma (Cat. Nr.: F1635-500ML) |
Saponin | Sigma (Cat. Nr.: S7900-100G) |
Permeabilization buffer | 0.5% saponin, PBS, 1% FBS |
Alexa Fluor® 647 secondary Ab | AffmiPure F(ab')2 Fragment Goat AntiHuman IgG, Fcy Fragment Spécifie (Jackson ImmunoResearch, Cat. Nr.: 109-606-098) |
Anti-CD f 07 PE secondary Ab | Anti-CD 107 PE (BioLegend, Cat. Nr.: 328608, Clone H4A3, Mouse IgGl, kappa) |
126
Experimental Procedures
Measurement of binding to human Fc-receptors
Binding of HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE to human FcyRs was measured on an Octet® instrument (BLI, biolayer interferometry; FortéBio). Briefly, His-tagged human FcyRs (FcyRIIa allele H131, FcyRIIa allele R131, FcyRIIAa allele F158, FcyRIIIa allele V158 and FcyRIIb) at 2 pg/ml were captured onto antipenta-His sensors for 6 minutes. FcyR-loaded sensors were then exposed for 4 minutes 10 to a solution of kinetics buffer (pH 7.1) containing 2 pg/ml of each mAb in the presence pg/ml of affmiPure F(ab')2 Fragment Goat Anti-Human IgG, F(ab')2 fragmentspecific (to cross-link human mAbs through the Fab fragment), followed by a dissociation step in the same buffer for 4 additional minutes (right part of the plot). Association and dissociation profdes were measured in real time as change in the 15 interférence pattern using an Octet® RED96 (FortéBio). Binding of HBC34-V35MLNS-GAALIE, HBC34-V35-MLNS, or HBC34-V35 in solution to immobilized human FcRn was measured by Octet in real time at pH=6.0 or pH=7.4.
Measurement of binding to human complément protein Clq
Binding of HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE to human complément was measured on an Octet® instrument (BLI, biolayer interferometry; FortéBio). Briefly, anti-human Fab (CH 1-spécifie) sensors were used to capture, through the Fab fragment, the full IgGl of HBC34-V35-MLNS and HBC34-V3525 MLNS-GAALIE mAbs at 10 pg/ml for 10 minutes. IgG-loaded sensors were then exposed for 4 minutes to a solution of kinetics buffer (pH 7.1) containing 3 pg/ml of purified human Clq (left part of the plot), followed by a dissociation step in the same buffer for 4 additional minutes (right part of the plot). Association and dissociation profiles were measured in real time as change in the interférence pattern using an 30 Octet® RED96 (FortéBio).
127
Préparation of Human NK cells from whole blood
NK cells were freshly isolated from whole EDTA blood using the MACSxpress® NK isolation Kit following the manufacturer’s instruction. Briefly, anticoagulated blood was mixed in a 50 ml tube with 15 ml of the NK isolation cocktail and incubated for 5 minutes at room température using a rotator at approximately 12 rounds per minute. The tube was then placed in the magnetic field of the MACSxpress® Separator for 15 minutes. The magnetically labeied cells adhéré to the wall of the tube while the aggregated érythrocytes sédiment to the bottom. The target NK cells were then collected from the supematant while the tube was stiil inside the MACSxpress® Separator. NK cells were centrifuged, treated with distilled water to remove residual érythrocytes, centrifuged again and finally resuspended in AIM-V medium.
Détermination of Antibody-Dependent NK cell killing
MAbs were serially diluted 10-fold in AIM-V medium from 100 pg/ml to 0.001 pg/ml. Target cells (PLC/PRF/5; MacNab, et al., British Journal of Cancer, 34(5), 1976) were added in a round bottom 384-well plate at 7.5 x 103 cells/well in 23 pl, then serially diluted antibodies were added to each well (23 pl per well), and the antibody/cell mixture was incubated for 10 minutes at room température. Following incubation, human NK cells were added at a cell density of 7.5 x 104/well in 23 pl, yielding an effector to target ratio of 10:1. Control wells were also included that were used to measure maximal lysis (containing target cells with 23 pl of 3% Triton x-100) and spontaneous lysis (containing target cells and effector cells without antibody). Plates were incubated for 4 hours at 37°C with 5% CO2. Cell death was determined by measuring lactate dehydrogenase (LDH) release using a LDH détection kit according to the manufacturer’s instructions. In brief, plates were centrifuged for 4 minutes at 400 x g, and 35 pl of supematant was transferred to a fiat 384-well plate. LDH reagent was prepared and 35 pl were added to each well. Using a kinetic protocol, the absorbance at 490 nm and 650 nm was measured once every 2 minutes for 8 minutes. The percent spécifie lysis was determined by applying the following formula: (spécifie release spontaneous release) / (maximum release - spontaneous release) x 100.
128
Détermination of Antibody-Dependent NK cell activation
Activation of primary NK cells was tested using freshly isolated cells from two donors that had been previously genotyped for expressing homozygous high (VI58 allele) or low (F158 allele) affinity FcyRIIIa. Serial dilutions of mAbs (serially diluted 10-fold in AIM-V medium from 100 gg/ml to 0.0001 pg/ml) were incubated with NK cells for 4 hours. Activation of NK cell was measured by flow cytometry by staining NK cells with anti-CD107a mAb (anti-CD107 PE, BioLegend®, used diluted 1/35) as a functional marker for NK cell activity.
Détermination of Antibody-Dependent Activation of Human FcyRIIIa
HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE were serially diluted 4-fold in ADCC Assay buffer from 5 pg/ml to 0.076 pg/ml. Target antigen (HBsAg from Engerix B, Glaxo SmithKline) was added in a white fiat bottom 96-well plate at 0.6 gg/ml in 25 μΐ, then serially diluted antibodies were added to each well (25 μΐ per well), and the antibody/cell mixture was incubated for 10 minutes at room température. Effector cells for the ADCC Bioassay were thawed and added at a cell density of 7.5 x 104/well in 25 μΐ (final HBsAg concentration was 0.2 gg/ml). Control wells were also included that were used to measure antibody-independent activation (containing HBsAg and effector cells but no antibody) and spontaneous luminescence of the plate (wells containing the ADCC Assay buffer only). Plates were incubated for 24 hours at 37°C with 5% CO2. Activation of human FcyRIIIa (V158 or F158 variants) in this bioassay results in NFAT-mediated expression of the luciferase reporter gene. Luminescence was measured with a luminometer using the Bio-Glo-™ Luciferase Assay Reagent according to the manufacturer’s instructions. The data (i.e., spécifie FcyRIIIa activation) are expressed as the average of relative luminescence units (RLU) over the background by applying the following formula: (RLU at concentration x of mAbs RLU of background).
129
Détermination of Antibody-Dependent Activation of Human FcyRIIa
HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE were serially diluted 5-fold in ADCP Assay buffer from 50 pg/ml to 0.00013 pg/ml. Target antigen (HBsAg from Engerix B) was added in a white flat-bottom 96-well plate at 0.6 or 6 pg/ml in 25 pl, then serially diluted antibodies were added to each well (25 pl per well), and the antigen/antibody was incubated for 25 minutes at room température. Effector cells for the FcyRIIa activation bioassay were thawed and added at a cell density of 50.0 x 104/well in 25 pl (final HBsAg concentration was 0.2 or 2 pg/ml, respectively). Control wells were also included that were used to measure antibody-independent activation (containing HBsAg and effector cells but no antibody) and spontaneous luminescence of the plate (wells containing the ADCP Assay buffer only). Plates were incubated for 23 hours at 37°C with 5% CO2. Activation of human FcyRIIa (H131 variants) in this bioassay results in NFAT-mediated expression of the luciferase reporter gene. Luminescence was measured with a luminometer using the Bio-Glo-™ Luciferase Assay Reagent according to the manufacturer’s instructions. The data (i.e., spécifie FcyRIIa activation) are expressed as the average of relative luminescence units (RLU) over the background by applying the following formula: (RLU at concentration [x] of mAbs - RLU of background).
Détermination of Antibody-Dependent Activation of Human FcyRIIb
HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE were serially diluted 5-fold in ADCP Assay buffer from 100 pg/ml to 0.00026 pg/ml. Target antigen (HBsAg from Engerix B) was added in a white fiat bottom 96-well plate at 3 pg/ml in 25 pl, then serially diluted antibodies were added to each well (25 pl per well), and the antigen/antibody was incubated for 15 minutes at room température. Effector cells for the FcyRIIb activation bioassay were thawed and added at a cell density of 75.0 x 104/well in 25 pl (the final HBsAg concentration was 1 pg/ml). Control wells were also included that were used to measure antibody-independent activation (containing HBsAg and effector cells but no antibody) and spontaneous luminescence of the plate (wells containing the ADCP Assay buffer only). Plates were incubated for 20 hours at 37°C
130 with 5% CO2. Activation of human FcyRIIb in this bioassay results in NFAT-mediated expression of the luciferase reporter gene. Luminescence was measured with a luminometer using the Bio-Glo-™ Luciferase Assay Reagent according to the manufacturer’s instructions. The data (i.e., specific FcyRIIb activation) are expressed as the average of relative luminescence units (RLU) over the background by applying the following formula: (RLU at concentration [x] of mAbs - RLU of background).
Détermination of Antibody binding to human hepatoma cell line PLC/PRF/5
PLC/PRF/5 cells were trypsinized for 5 min at 37°C, transferred in 7 ml growing medium, centrifugated at 400 x g, 4 min, 4°C, and extensively washed at 4°C in PBS. Some cells were fixed with 4% formaldéhyde (20 minutes at 4°C); others were fixed and then permeabilized with permeabilization buffer (20 minutes at 4°C). The cellular pellet was resuspended in 2.64 ml of wash buffer (fixed cells) or permeabilization buffer (fix&perm cells) (Table 7) and dispensed at 200 μΐ/well into 96-well round bottom plates (corresponding to 100’000 cells/well). The plate was centrifugated at 400g , 4 min, 4°C. Serial 1:5 5-points dilutions of the test antibodies starting from a final concentration of 10 pg/ml were added to cell-containing wells and incubated 30 minutes on ice. After 2 washes at 4°C, 400 x g, 4 min in wash buffer (fix cells) or permeabilization buffer (fix&perm cells), 50 μΐ/well of Alexa Fluor® 647-labelled secondary antibody (Table 7) was added to cells and incubated for 20 min on ice. Cells were washed 2 more times with wash buffer (fix cells) or permeabilization buffer (fix&perm cells), resuspended in 200 μΐ/well of wash buffer (fix cells) or permeabilization buffer (fix&perm cells) and signal (MFI, mean fluorescence intensity) was quantified with a cytofluorimeter (BD FACSCanto™ II).
Results
Direct antiviral mechanisms are important for neutralizing HBV in vivo. Indirect, Fcdependent mechanisms of action mediated by the interaction of the Fc région with Fc gamma receptors (FcyRs) on immune cells may also hâve important contributions to in vivo efficacy and to médiate endogenous immune responses. FcyR-dependent
131 mechanisms can be assessed in vitro by measuring binding to FcyRs as well as m antibody-dependent activation of human FcyRs (Hsieh, Y.-T., et al., Journal of
Immunological Methods, 441(C), 56-66. doi.org/10.1016/j.jim.2016.12.002). The ability of the antibody to bind to FcRn and to complément are other factors of interest.
In one set of experiments, HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE were compared side-by-side for their ability to bind to the full set of human FcyRs (FcyRIIIa V158 and F158 alleles, FcyRIIa H131 and R131 alleles, and FcyRIIb) using biolayer interferometry (BLI Octet® System, ForteBio). As shown in Figures 9A-9E, Fc bearing MLNS-GAALIE mutations hâve altered interactions with FcyRs; specifically, Fc bearing both of these mutations, as opposed to Fc bearing MLNS alone, hâve enhanced binding to FcyRIIIa and FcyRIIa, and reduced binding to FcyRIIb.
As shown in Figure 9F, antibodies bearing the MLNS Fc mutation hâve increased binding to FcRn at pH 6.0 relative to antibody with wild-type Fc, but little to no measurable binding to FcRn at pH 7.4, which is comparable to antibody with wild-type Fc.
Also, binding of HBC34-V35-MLNS-GAALIE to Clq was abolished, as measured by biolayer interferometry (Figure 10).
HBC34-V35-MLNS and HBC34-V35-MLNS-GAALIE were also tested for their ability to activate human FcyRIIIa and FcyRIIa using cell-based reporter bioassays. These assays utilize Jurkat cells engineered with a NFAT-mediated luciferase reporter to reflect activation of human FcyRs. While HBC34-V35-MLNS poorly activated or did not activate human FcyRIIIa and FcyRIIa in the presence of HBsAg, HBC34-V35MLNS-GAALIE showed dose-dependent activation of ail tested FcyRs (Figures 11 A, 11B, 12A-12B). HBC34-V35-MLNS-GAALIE did not activate FcyRIIb, even when tested at 100 gg/ml (Figures 13A-13B).
ADCC activity was also measured using natural killer cells (NK) isolated from human peripheral blood mononuclear cells of one donor who was previously genotyped for
132 expressing heterozygous high (VI58) and low (F158) affinity FcyRIIIa (F/V). Isolated NK cells were used to measure the killing of the hepatoma cell line PLC/PR/5 upon exposure to HBC34-V35; HBC34-V35-MLNS; HBC34-V35-MLNS-GAALIE; or another mAb (17.1.41, targeting another epitope on the antigenic loop of the HBsAg; see Eren, R., et al., Hepatology, doi.org/10.1053/jhep.2000.9632; Galun, E., et aL, Hepatology, doi.org/10.1053/jhep.2002.31867). Killing in the presence of the HBsAgspecific mAbs HBC34-V35, HBC34-V35-MLNS, HBC34-V35-MLNS-GAALIE and 17.1.41 was not observed (Figure 14A). The observed lack of antibody-dependent killing of PLC/PR/5 cells might be related to the poor expression of HBsAg on the surface of these cells (Figure 14B), which, without wishing to be bound by theory, may not be sufficient to trigger killing by NK cells. Conversely, high levels of HBsAg were detected with HBC34v35 and 17.1.41 when PLC/PR/5 cells were fixed and permeabilized, indicating that most of the HBsAg is found either intracellularly or in secreted forms (i.e. subviral particles) (Figure 14B).
Activation of primary human NK cells (V/F) in the presence of HBC34v35-MLNS or HBC34-V35-MLNS-GAALIE and HBsAg was also examined using anti-CD107a mAb. Data are shown in Figures 15A and 15B.
These in vitro data show that HBV-specific binding proteins of the présent disclosure bearing the GAALIE Fc mutation bind to and activate low affinity activating FcyRIIa and FcyRIIIa more effectively than the non-GAALIE Fc parental antibody. GAALIEbearing binding proteins also do not bind to and or activate low affinity inhibitory FcyRIIb. GAALIE-bearing binding proteins also do not bind to Clq. Furthermore, GAALIE-bearing binding proteins do not promote ADCC on hepatoma cells, but activate human NK cells in the presence of soluble HBsAg. Introduction of MLNS mutation increases binding to FcRn at pH 6.0.
133
Example 7: In Vitro Study of Drug-Drug Interaction between HBC34-V35MLNS-GAALIE and a Pol/RT Inhibitor
An in vitro study was conducted to identify possible combination effects of HBC34V35-MLNS-GAALIE with the HBV pol/RT inhibitor Entecavir (ETV). In vitro combination effects were determined using HBC34-V35-MLNS-GAALIE and ETV in HepG2.2.15 cells in a checkerboard format. HBsAg and HBV DNA levels were used as read-outs and data were analyzed for combination effects using MacSynergy II (uab.edu/medicine/peds/macsynergy). For normalization, values obtained from untreated HepG2.2.15 cells were used as positive Controls, while tissue culture medium was used as négative control. Synergy plots at 99% confidence were used for reporting. Data are shown in Figure 16. The synergy plots for both readouts show an additive effect of HBC34-V35-MLNS-GAALIE with ETV in vitro. Notably, no antagonism was observed. These data support the use of nucleoside analogs in combination with HBC34-V35-MLNS-GAALIE in a clinical setting.
Example 8: Identification and characterization of human monoclonal antibody HBC24
An anti-HBV human monoclonal antibody was isolated in a similar manner as described in Traggiai E. et al., 2004, Nat Med 10(8): 871-5 from a human patient. The antibody was characterized by determining the nucléotide and amino acid sequences of its variable régions and the complementarity determining régions (CDRs) therein and termed HBC24. Accordingly, HBC24 is an IgGl-type fully human monoclonal antibody having the CDR, Vh and Vl sequences as shown above in Table 3. Exemplary nucléotide sequences encoding the Vh and Vl of HBC24 are provided in Table 4.
Example 9: Génération of germlined variants of HBC24 and functional testing
HBC24 is analyzed for the presence of somatic mutations in the variable régions relative to germline sequence. Identifïed somatic mutations are reverted to germline
134 sequence to produce HBC24 variants. HBC24 and variants are tested for binding (in vitro) and neutralization (in vitro', in vivo) of HBV and HBD serotypes using assays as described herein.
Example 10: Introduction of Fc modifications to HBC24 and variants
Further HBC24 variants are produced that contain the MLNS and GAALIE mutations in both Fc monomers. The HC amino acid sequences of selected variants are provided in SEQ ID NOs: 121 and 122. Variants are examined for: (1) in vitro binding to 10 antigen; (2) in vitro neutralization of HBV serotypes using assays as described herein.
TABLE OF SEQUENCES AND SEQ ID NUMBERS (SEQUENCE LISTING):
SEQ ID NO | Sequence | Remarks |
1 | Xi X2 X3 TC X4 X5 XôA X7G wherein Xi, X2, X3, X4, X5, Xô and X7 may be any amino | epitope |
2 | Xi X2 X3 TC X4 X5 XôA X7G wherein Xi is P, T or S, X2 is C or S, X3 is R, K, D or I, X4 is M or T, X5 is T, A or I, Χδ is T, P or L, and X7 is Q, H or L. |
135
3 | MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWT SLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYR WMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIP GSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNC TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWF VGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFF CLWVYI | S domain of HBsAg (GenBank acc. no. J02203) |
4 | MENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWT SLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYR WMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIP GSSTTGTGPCRTCTTPAQGTSMYPSCCCTKPSDGNC TCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWF VGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIF FCLWVYI | S domain of HBsAg (GenBank acc. no. FJ899792) |
5 | QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPS CCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | J02203 (D, ayw3) |
6 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSMYPSC CCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | FJ899792 (D, adw2) |
7 | QGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSC CCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSW | AM282986 (A) |
8 | QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSC CCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSW | D23678 (Bl) |
9 | QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSC CCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSW | AB117758 (Cl) |
10 | QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSC CCSKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | AB205192(E) |
11 | QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPS CCCSKPSDGNCTCTPTPSSWAT GKYT WFWASARFSW | X69798 (F4) |
12 | QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSC CCTKPSDGNCTC1PIPSSWAFAKYLWEWASVRFSW | AF160501(G) |
13 | QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPS CCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSW | AY090454 (H) |
14 | QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSC CCTKPSDGNCTCIPIPSSWAFAKYLWEWASARFSW | AF241409 (I) |
15 | QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSC CCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSW | AB486012(J) |
16 | CQGMLPVCPLIPGSSTTGTGTCRTCTTPAQGTSMYPS CCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg Y100C/P120T |
17 | QGMLPVCPLIPGSSTTGTGTCRTCTTPAQGTSMYPSC CCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg P120T |
18 | QGMLPVCPLIPGSSTTGTGTCRTCTTPAQGTSMYPSC CCTKPLDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg P120T/S143L |
136
19 | QGMLPVCPLIPGSSTTGTGPSRTCTTPAQGTSMYPSC CCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg C121S |
20 | QGMLPVCPLIPGSSTTGTGPCDTCTTPAQGTSMYPSC CCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg R122D |
21 | QGMLPVCPLIPGSSTTGTGPCITCTTPAQGTSMYPSC CCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg R1221 |
22 | QGMLPVCPLIPGSSTTGTGPCRNCTTPAQGTSMYPS CCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg T123N |
23 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAHGTSMYPSC CCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg Q129H |
24 | QGMLPVCPLIPGSSTTGTGPCRTCTTPALGTSMYPSC CCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg Q129L |
25 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSHYPSC CCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg Ml33H |
26 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSLYPSC CCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg Ml33L |
27 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSTYPSC CCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg Ml 33T |
28 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSMYPSC CCTEPSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg K141E |
29 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSMYPSC CCTKSSDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAgP142S |
30 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSMYPSC CCTKPKDGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg S143K |
31 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSMYPSC CCTKPSAGNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg D144A |
32 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSMYPSC CCTKPSDRNCTCIPIPSSWAFGKFLWEWASARFSW | HBsAg G145R |
33 | QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSMYPSC CCTKPSDGACTCIPIPSSWAFGKFLWEWASARFSW | HBsAgN146A |
34 | GRIFRSFY | HBC34 CDRH1 aa |
35 | NQDGSEK | HBC34 CDRH2 aa |
36 | AAWSGNSGGMDV | HBC34 CDRH3 aa |
37 | KLGNKN | HBC34 CDRL1 aa |
38 | EVK | HBC34 CDRL2 aa |
39 | VIYEVKYRP | HBC34 CDRL2 long aa |
137
40 | QTWDSTTVV | HBC34 CDRL3 aa |
41 | ELQLVESGGGWVQPGGSQRLSCAASGRIFRSFYMS WVRQAPGKGLEWVATINQDGSEKLYVDSVKGRFTI SRDNAKNSLFLQMNNLRVEDTAVYYCAAWSGNSG GMDVWGOGTTVSVSS | HBC34, HBC34V7, HBC34-V34, HBC34-V35 VH aa |
42 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVCWFQ HKPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTI SGTQAMDEAAYFCQTWDSTTVVFGGGTRLTVL | HBC34 VL aa |
43 | GGACGCATCTTTAGAAGTTTTTAC | HBC34 CDRH1 nue |
44 | ATAAACCAAGATGGAAGTGAGAAA | HBC34 CDRH2 nue |
45 | GCGGCTTGGAGCGGCAATAGTGGGGGTATGGACG TC | HBC34 CDRH3 nue |
46 | AAATTGGGGAATAAAAAT | HBC34 CDRL1 nue |
47 | GAGGTTAAA | HBC34 CDRL2 nue |
48 | gtcatctatGAGGTTAAAtaccgcccc | HBC34 CDRL2 long nue |
49 | CAGACGTGGGACAGCACCACTGTGGTG | HBC34 CDRL3 nue |
50 | GAACTGCAGCTGGTGGAGTCTGGGGGAGGCTGGG TCCAGCCGGGGGGGTCCCAGAGACTGTCCTGTGC AGCCTCTGGACGCATCTTTAGAAGTTTTTACATGA GCTGGGTCCGCCAGGCCCCAGGGAAGGGGCTGGA GTGGGTGGCCACTATAAACCAAGATGGAAGTGAG AAATTATATGTGGACTCTGTGAAGGGCCGATTCA CCATCTCCAGAGACAACGCCAAGAACTCACTATT TCTGCAAATGAACAACCTGAGAGTCGAGGACACG GCCGTTTATTACTGCGCGGCTTGGAGCGGCAATA GTGGGGGTATGGACGTCTGGGGCCAGGGGACCAC GGTCTCCGTCTCCTCA | HBC34 VH nue |
138
51 | TCCTATGAGCTGACTCAGCCACCCTCAGTGTCCGT GTCCCCAGGACAGACAGTCAGCATCCCCTGCTCT GGAGATAAATTGGGGAATAAAAATGTTTGCTGGT TTCAGCATAAGCCAGGCCAGTCCCCTGTGTTGGTC ATCTATGAGGTTAAATACCGCCCCTCGGGGATTCC TGAGCGATTCTCTGGCTCCAACTCTGGGAACACA GCCACTCTGACCATCAGCGGGACCCAGGCTATGG ATGAGGCTGCCTATTTCTGTCAGACGTGGGACAG CACCACTGTGGTGTTCGGCGGAGGGACCAGGCTG ACCGTCCTA | HBC34 VL nue |
52 | XGSSTTSTGPCRTCMTXPSDGNATAIPIPSSWX wherein the residues coded as X were substituted with Cvsteines | peptide |
53 | TSTGPCRTCMTTAQG | peptide |
54 | GMLPVCPLIPGSSTTSTGPCRTCMTT | peptide |
55 | XSMYPSASATKPSDGNXTGPCRTCMTTAQGTSX wherein the residues coded as X were substituted with Cysteines | peptide |
56 | PCRTCMTTAQG | amino acids 120 130 of the S domain of HBsAg (HBV-D .102203 |
57 | PCXiTCX2X3X4AQG, wherein Xi is R or K, X2 is M or T, X3 is T or I, and X4 is T, P or L | epitope |
58 | QTFDSTTW | HBC34-V7 CDRL3 and HBC34-V23 CDRL3 (aa) |
59 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVCWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTFDSTTVVFGGGTRLTVL | HBC34-V7 VL |
60 | AAGCTGGGGAACAAAAAT | HBC34-V7 CDRL1 and HBC-V23 CDRL1 (nue) |
61 | GAGGTGAAA | HBC34-V7 CDRL2 and HBC34v23 CDRL2 nue |
139
62 | GTCATCTACGAGGTGAAATATCGGCCT | HBC34-V7 CDRL2 long and CDRL2 HBC34-V23 long |
63 | CAGACATTCGATTCCACCACAGTGGTC | CDRL3 HBC34-V7 and CDRL3 HBC34-V23 nue |
64 | TCTTACGAGCTGACACAGCCACCTAGCGTGTCCGT CTCTCCAGGACAGACCGTGTCCATCCCTTGCTCTG GCGACAAGCTGGGGAACAAAAATGTCTGTTGGTTC CAGCACAAGCCAGGGCAGAGTCCCGTGCTGGTCAT CTACGAGGTGAAATATCGGCCTTCAGGAATTCCAG AACGGTTCAGCGGATCAAACAGCGGCAATACTGC AACCCTGACAATTAGCGGGACCCAGGCCATGGAC GAAGCCGCTTATTTCTGCCAGACATTCGATTCCAC CACAGTGGTCTTTGGCGGGGGAACTAGGCTGACCG TGCTG | HBC34-V7, HBC34-V34, and HBC34-V35 VL nue |
65 | SYELTQPPSVSVSPGQTASITCSGDKLGNKNACWYQ QKPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTI SGTQAMDEADYYCQTFDSTTVVFGGGTKLTVL | HBC34-V23 VL aa |
66 | INQDGSEK | HBC34wt CDRH2 |
67 | EVQLVESGGGLVQPGGSLRLSCAASGRIFRSFYMSW VRQAPGKGLEWVANINQDGSEKLYVDSVKGRFTISR DNAKNSLFLQMNNLRVEDTAVYYCAAWSGNSGGM DVWGQGTTVTVSS | HBC34-V31, HBC34-V32 and HBC34-V33 VH |
68 | GAGGTGCAGCTGGTGGAATCCGGCGGGGGACTGG TGCAGCCTGGCGGCTCACTGAGACTGAGCTGTGCA GCTTCTGGAAGAATCTTCAGATCTTTTTACATGAGT TGGGTGAGACAGGCTCCTGGGAAGGGACTGGAGT GGGTCGCAAACATCAATCAGGACGGATCAGAAAA GCTGTATGTGGATAGCGTCAAAGGCAGGTTCACTA TTTCCCGCGACAACGCCAAAAATTCTCTGTTTCTGC AGATGAACAATCTGCGGGTGGAGGATACCGCTGTC TACTATTGTGCAGCCTGGTCTGGCAACAGTGGAGG CATGGACGTGTGGGGACAGGGAACCACAGTGACA GTCAGCTCC | HBC34-V31, HBC34-V32 and HBC34-V33 VH (nue) |
140
69 | TCTTACGAGCTGACACAGCCCCCTAGCGTGTCCGT CTCTCCAGGCCAGACAGCATCCATCACTTGCTCTG GCGACAAGCTGGGGAACAAAAATGCCTGTTGGTA TCAGCAGAAGCCAGGGCAGAGTCCCGTGCTGGTC ATCTACGAGGTGAAATATCGGCCTTCAGGAATTCC AGAAAGATTCAGTGGATCAAACAGCGGCAATACT GCTACCCTGACAATTAGCGGGACCCAGGCCATGGA CGAAGCTGATTACTATTGCCAGACATTCGATTCCA CCACAGTGGTCTTTGGCGGGGGAACTAAGCTGACC GTGCTG | HBC34-V23 VL nue |
70 | GAACTGCAGCTGGTCGAATCAGGAGGAGGGTGGG TCCAGCCCGGAGGGAGCCAGAGACTGTCTTGTGCC GCATCAGGGAGGATCTTCAGGAGCTTCTACATGTC CTGGGTGCGCCAGGCACCAGGCAAGGGACTGGAG TGGGTCGCCACCATCAACCAGGACGGATCTGAAA AGCTGTATGTGGATAGTGTCAAAGGCCGGTTCACA ATTAGCAGAGACAACGCTAAAAATTCTCTGTTTCT GCAGATGAACAATCTGCGAGTGGAGGATACCGCC GTCTACTATTGCGCCGCTTGGTCTGGCAACAGCGG CGGGATGGATGTCTGGGGGCAGGGCACAACAGTG AGCGTCTCTTCC | HBC34 wt VH codon optimized |
71 | TCATACGAACTGACTCAGCCTCCCTCCGTCTCCGTC TCACCTGGACAGACCGTCTCAATCCCCTGCTCCGG CGATAAACTGGGCAACAAGAACGTGTGCTGGTTCC AGCACAAACCCGGACAGAGTCCTGTGCTGGTCATC TACGAGGTCAAGTATCGGCCAAGCGGCATTCCCGA AAGATTCAGCGGCTCCAACTCTGGGAATACCGCAA CACTGACTATCTCTGGAACCCAGGCAATGGACGAG GCAGCTTACTTTTGCCAGACTTGGGATTCAACTAC TGTCGTGTTCGGCGGCGGAACTAGACTGACTGTCC TG | HBC34 wt VL codon optimized |
72 | GGGAGGATCTTCAGGAGCTTCTAC | HBC34 wt CDRH1 codon optimized |
73 | ATCAACCAGGACGGATCTGAAAAG | HBC34 wt CDRH2 codon optimized |
74 | GCCGCTTGGTCTGGCAACAGCGGCGGGATGGATGT C | HBC34 wt CDRH3 codon optimized |
75 | AAACTGGGCAACAAGAAC | HBC34 wt CDRL1 codon optimized |
76 | GAGGTCAAG | HBC34 wt CDRL2 codon optimized |
141
77 | GTCATCTACGAGGTCAAGTATCGGCCA | HBC34 wt CDRL2 long codon ootimized |
78 | CAGACTTGGGATTCAACTACTGTCGTG | HBC34 wt CDRL3 codon optimized |
79 | GGSGG | linker |
80 | TGPCRTC | epitope |
81 | GNCTCIP | epitope |
82 | CCIPIPSSWAFGCSTTSTGPCRTCC wherein in particular thy cysteines at positions 2, 21, and 24 are coupled to acetamidomethyl. | discontinuous epitope mimic |
83 | CGNCTCIPIPSSWAFÇSTTSTGPCRTCÇ wherein in particular thy cysteines at positions 4, 6, 24, and 27 are coupled to acetamidomethyl. | discontinuous epitope mimic |
84 | CGGGCSTTSTGPCRTCC wherein in particular thy cysteines at positions 13 and 16 are coupled to acetamidomethyl. | looped epitope mimic |
85 | STTSTGPCRTC | epitope |
86 | GNCTCIPIPSSWAFC | epitope |
87 | GNCTCIPIPSSWAF | epitope - |
88 | PCRXC | epitope |
89 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVAWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTFDSTTVVFGGGTRLTVL | HBC34-V35 VL |
90 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVSWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTFDSTTWFGGGTRLTVL | HBC34-V34 VL |
91 | ELQLVESGGGWVQPGGSQRLSCAASGRIFRSFYMSW VRQAPGKGLEWVATINQDGSEKLYVDSVKGRFTISR DNAKNSLFLQMNNLRVEDTAVYYCAAWSGNSGGM DVWGQGTTVSVSSASTKGPSVFPLAPSSKSTSGGTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLAGPSVFLFPPKPKDTL MISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPLPEEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHE ALHSHYTQKSLSLSPGK | HC of HBC34-V35MLNS-GAALIE and HBC34-V34MLNS-GAALIE (glM17, 1) |
142
92 | ELQLVESGGGWVQPGGSQRLSCAASGRIFRSFYMSW VRQAPGKGLEWVATINQDGSEKLYVDSVKGRFTISR DNAKNSLFLQMNNLRVEDTAVYYCAAWSGNSGGM DVWGQGTTVSVSSASTKGPSVFPLAPSSKSTSGGTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEA LHSHYTQKSLSLSPGK | HC ofHBC34-V35- MLNS and HBC34- V34-MLNS (glM17, 1) |
93 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVAWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTFDSTTVVFGGGTRLTVLGQPK AAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVA WKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPE QWKSHRSYSCQVTHEGSTVEKTVAPTECS | LC of HBC34-V35 |
94 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVSWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTFDSTTWFGGGTRLTVLGQPK AAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVA WKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPE QWKSHRSYSCQVTHEGSTVEKTVAPTECS | LC ofHBC34-V34 |
95 | EVQLLESGGGLVQPGGSLRLSCAASGSTFTKYAMSW VRQAPGKGLEWVASISGSVPGFGIDTYYADSVKGRF TISRDTSKNTLYLQMNSLRAEDTALYYCAKDVGVIG SYYYYAMDVWGQGTAVTVSS | HBC24 VH |
96 | EIVLTQSPGTLSLSPGERATLSCRASQGLSSSYLAWY QQKPGQAPRLLIYSASTRATGIPDRFSGSGSGTDFTLT ISRLEPEDFAVYYCQQYAYSPRWTFGQGTKVEIK | HBC24 VL |
97 | GSTFTKYA | CDRH1 of HBC24 |
98 | ISGSVPGF | CDRH2 of HBC24 |
99 | LYYCAKDVGVIGSYYYYAMDV | CDRH3 of HBC24 |
100 | QGLSSSY | CDRL1 ofHBC24 |
101 | SAS | CDRL2 ofHBC24 |
102 | QQYAYSPRWT | CDRL3 of HBC24 |
143
103 | gagctgcagctggtggagtccggcggcggctgggtgcagcctggcggctcccag aggctgagctgtgccgcttctggcaggatcttccggtccttttacatgtcttgggtgcg gcaggctccaggcaagggcctggagtgggtggctaccatcaaccaggacggctc cgagaagctgtatgtggatagcgtgaagggcagattcacaatctctcgcgacaacg ccaagaactccctgtttctgcagatgaacaatctgagggtggaggataccgccgtgt actattgcgccgcttggtctggcaatagcggcggcatggacgtgtggggacaggg caccaccgtgtccgtgtccagc | VH of HBC34-V7, HBC34-V35, and HBC34-V34 (codon optimized) |
104 | agctacgagctgacacagcccccttccgtgtccgtgtcccctggacagaccgtgtc catcccatgcagcggcgacaagctgggcaacaagaacgtgtcctggtttcagcata agcctggccagtcccccgtgctggtcatctacgaggtgaagtataggcccagcgg catccctgagcggttctctggctccaacagcggcaatacagccaccctgacaatctc tggcacacaggctatggacgaggccgcttatttctgccagacctttgattccaccac agtggtgttcggcggcggcaccagactgacagtgctg | HBC34-V34 VL (codon optimized) |
105 | agctacgagctgacacagcccccttccgtgtccgtgtcccctggacagaccgtgtc catcccatgcagcggcgacaagctgggcaacaagaacgtggcctggtttcagcat aagcctggccagtcccccgtgctggtcatctacgaggtgaagtataggcccagcg gcatccctgagcggttctctggctccaacagcggcaatacagccaccctgacaatc tctggcacacaggctatggacgaggccgcttatttctgccagacctttgattccacca cagtggtgttcggcggcggcaccagactgacagtgctg | HBC34-V35 VL (codon optimized) |
106 | gaggtgcagttgttggagtctgggggaggcttggtacagcctggggggtccctga gactctcctgtgcagcctctGGATCCACTTTTACCAAATATGC CatgagctgggtccgtcaggctccagggaaggggctggagtgggtcgcaagtA TTAGTGGAAGTgttcctggttttGGTATTGACACAtactacgca gactccgttaagggccggttcaccatctccagagacacttccaagaacaccctgtat ctgcaaatgaacagcctgagagccgaggacacggccttatattactgtGCGAA AGATGTCGGGGTTATCGGGTCATACTATTACTACG CTATGGACGTCtggggtcaa | HBC24 VH (wild type) |
107 | aaattgtgttgacgcagtctccaggcaccctgtctttgtctccaggggaaagagcca ccctctcctgcagggccagtCAGGGTCTTAGCAGCAGTTACtta gcctggtaccagcagaaacctggccaggctcccaggctcctcatctatAGTGC GTCCaccagggccactggcatcccagacaggttcagtggcagtgggtctggga cagacttcactctcaccatcagcagactggagcctgaagattttgcagtgtattactgt CAACAGTATGCTTACTCACCTCGGTGGACGttcggcca agggaccaaggtggagatcaaac | HBC24 VL (wild type) |
144
108 | GAGGTGCAGCTGCTGGAAAGCGGCGGCGGCCTGG TGCAGCCCGGCGGCTCCCTGAGGCTGTCTTGCGCC GCCTCTGGCAGCACCTTCACAAAGTATGCAATGTC TTGGGTGCGCCAGGCACCAGGCAAGGGCCTGGAG TGGGTGGCCTCCATCTCTGGCAGCGTGCCTGGCTT CGGCATCGACACCTACTATGCCGATTCCGTGAAGG GCCGGTTTACAATCAGCAGAGACACCTCCAAGAAC ACACTGTATCTGCAGATGAATTCTCTGCGGGCCGA GGACACCGCCCTGTACTATTGTGCCAAGGATGTGG GCGTGATCGGCAGCTACTATTACTATGCAATGGAC GTGTGGGGACAGGGAACAGCAGTGACAGTGAGCT CC | HBC24 VH (codon optimized) |
109 | GAGATCGTGCTGACCCAGTCTCCTGGCACACTGTC CCTGTCCCCTGGAGAGAGAGCCACCCTGTCCTGCA GAGCCTCTCAGGGCCTGAGCTCCTCTTACCTGGCC TGGTATCAGCAGAAGCCTGGACAGGCCCCTCGGCT GCTGATCTACTCTGCCTCCACCAGAGCAACAGGCA TTCCTGACCGCTTCTCCGGATCTGGAAGCGGCACA GACTTCACCCTGACAATCAGCCGGCTGGAGCCTGA GGACTTCGCCGTGTACTATTGTCAGCAGTACGCCT ATTCCCCAAGGTGGACCTTTGGCCAGGGCACAAAG GTGGAGATCAAG | HBC24 VL (codon optimized) |
110 | agctacgagctgacacagcccccttccgtgtccgtgtcccctggacagaccgtgtc catcccatgcagcggcgacaagctgggcaacaagaacgtgtgctggtttcagcata agcctggccagtcccccgtgctggtcatctacgaggtgaagtataggcccagcgg catccctgagcggttctctggctccaacagcggcaatacagccaccctgacaatctc tggcacacaggctatggacgaggccgcttatttctgccagacctttgattccaccac agtggtgttcggcggcggcaccagactgacagtgctg | HBC34-V7 VL (codon optimized) |
111 | SYELTQPPSVSVSPGQTASITCSGDKLGNKNASWYQ QKPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTI SGTQAMDEADYYCQTFDSTTWFGGGTKLTVL | HBC34-V23- L_C40S |
112 | SYELTQPPSVSVSPGQTASITCSGDKLGNKNAAWYQ QKPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTI SGTQAMDEADYYCQTFDSTTWFGGGTKLTVL | HBC34-V23- L_C40A |
113 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVSWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTWDSTTWFGGGTRLTVL | HBC34-V31- L_C40S |
114 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVAWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTWDSTTWFGGGTRLTVL | HBC34-V31- L_C40A |
145
115 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVSWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTFDSTTWFGGGTRLTVL | HBC34-V32- LC40S |
116 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVAWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTWDSTTVVFGGGTRLTVL | HBC34-V32- L_C40A |
117 | SYELTQPPSVSVSPGQTASITCSGDKLGNKNASWYQ QKPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTI SGTQAMDEADYYCQTFDSTTVVFGGGTKLTVL | HBC34-V33- LC40S |
118 | SYELTQPPSVSVSPGQTASITCSGDKLGNKNAAWYQ QKPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTI SGTQAMDEADYYCQTFDSTTVVFGGGTKLTVL | HBC34-V33- LC40A |
119 | S YELTQPPS VS VSPGQTVSIPC SGDKLGNKNVS WFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTWDSTTVVFGGGTRLTVL | HBC34-L_C40S |
120 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVAWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTWDSTTVVFGGGTRLTVL | HBC34-L_C40A |
121 | EVQLLESGGGLVQPGGSLRLSCAASGSTFTKYAMSW VRQAPGKGLEWVASISGSVPGFGIDTYYADSVKGRF TISRDTSKNTLYLQMNSLRAEDTALYYCAKDVGVIG SYYYYAMDVWGQGTAVTVSSASTKGPSVFPLAPSSK STSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS NTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCWVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVLHEALHSHYTQKSLSLSPGK | HBC24-MLNS |
146
122 | EVQLLESGGGLVQPGGSLRLSCAASGSTFTKYAMSW VRQAPGKGLEWVASISGSVPGFGIDTYYADSVKGRF TISRDTSKNTLYLQMNSLRAEDTALYYCAKDVGVIG SYYYYAMDVWGQGTAVTVSSASTKGPSVFPLAPSSK STSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS NTKVDKKVEPKSCDKTHTCPPCPAPELLAGPSVFLFP PKPKDTLMISRTPEVTCWVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPLPEEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVLHEALHSHYTQKSLSLSPGK | HBC24-MLNSGAALIE |
123 | ELQLVESGGGWVQPGGSQRLSCAASGRIFRSFYMSW VRQAPGKGLEWVATINQDGSEKLYVDSVKGRFTISR DNAKNSLFLQMNNLRVEDTAVYYCAAWSGNSGGM DVWGQGTTVSVSSAKTTAPSVYPLAPVCGDTTGSSV TLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSD LYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMIS LSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQ THREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNN KDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQ VTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPV LDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGL HNHHTTKSFSRTPGK | HBC34-V7-mu (IgG2a) HC |
124 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVCWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTFDSTTWFGGGTRLTVLGQPKS SPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDW KVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTAR AWERHSSYSCQVTHEGHTVEKSLSRADCS | HBC34-V7-mu (IgG2a) LC |
147
125 | ELQLVESGGGWVQPGGSQRLSCAASGRIFRSFYMSW VRQAPGKGLEWVATINQDGSEKLYVDSVKGRFTISR DNAKNSLFLQMNNLRVEDTAVYYCAAWSGNSGGM DVWGQGTTVSVSSAKTTAPSVYPLAPVCGDTTGSSV TLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSD LYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMIS LSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQ THREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNN KDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQ VTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPV LDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGL HNHHTTKSFSRTPGK | HBC34-V35-mu (IgG2a) HC |
126 | SYELTQPPSVSVSPGQTVSIPCSGDKLGNKNVAWFQH KPGQSPVLVIYEVKYRPSGIPERFSGSNSGNTATLTIS GTQAMDEAAYFCQTFDSTTVVFGGGTRLTVLGQPKS SPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDW KVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTAR AWERHSSYSCQVTHEGHTVEKSLSRADCS | HBC34-V35-mu (IgG2a) LC |
127 | EVQLLESGGGLVQPGGSLRLSCAASGSTFTKYAMSW VRQAPGKGLEWVASISGSVPGFGIDTYYADSVKGRF TISRDTSKNTLYLQMNSLRAEDTALYYCAKDVGVIG SYYYYAMDVWGQGTAVTVSSAKTTAPSVYPLAPVC GDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVH TFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPAS STKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPP KIKDVLMISLSPIVTCVWDVSEDDPDVQISWFVNNV EVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGK EFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPP EEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTEL NYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYS CSVVHEGLHNHHTTKSFSRTPGK | HBC24-mu (IgG2a) HC |
128 | EIVLTQSPGTLSLSPGERATLSCRASQGLSSSYLAWY QQKPGQAPRLLIYSASTRATGIPDRFSGSGSGTDFTLT ISRLEPEDFAVYYCQQYAYSPRWTFGQGTKVEIKAD AAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVK WKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTK DEYERHNSYTCEATHKTSTSPIVKSFNRNEC | HBC24-mu (IgG2a) LC |
148
129 | ELQLVESGGGWVQPGGSQRLSCAASGRIFRSFYMSW VRQAPGKGLEWVATINQDGSEKLYVDSVKGRFTISR DNAKNSLFLQMNNLRVEDTAVYYCAAWSGNSGGM DVWGQGTTVSVSSASTKGPSVFPLAPSSKSTSGGTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPGK | HBC34-V7, HBC34-V34, HBC34-V35 HC (wild-type) |
149
130 | GCCTCCACAAAGGGCCCAAGCGTGTTTCCACTGGC TCCCTCTTCCAAGTCTACCTCCGGCGGCACAGCCG CTCTGGGATGTCTGGTGAAGGATTACTTCCCAGAG CCCGTGACCGTGTCTTGGAACTCCGGCGCCCTGAC CAGCGGAGTGCATACATTTCCAGCTGTGCTGCAGA GCTCTGGCCTGTACTCTCTGTCCAGCGTGGTGACC GTGCCCTCTTCCAGCCTGGGCACCCAGACATATAT CTGCAACGTGAATCACAAGCCAAGCAATACAAAG GTGGACAAGAAGGTGGAGCCCAAGTCTTGTGATA AGACCCATACATGCCCTCCATGTCCAGCTCCAGAG CTGCTGGGCGGCCCAAGCGTGTTCCTGTTTCCACC CAAGCCTAAGGATACCCTGATGATCTCCAGAACCC CCGAGGTGACATGCGTGGTGGTGGACGTGAGCCA CGAGGATCCTGAGGTGAAGTTCAACTGGTACGTGG ACGGCGTGGAGGTGCATAATGCTAAGACCAAGCC CAGGGAGGAGCAGTACAACTCTACCTATCGGGTG GTGTCCGTGCTGACAGTGCTGCACCAGGATTGGCT GAACGGCAAGGAGTATAAGTGCAAGGTGTCTAAT AAGGCCCTGCCCGCTCCTATCGAGAAGACCATCTC CAAGGCCAAGGGCCAGCCTAGAGAGCCACAGGTG TACACACTGCCTCCATCTCGCGATGAGCTGACCAA GAACCAGGTGTCCCTGACATGTCTGGTGAAGGGCT TCTATCCTTCCGACATCGCTGTGGAGTGGGAGAGC AATGGCCAGCCAGAGAACAATTACAAGACCACAC CCCCTGTGCTGGACAGCGATGGCTCTTTCTTTCTGT ATAGCAAGCTGACCGTGGACAAGTCTCGCTGGCAG CAGGGCAACGTGTTTAGCTGTTCTGTGATGCATGA GGCCCTGCACAATCATTATACACAGAAGTCCCTGA GCCTGTCTCCTGGCAAG | HBC34-V7, HBC34-V34, HBC34-V35 CH1hinge-CH2-CH3 (codon-optim ized) |
150
131 GAGCTGCAGCTGGTGGAGTCCGGCGGCGGCTGGG
TGCAGCCTGGCGGCTCCCAGAGGCTGAGCTGTGCC
GCTTCTGGCAGGATCTTCCGGTCCTTTTACATGTCT TGGGTGCGGCAGGCTCCAGGCAAGGGCCTGGAGT GGGTGGCTACCATCAACCAGGACGGCTCCGAGAA GCTGTATGTGGATAGCGTGAAGGGCAGATTCACAA TCTCTCGCGACAACGCCAAGAACTCCCTGTTTCTG
HBC34-V7, HBC34-V34, HBC34-V35 VHCHl-hinge-CH2CH3 (codonoptimized)
CAGATGAACAATCTGAGGGTGGAGGATACCGCCG
TGTACTATTGCGCCGCTTGGTCTGGCAATAGCGGC GGCATGGACGTGTGGGGACAGGGCACCACCGTGT CCGTGTCCAGCGCCTCCACAAAGGGCCCAAGCGTG TTTCCACTGGCTCCCTCTTCCAAGTCTACCTCCGGC GGCACAGCCGCTCTGGGATGTCTGGTGAAGGATTA CTTCCCAGAGCCCGTGACCGTGTCTTGGAACTCCG GCGCCCTGACCAGCGGAGTGCATACATTTCCAGCT GTGCTGCAGAGCTCTGGCCTGTACTCTCTGTCCAG CGTGGTGACCGTGCCCTCTTCCAGCCTGGGCACCC AGACATATATCTGCAACGTGAATCACAAGCCAAGC AATACAAAGGTGGACAAGAAGGTGGAGCCCAAGT CTTGTGATAAGACCCATACATGCCCTCCATGTCCA GCTCCAGAGCTGCTGGGCGGCCCAAGCGTGTTCCT GTTTCCACCCAAGCCTAAGGATACCCTGATGATCT CCAGAACCCCCGAGGTGACATGCGTGGTGGTGGA CGTGAGCCACGAGGATCCTGAGGTGAAGTTCAACT GGTACGTGGACGGCGTGGAGGTGCATAATGCTAA GACCAAGCCCAGGGAGGAGCAGTACAACTCTACC TATCGGGTGGTGTCCGTGCTGACAGTGCTGCACCA GGATTGGCTGAACGGCAAGGAGTATAAGTGCAAG GTGTCTAATAAGGCCCTGCCCGCTCCTATCGAGAA GACCATCTCCAAGGCCAAGGGCCAGCCTAGAGAG CCACAGGTGTACACACTGCCTCCATCTCGCGATGA GCTGACCAAGAACCAGGTGTCCCTGACATGTCTGG TGAAGGGCTTCTATCCTTCCGACATCGCTGTGGAG TGGGAGAGCAATGGCCAGCCAGAGAACAATTACA AGACCACACCCCCTGTGCTGGACAGCGATGGCTCT TTCTTTCTGTATAGCAAGCTGACCGTGGACAAGTC TCGCTGGCAGCAGGGCAACGTGTTTAGCTGTTCTG TGATGCATGAGGCCCTGCACAATCATTATACAt AG AAGTCCCTGAGCCTGTCTCCTGGCAAGTGATGAGG TACCGTGCGACGGCCGGCAAGCCCCCGCTCCCCGG
GCTCTCGCGGTCGTACGAGGAAAGCTT
151
132 | GGACAGCCAAAGGCTGCTCCATCTGTGACCCTGTT TCCACCCTCTTCCGAGGAGCTGCAGGCCAACAAGG CCACCCTGGTGTGCCTGATCTCTGACTTCTACCCTG GAGCTGTGACAGTGGCTTGGAAGGCTGATAGCTCT CCCGTGAAGGCTGGCGTGGAGACAACAACCCCTA GCAAGCAGTCTAACAATAAGTACGCCGCTTCCAGC TATCTGTCTCTGACACCAGAGCAGTGGAAGTCCCA CCGCTCTTATTCCTGCCAGGTGACCCATGAGGGCA GCACCGTGGAGAAGACAGTGGCCCCCACCGAGTG TTCT | HBC34-V7 CL (codon-optim ized) |
133 | AGCTACGAGCTGACACAGCCCCCTTCCGTGTCCGT GTCCCCTGGACAGACCGTGTCCATCCCATGCAGCG GCGACAAGCTGGGCAACAAGAACGTGTGCTGGTTT CAGCATAAGCCTGGCCAGTCCCCCGTGCTGGTCAT CTACGAGGTGAAGTATAGGCCCAGCGGCATCCCTG AGCGGTTCTCTGGCTCCAACAGCGGCAATACAGCC ACCCTGACAATCTCTGGCACACAGGCTATGGACGA GGCCGCTTATTTCTGCCAGACCTTTGATTCCACCAC AGTGGTGTTCGGCGGCGGCACCAGACTGACAGTGC TGGGACAGCCAAAGGCTGCTCCATCTGTGACCCTG TTTCCACCCTCTTCCGAGGAGCTGCAGGCCAACAA GGCCACCCTGGTGTGCCTGATCTCTGACTTCTACCC TGGAGCTGTGACAGTGGCTTGGAAGGCTGATAGCT CTCCCGTGAAGGCTGGCGTGGAGACAACAACCCCT AGCAAGCAGTCTAACAATAAGTACGCCGCTTCCAG CTATCTGTCTCTGACACCAGAGCAGTGGAAGTCCC ACCGCTCTTATTCCTGCCAGGTGACCCATGAGGGC AGCACCGTGGAGAAGACAGTGGCCCCCACCGAGT GTTCT | HBC34-V7 LC (VL-CL) (codonoptimized) |
134 | GGACAGCCAAAGGCTGCTCCATCTGTGACCCTGTT TCCACCCTCTTCCGAGGAGCTGCAGGCCAACAAGG CCACCCTGGTGTGCCTGATCTCTGACTTCTACCCTG GAGCTGTGACAGTGGCTTGGAAGGCTGATAGCTCT CCCGTGAAGGCTGGCGTGGAGACAACAACCCCTA GCAAGCAGTCTAACAATAAGTACGCCGCTTCCAGC TATCTGTCTCTGACACCAGAGCAGTGGAAGTCCCA CCGCTCTTATTCCTGCCAGGTGACCCATGAGGGCA GCACCGTGGAGAAGACAGTGGCCCCCACCGAGTG | HBC34-V34, HBC34-V35 CL (codonoptimized) |
152
135 | AGCTACGAGCTGACACAGCCCCCTTCCGTGTCCGT GTCCCCTGGACAGACCGTGTCCATCCCATGCAGCG GCGACAAGCTGGGCAACAAGAACGTGTCCTGGTTT CAGCATAAGCCTGGCCAGTCCCCCGTGCTGGTCAT CTACGAGGTGAAGTATAGGCCCAGCGGCATCCCTG AGCGGTTCTCTGGCTCCAACAGCGGCAATACAGCC ACCCTGACAATCTCTGGCACACAGGCTATGGACGA GGCCGCTTATTTCTGCCAGACCTTTGATTCCACCAC AGTGGTGTTCGGCGGCGGCACCAGACTGACAGTGC TGGGACAGCCAAAGGCTGCTCCATCTGTGACCCTG TTTCCACCCTCTTCCGAGGAGCTGCAGGCCAACAA GGCCACCCTGGTGTGCCTGATCTCTGACTTCTACCC TGGAGCTGTGACAGTGGCTTGGAAGGCTGATAGCT CTCCCGTGAAGGCTGGCGTGGAGACAACAACCCCT AGCAAGCAGTCTAACAATAAGTACGCCGCTTCCAG CTATCTGTCTCTGACACCAGAGCAGTGGAAGTCCC ACCGCTCTTATTCCTGCCAGGTGACCCATGAGGGC AGCACCGTGGAGAAGACAGTGGCCCCCACCGAGT GTTCT | HBC34-V34 LC (VL-CL) (codonoptimized) |
136 | AGCTACGAGCTGACACAGCCCCCTTCCGTGTCCGT GTCCCCTGGACAGACCGTGTCCATCCCATGCAGCG GCGACAAGCTGGGCAACAAGAACGTGGCCTGGTT TCAGCATAAGCCTGGCCAGTCCCCCGTGCTGGTCA TCTACGAGGTGAAGTATAGGCCCAGCGGCATCCCT GAGCGGTTCTCTGGCTCCAACAGCGGCAATACAGC CACCCTGACAATCTCTGGCACACAGGCTATGGACG AGGCCGCTTATTTCTGCCAGACCTTTGATTCCACCA CAGTGGTGTTCGGCGGCGGCACCAGACTGACAGTG CTGGGACAGCCAAAGGCTGCTCCATCTGTGACCCT GTTTCCACCCTCTTCCGAGGAGCTGCAGGCCAACA AGGCCACCCTGGTGTGCCTGATCTCTGACTTCTAC CCTGGAGCTGTGACAGTGGCTTGGAAGGCTGATAG CTCTCCCGTGAAGGCTGGCGTGGAGACAACAACCC CTAGCAAGCAGTCTAACAATAAGTACGCCGCTTCC AGCTATCTGTCTCTGACACCAGAGCAGTGGAAGTC CCACCGCTCTTATTCCTGCCAGGTGACCCATGAGG GCAGCACCGTGGAGAAGACAGTGGCCCCCACCGA GTGTTCT | HBC34-V35 LC (VL-CL) (codonoptimized) |
137 | APELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVS HEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK | WT hlgGl Fc |
153
138 | ELQLVESGGGWVQPGGSQRLSCAASGRIFRSFYMSW VRQAPGKGLEWVATINQDGSEKLYVDSVKGRFTISR DNAKNSLFLQMNNLRVEDTAVYYCAAWSGNSGGM DVWGQGTTVSVSSASTKGPSVFPLAPSSKSTSGGTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLAGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPLPEEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK | HBC34, HBC34-V7, HBC34-V23, HBC34-V34, HBC34-V35, HBC34C40S, HBC34C40A, HBC34-V23_C40S, HBC34-V23_C40A HC with GAALIE mutation in hlgGl Fc |
139 | ESKYGPPCPPCPAPPVAGP | Chimeric hinge sequence |
The various embodiments described above can be combined to provide further 5 embodiments. Ail of the U.S. patents, U.S. patent application publications, U.S. patent applications, foreign patents, foreign patent applications and non-patent publications referred to in this spécification and/or listed in the Application Data Sheet are incorporated herein by reference, in their entirety. Aspects of the embodiments can be modified, if necessary to employ concepts of the various patents, applications and publications to provide yet further embodiments.
U.S. Provisional Application 62/782,274, filed December 19, 2018 and U.S. Provisional Application 62/860,085, filed June 11, 2019 are incorporated herein by reference, in their entirety.
These and other changes can be made to the embodiments in light of the above15 detailed description. In general, in the following claims, the terms used should not be construed to limit the claims to the specific embodiments disclosed in the spécification and the claims, but should be construed to include ail possible embodiments along with the full scope of équivalents to which such claims are entitled. Accordingly, the claims are not limited by the disclosure.
Claims (63)
1. An isolated antibody, or an antigen binding fragment thereof, comprising:
(i) a heavy chain variable région (Vh) comprising at least 90% identity to the amino acid sequence according to SEQ ID NO:41; and (ii) a light chain variable région (Vl) comprising at least 90% identity to the amino acid sequence according to any one of SEQ ID NOs: 59, 89, or 90, provided that the amino acid at position 40 of the Vl according to IMGT numbering is not a cysteine, wherein the antibody or antigen binding fragment thereof binds to the antigenic loop région of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
2. The antibody or antigen binding fragment of claim 1, wherein:
(i) the Vh comprises at least 95% identity to the amino acid sequence according to SEQ ID NO:41; and/or (ii) the Vl comprises at least 95% identity to the amino acid sequence according to any one of SEQ ID NOs: 59, 89, or 90.
3. The antibody or antigen binding fragment of claim 1 or 2, wherein the amino acid at position 40 of the Vl is alanine.
4. The antibody or antigen binding fragment of claim 1 or 2, wherein the amino acid at position 40 of the Vl is serine.
5. The antibody or antigen binding fragment of claim 1 or 2, wherein the amino acid at position 40 of the Vl is glycine.
6. The antibody or antigen binding fragment of any one of claims 1-5, comprising CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 sequences according to SEQ ID NOs: (i) 34-36, 37, 38, and 40, respectively;
(ii) 34, 66, 36, 37, 38, and 40, respectively;
(iii) 34-36, 37, 39, and 40, respectively;
155 (iv) 34, 66, 36, 37, 39, and 40, respectively;
(v) 34-36, 37, 38, and 58, respectively;
(vi) 34, 66, 36, 37, 38, and 58, respectively;
(vii) 34-36, 37, 39, and 58, respectively; or
5 (vii) 34, 66, 36, 37, 39, and 58, respectively.
7. The isolated antibody of any one of ciaims 1-3, or 6, wherein the Vh comprises or consists of the amino acid sequence according to SEQ ID NO:41 and Vl comprises or consists of the amino acid sequence according to SEQ ID NO:89.
8. The isolated antibody of any one of ciaims 1, 2, 4, or 6, wherein the Vh comprises or consists of the amino acid sequence according to SEQ ID NO:41 and Vl comprises or consists of the amino acid sequence according to SEQ ID NO:90.
15
9. The antibody or antigen binding fragment of any one of ciaims 1-8, wherein the antibody, or the antigen binding fragment thereof, comprises a human antibody, a monoclonal antibody, a purified antibody, a single chain antibody, a Fab, a Fab’, a F(ab’)2, a Fv, or a scFv.
20
10. The antibody or antigen binding fragment of any one of ciaims 1-9, wherein the antibody or antigen binding fragment is a multi-specific antibody or antigen binding fragment.
11. The antibody or antigen binding fragment of claim 10, wherein the antibody or antigen binding fragment is a bispecific antibody or antigen binding fragment.
12. The antibody of any one of ciaims 1-11, or an antigen binding fragment thereof, wherein the antibody or the antigen binding fragment comprises a Fc moiety.
13. The antibody or antigen binding fragment of claim 12, wherein the Fc moiety comprises a 30 mutation that enhances binding to FcRn as compared to a reference Fc moiety that does not comprise the mutation.
156
14. The antibody or antigen binding fragment of claim 12 or 13, wherein the Fc moiety comprises a mutation that enhances binding to a FcyR, preferably a FcyRIIA or FcyRIIIA as compared to a reference Fc moiety that does not comprise the mutation.
15. The antibody or antigen binding fragment of any one of claims 12-14, wherein the Fc moiety is an IgG isotype or is derived from an IgG isotype.
16. The antibody or antigen binding fragment of claim 15, wherein the IgG isotype is an IgGl 10 isotype.
17. The antibody or antigen binding fragment of any one of claims 13-16, wherein the mutation that enhances binding to FcRn comprises: M428L; N434S; N434H; N434A; N434S; M252Y; S254T; T256E; T250Q; P257I; Q311I; D376V; T307A; E380A; or any 15 combination thereof.
18. The antibody or antigen binding fragment of claim 17, wherein the mutation that enhances binding to FcRn comprises:
(i)
M428L/N434S;
20
(ii)
M252Y/S254T/T256E;
(iii)
T250Q/M428L;
(iv)
P257I/Q3111;
(v)
P257I/N434H;
(vi)
D376V/N434H;
25
(vii)
T307A/E380A/N434A; or (viii)
any combination of (i)-(vii).
19. The antibody or antigen binding fragment of any one of claims 14-18, wherein the mutation 30 that enhances binding to a FcyR comprises S239D; I332E; A330L; G236A; or any combination thereof.
157
20. The antibody or antigen binding fragment of claim 19, wherein the mutation that enhances binding to a FcyR comprises:
(i) S239D/I332E;
(ii) S239D/A330L/I332E;
(iii) G236A/S239D/I332E; or (iv) G236A/A330L/I332E.
21. The antibody or antigen binding fragment of claim 19 or 20, wherein the mutation that enhances binding to a FcyR comprises or consists of G236A/A330L/I332E, and optionally does not comprise S239D.
22. The antibody or antigen binding fragment of any one of claims 12-21, wherein the Fc moiety comprises the amino acid substitution mutations: M428L; N434S; G236A; A330L; and I332E, and optionally does not comprise S239D.
23. An isolated antibody, or an antigen binding fragment thereof, comprising:
(i) a heavy chain variable région (Vh) comprising the amino acid sequence according to SEQ ID NO:41; and (ii) a light chain variable région (Vl) comprising the amino acid sequence according to SEQ ID NO:89, wherein the antibody or antigen binding fragment thereof binds to the antigenic loop région of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
24. The isolated antibody or antigen binding fragment of claim 23, further comprising an Fc moiety.
25. The isolated antibody or antigen binding fragment of claim 24, wherein the Fc moiety is derived from an IgG isotype and comprises M428L and N434S substitution mutations.
158
26. The isolated antibody or antigen binding fragment of claim 24 or 25, wherein the Fc moiety is derived from an IgG isotype and comprises G236A, A330L, and I332E substitution mutations, and optionally does not comprise a S239D mutation.
27. The isolated antibody or antigen binding fragment of claim 26, wherein the Fc moiety comprises M428L, N434S, G236A, A330L, and I332E substitution mutations.
28. The antibody or antigen binding fragment of any one of ciaims 1-27, comprising the heavy chain (HC) amino acid sequence according to SEQ ID NO: 91 or 138.
29. The antibody or antigen binding fragment of any one of ciaims 1-25, comprising the heavy chain (HC) amino acid sequence according to SEQ ID NO: 92.
30. The antibody or antigen binding fragment of any one of ciaims 1-3, 6, 7, 9, 10, and 15-29, comprising the light chain (LC) amino acid sequence according to SEQ ID NO:93.
31. The antibody or antigen binding fragment of any one of ciaims 1, 2, 4, 6, and 8-22, comprising the light chain (LC) amino acid sequence according to SEQ ID NO:94.
32. The antibody or antigen binding fragment of claim 28 or 30, comprising:
(i) the HC amino acid sequence according to SEQ ID NO:91 and the LC amino acid sequence according to SEQ ID NO:93;
(ii) the HC amino acid sequence according to SEQ ID NO:92 and the LC amino acid sequence according to SEQ ID NO:94;
(iii) the HC amino acid sequence according to SEQ ID NO:91 and the LC amino acid sequence according to SEQ ID NO:94; or (iv) the HC amino acid sequence according to SEQ ID NO:92 and the LC amino acid sequence according to SEQ ID NO:93.
159
33. An isolated antibody, or an antigen binding fragment thereof, comprising:
(i) a heavy chain (HC) comprising the amino acid sequence according to SEQ ID NO:91; and (ii) a light chain (LC) comprising the amino acid sequence according to SEQ ID NO:93, wherein the antibody or antigen binding fragment thereof binds to the antigenic loop région of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
34. The antibody or antigen binding fragment of any one of claims 1-33, wherein the antibody or the antigen binding fragment is capable of binding an HBsAg of a génotype selected from the HBsAg génotypes A, B, C, D, E, F, G, H, I, and J, or any combination thereof.
35. The antibody or antigen binding fragment of any one of claims 1-34, wherein the antibody or antigen binding fragment is capable of reducing a sérum concentration of HBV DNA in a mammal having an HBV infection.
36. The antibody or antigen binding fragment of any one of claims 1-35, wherein the antibody or antigen binding fragment is capable of reducing a sérum concentration of HBsAg in a mammal having an HBV infection.
37. The antibody or antigen binding fragment of any one of claims 1-36, wherein the antibody or antigen binding fragment is capable of reducing a sérum concentration of HBeAg in a mammal having an HBV infection.
38. The antibody or antigen binding fragment of any one of claims 1 -37, wherein the antibody or antigen binding fragment is capable of reducing a sérum concentration of HBcrAg in a mammal having an HBV infection.
39. An isolated polynucleotide comprising a nucléotide sequence that encodes the antibody or the antigen binding fragment of any one of claims 1-38.
160
40. The polynucleotide of claim 39, wherein the nucléotide sequence that encodes the antibody or antigen binding fragment is codon optimized for expression in a host cell.
41. The polynucleotide of claim 39 or 40, comprising a nucléotide sequence having at least 80% identity to the nucléotide sequence according to any one of SEQ ID NOs: 103-105, 110, and 130-136.
42. The polynucleotide of claim 41, comprising a Vn-encoding nucléotide sequence according to SEQ ID NO: 103, and a Vt-encoding nucléotide sequence according to SEQ ID NO: 105.
43. The polynucleotide of claim 41, comprising a VH-encoding nucléotide sequence according to SEQ ID NO:103, and a Vt-encoding nucléotide sequence according to SEQ ID NO: 104.
44. A vector comprising the polynucleotide of any one of claims 39-43.
45. The vector of claim 44, wherein the vector comprises a lentiviral vector or a retroviral vector.
46. A host cell comprising a heterologous polynucleotide of any one of claims 39-43.
47. A pharmaceutical composition comprising:
(i) the antibody or antigen binding fragment of any one of claims 1-38;
(ii) the polynucleotide according to any one of claims 39-43;
(iii) the vector according to claim 44 or 45;
(iv) the host cell of claim 46; or (v) any combination of (i)-(iv).
48. The pharmaceutical composition according to claim 47, further comprising a pharmaceutically acceptable excipient, diluent or carrier.
161
49. A kit comprising:
(a) a component selected from:
(i) the antibody or antigen binding fragment of any one of claims 1-38;
(ii) the polynucleotide according to any one of claims 39-43;
(iii) the vector according to claim 44 or 45;
(iv) the host cell of claim 46;
(v) the pharmaceutical composition of claim 47 or 48; or (vi) any combination of (i)-(v); and (b) instructions for using the component to prevent, treat, attenuate, and/or diagnose a hepatitis B infection and/or a hepatitis D infection.
50. The composition of claim 47 or 48, or the kit of claim 49, further comprising:
(i) a polymerase inhibitor, wherein the polymerase inhibitor optionally comprises Lamivudine, Adefovir, Entecavir, Telbivudine, Tenofovir, or any combination thereof;
(ii) an interferon, wherein the interferon optionally comprises IFNbeta and/or IFNalpha;
(iii) a checkpoint inhibitor, wherein the checkpoint inhibitor optionally comprises an anti-PD-1 antibody or antigen binding fragment thereof, an anti-PD-Ll antibody or antigen binding fragment thereof, and/or an anti-CTLA4 antibody or antigen binding fragment thereof;
(iv) an agonist of a stimulatory immune checkpoint molécule; or (v) any combination of (i)-(iv).
51. The composition or kit of claim 50, wherein the polymerase inhibitor comprises lamivudine.
52. A method of producing the antibody or antigen binding fragment of any one of claims 13 8, comprising culturing the host cell of claim 46 under conditions and for a time sufficient to produce the antibody, or antigen binding fragment.
162
53. Use of: (i) the antibody or antigen binding fragment of any one of claims 1-38; (ii) the polynucleotide of any one of claims 39-43; (iii) the vector of claim 44 or 45; (iv) the host cell of claim 46 and/or (v) the pharmaceutical composition of claim 47 or 48, in the manufacture of a médicament to prevent, treat, attenuate, and/or diagnose a hepatitis B infection and/or a hepatitis D infection in a subject.
54. The use of claim 53, wherein the médicament is for administration to the subject with one or more of:
(vi) a polymerase inhibitor, wherein the polymerase inhibitor optionally comprises Lamivudine, Adefovir, Entecavir, Telbivudine, Tenofovir, or any combination thereof;
(vii) an interferon, wherein the interferon optionally comprises IFNbeta and/or IFNalpha; (viii) a checkpoint inhibitor, wherein the checkpoint inhibitor optionally comprises an antiPD-1 antibody or antigen binding fragment thereof, an anti-PD-Ll antibody or antigen binding fragment thereof, and/or an anti-CTLA4 antibody or antigen binding fragment thereof;
(ix) an agonist of a stimulatory immune checkpoint molécule; or (x) any combination of (vi)-(ix).
55. The use of claim 53 or 54, wherein the subject has a chronic hepatitis B infection; the subject has received a liver transplant; the subject is non-immunized against hepatitis B; the subject is a newbom; the subject is undergoing or has undergone hemodialysis; or any combination thereof.
56. A method for in vitro diagnosis of a hepatitis B and/or a hepatitis D infection, the method comprising:
(i) contacting a sample from a subject with an antibody or antigen-binding fragment of any one of claims 1-38; and (ii) detecting a complex comprising an antigen and the antibody, or comprising an antigen and the antigen binding fragment, or detecting a complex comprising an antigen and the fusion protein.
163
57. The method of claim 56, wherein the sample comprises blood isolated from the subject.
58. A method for detecting the presence or absence of an epitope in a correct conformation in an anti-hepatitis-B and/or an anti-hepatitis-D vaccine, the method comprising:
(i) contacting the vaccine with an antibody or antigen-binding fragment of any one of ciaims 1-38; and (ii) determining whether a complex comprising an antigen and the antibody, or comprising an antigen and the antigen binding fragment, or comprising an antigen and a fusion protein, has been formed.
59. An isolated antibody, or an antigen binding fragment thereof, comprising:
(i) a heavy chain variable région (Vh) comprising a CDRH1 amino acid sequence according to SEQ ID NO:34, a CDRH2 amino acid sequence according to SEQ ID NO:35 or 66, a CDRH3 amino acid sequence according to SEQ ID NO:36;
(ii) a light chain variable région (Vl) comprising a CDRL1 acid sequence according to SEQ ID NO:37, a CDRL2 acid sequence according to SEQ ID NO:38 or 39, and CDRL3 amino acid sequence according to SEQ ID NO:58 or 40; and (iii) a Fc moiety, wherein the Fc moiety comprises G236A/A330L/I332E.
60. The antibody or antigen binding fragment of claim 59, wherein the Fc moiety does not comprise S239D.
61. The antibody or antigen binding fragment of claim 59 or 60, wherein the Fc moiety further comprises M428L/N434S.
62. The antibody or antigen binding fragment of any one of ciaims 59-61, wherein the
Vh comprises or consists of the amino acid sequence according to any one of SEQ ID NOs:41 or 67 and wherein the Vl comprises or consists of the amino acid sequence according to any one of SEQ ID NOs:42, 59, 65, 89, 90, and 111-120.
164
63. The antibody or antigen binding fragment of any one of claims 1-38 and 59-62, wherein the antibody or antigen binding fragment:
(i) has enhanced binding to a human FcyRIIA, a human FcyRIIIA, or both, as compared to a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E, wherein the human FcyRIIA is optionally H131 or R131, and/or the human FcyRIIIA is optionally F158 or V158;
(ii) has reduced binding to a human FcyRIIB, as compared to a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E;
(iii) does not bind to a human FcyRIIB;
(iv) has reduced binding to a human Clq, as compared to a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E;
(v) does not bind to a human Clq;
(vi) activâtes a FcyRIIA, a human FcyRIIIA, or both, to a greater degree than does a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E, wherein the human FcyRIIA is optionally H131 or R131, and/or the human FcyRIIIA is optionally F158orV158;
(vii) does not activate a human FcyRIIB;
(viii) activâtes a human natural killer (NK) cell in the presence of HBsAg to a greater degree than does a reference polypeptide that includes a Fc moiety that does not comprise G236A/A330L/I332E, wherein the reference polypeptide is optionally an antibody that binds to an HB Ag, optionally an HBsAg;
(ix) has an HBsAg EC50 of from about 12.75 ng/mL to about 19.9 ng/mL, or from about 12.75 ng/mL to about 12.84 ng/mL, or about 12.79 ng/mL, or from about 16.22 ng/mL to about 19.9 ng/mL, or about 17.97 ng/mL, and/or (b) has an HBeAg ECso about from about 10.78 ng/mL to about 13.72 ng/mL, or from about 10.78 ng/mL to about 10.93 ng/mL, or about 10.85 ng/mL, or from about 11.59 ng/mL to about 13.72 ng/mL, or about 12.61 ng/mL, wherein the HBV is optionally HBV Génotype D, and wherein the EC50 is optionally determined in vitro by measuring HBsAg or HBeAg, respectively, secreted by HepG2 cells overexpressing NTCP and infected with the HBV, at day 7 following administration of the antibody or antigen binding fragment to the HepG2 cells;
165 (x) has an HBsAg EC5o of from about 10.43 ng/mL to about 22.41 ng/mL, or about 13.81 ng/mL to about 16.56 ng/mL, or about 15.12 ng/mL, or from about 12.24 ng/mL to about 22.41 ng/mL, or about 16.56 ng/mL, or from about 10.43 ng/mL to about 20.08 ng/mL, or about 14.47 ng/mL, nand/or (b) has an HBeAg ECso about from about 10.39 ng/mL to about 13.99 ng/mL, or from about 10.63 ng/mL to about 10.66 ng/mL, or about 10.64 ng/mL, or from about 10.39 ng/mL to about 10.60 ng/mL, or about 10.49 ng/mL, or from about 13.25 ng/mL to about 13.99 ng/mL, or about 13.61 ng/mL, wherein the HBV is optionally HBV Génotype D, and wherein the EC50 is optionally determined in vitro by measuring HBsAg or HBeAg, respectively, secreted by HepG2 cells overexpressing NTCP and infected with the HBV, at day 7 following administration of the antibody or antigen binding fragment to the HepG2 cells;
(xi) is capable of binding to an HBsAg variant comprising HBsAg-Y100C/P120T,
HBsAg-P120T, HBsAg-P120S/S143L, HBsAg-C121S, HBsAg-R122D, HBsAgR122I, HBsAg-T123N, HBsAg-Q129H, HBsAg-Q129L, HBsAg-M133H, HBsAg-M133L, HBsAg-M133T, HBsAg-K141E, HBsAg-P142S, HBsAgS143K, HBsAg-D144A, HBsAg-G145R, HBsAg-N146A, or any combination thereof;
(xii) has improved binding to an HBsAg variant comprising HBsAg-Y100C/P120T, HBsAg-P120T, HBsAg-P120S/S143L, HBsAg-C121S, HBsAg-R122D, HBsAgR122I, HBsAg-T123N, HBsAg-Q129H, HBsAg-Q129L, HBsAg-M133H, HBsAg-M133L, HBsAg-M133T, HBsAg-K141E, HBsAg-P142S, HBsAgS143K, HBsAg-D144A, HBsAg-G145R, HBsAg-N146A, or any combination thereof, as compared to a reference antibody or antigen binding fragment that binds to HBsAg and that includes a Fc moiety that does not comprise G236A/A330L/I332E; and/or (xiii) is capable of neutralizing (a) an HBV of génotype A with an EC50 of about 2.34 ng/mL; (b) an HBV of génotype B with an EC50 of about 2.22 ng/mL; (c) an HBV of génotype C with an EC50 of about 0.92 ng/mL; (d) an HBV of génotype D with an EC50 of about 1.10 ng/mL; (e) an HBV of génotype E with an EC50 of about 1.12 ng/mL; (f) an HBV of génotype F with an EC50 of about 1.93 ng/mL; (g) an
166
HBV of génotype G with an ECso of about 1.43 ng/mL; and/or (h) an HBV of génotype H with an EC50 of about 1.93 ng/mL, wherein the EC50 is optionally determined using a recombinant HDV engineered to express an HBsAg ofthe HBV génotype.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US62/782,274 | 2018-12-19 | ||
US62/860,085 | 2019-06-11 |
Publications (1)
Publication Number | Publication Date |
---|---|
OA20238A true OA20238A (en) | 2022-03-18 |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP3898668B1 (en) | Antibodies that neutralize hepatitis b virus and uses thereof | |
US11479599B2 (en) | Antibodies against SARS-CoV-2 and methods of using the same | |
IL297997A (en) | Cd20 binding molecules and uses thereof | |
CA3177169A1 (en) | Antibodies against sars-cov-2 | |
US20240059757A1 (en) | Antibodies against sars-cov-2 and methods of using the same | |
AU2015367224B2 (en) | IL-21 antibodies | |
CA3194162A1 (en) | Antibodies against sars-cov-2 | |
US20220380441A1 (en) | Antibody compositions and methods for treating hepatitis b virus infection | |
US20240092872A1 (en) | Compositions and methods for treating hepatitis b virus infection | |
TW202204395A (en) | Antibodies against sars-cov-2 and methods of using the same | |
OA20238A (en) | Antibodies that neutralize hepatitis B virus and uses thereof. | |
TW202200615A (en) | Method for treatment and prophylaxis of crs in patients | |
TW202411246A (en) | Engineered hepatitis b virus neutralizing antibodies and uses thereof | |
WO2023230439A1 (en) | Fc-engineered hepatitis b virus neutralizing antibodies and uses thereof | |
WO2022204202A1 (en) | Antibodies that bind to multiple sarbecoviruses |