WO2021016347A1 - Compositions and methods for treating skin infections and other diseases - Google Patents
Compositions and methods for treating skin infections and other diseases Download PDFInfo
- Publication number
- WO2021016347A1 WO2021016347A1 PCT/US2020/043061 US2020043061W WO2021016347A1 WO 2021016347 A1 WO2021016347 A1 WO 2021016347A1 US 2020043061 W US2020043061 W US 2020043061W WO 2021016347 A1 WO2021016347 A1 WO 2021016347A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- acnes
- composition
- subject
- propionibacterium
- bacteria
- Prior art date
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 177
- 238000000034 method Methods 0.000 title claims abstract description 95
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 title claims description 31
- 201000010099 disease Diseases 0.000 title claims description 30
- 206010040872 skin infection Diseases 0.000 title 1
- 241000186427 Cutibacterium acnes Species 0.000 claims description 106
- 239000003795 chemical substances by application Substances 0.000 claims description 80
- 241000186429 Propionibacterium Species 0.000 claims description 62
- 241000192125 Firmicutes Species 0.000 claims description 61
- 241001464974 Cutibacterium avidum Species 0.000 claims description 57
- 150000001413 amino acids Chemical group 0.000 claims description 45
- 208000002874 Acne Vulgaris Diseases 0.000 claims description 31
- 206010000496 acne Diseases 0.000 claims description 31
- 208000017520 skin disease Diseases 0.000 claims description 28
- 241001505901 Streptococcus sp. 'group A' Species 0.000 claims description 19
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 claims description 18
- 241001659030 [Propionibacterium] humerusii Species 0.000 claims description 18
- 239000008194 pharmaceutical composition Substances 0.000 claims description 17
- 241000194033 Enterococcus Species 0.000 claims description 16
- 208000015181 infectious disease Diseases 0.000 claims description 15
- 241001464975 Cutibacterium granulosum Species 0.000 claims description 14
- 239000003242 anti bacterial agent Substances 0.000 claims description 12
- 230000003115 biocidal effect Effects 0.000 claims description 12
- 206010061218 Inflammation Diseases 0.000 claims description 11
- 230000004054 inflammatory process Effects 0.000 claims description 11
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 claims description 11
- 241000194017 Streptococcus Species 0.000 claims description 10
- 241000193163 Clostridioides difficile Species 0.000 claims description 9
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 claims description 9
- 201000004681 Psoriasis Diseases 0.000 claims description 9
- 241000191967 Staphylococcus aureus Species 0.000 claims description 9
- 108010059993 Vancomycin Proteins 0.000 claims description 9
- 229910052742 iron Inorganic materials 0.000 claims description 9
- 229960003085 meticillin Drugs 0.000 claims description 9
- 229960003165 vancomycin Drugs 0.000 claims description 9
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 claims description 9
- 241000191940 Staphylococcus Species 0.000 claims description 8
- 230000000699 topical effect Effects 0.000 claims description 8
- 206010012438 Dermatitis atopic Diseases 0.000 claims description 6
- 201000008937 atopic dermatitis Diseases 0.000 claims description 6
- 229940055009 propionibacterium avidum Drugs 0.000 claims description 4
- 239000006228 supernatant Substances 0.000 claims description 4
- 230000001737 promoting effect Effects 0.000 abstract description 3
- 230000036559 skin health Effects 0.000 abstract description 3
- 241000894006 Bacteria Species 0.000 description 70
- 108010062877 Bacteriocins Proteins 0.000 description 67
- 230000001580 bacterial effect Effects 0.000 description 38
- 150000007523 nucleic acids Chemical group 0.000 description 35
- 108090000623 proteins and genes Proteins 0.000 description 35
- 108091028043 Nucleic acid sequence Proteins 0.000 description 26
- -1 cefmetzole Chemical compound 0.000 description 26
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 19
- 241000894007 species Species 0.000 description 19
- 108090000765 processed proteins & peptides Proteins 0.000 description 18
- 235000001014 amino acid Nutrition 0.000 description 14
- 238000009472 formulation Methods 0.000 description 14
- 201000010273 Porphyria Cutanea Tarda Diseases 0.000 description 13
- 206010036186 Porphyria non-acute Diseases 0.000 description 13
- 108020004707 nucleic acids Proteins 0.000 description 13
- 102000039446 nucleic acids Human genes 0.000 description 13
- 238000011282 treatment Methods 0.000 description 13
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 12
- 210000004027 cell Anatomy 0.000 description 12
- 230000012010 growth Effects 0.000 description 12
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 11
- 235000019441 ethanol Nutrition 0.000 description 11
- 102000004169 proteins and genes Human genes 0.000 description 11
- 150000001875 compounds Chemical class 0.000 description 10
- 230000036074 healthy skin Effects 0.000 description 10
- 235000018102 proteins Nutrition 0.000 description 10
- 238000004458 analytical method Methods 0.000 description 9
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 9
- 239000003995 emulsifying agent Substances 0.000 description 9
- 108091008053 gene clusters Proteins 0.000 description 9
- 201000004624 Dermatitis Diseases 0.000 description 8
- 241000301150 Propionibacterium acnes HL030PA2 Species 0.000 description 8
- 238000011529 RT qPCR Methods 0.000 description 8
- 239000010941 cobalt Substances 0.000 description 8
- 229910017052 cobalt Inorganic materials 0.000 description 8
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 8
- 239000003814 drug Substances 0.000 description 8
- 210000001035 gastrointestinal tract Anatomy 0.000 description 8
- 230000005764 inhibitory process Effects 0.000 description 8
- 150000004032 porphyrins Chemical class 0.000 description 8
- 150000003839 salts Chemical class 0.000 description 8
- 239000003981 vehicle Substances 0.000 description 8
- 108010072039 Histidine kinase Proteins 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 239000000839 emulsion Substances 0.000 description 7
- 150000002148 esters Chemical class 0.000 description 7
- 235000011187 glycerol Nutrition 0.000 description 7
- 230000000813 microbial effect Effects 0.000 description 7
- 230000004048 modification Effects 0.000 description 7
- 238000012986 modification Methods 0.000 description 7
- 230000001105 regulatory effect Effects 0.000 description 7
- 201000004700 rosacea Diseases 0.000 description 7
- 208000024891 symptom Diseases 0.000 description 7
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 7
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- 239000003963 antioxidant agent Substances 0.000 description 6
- 235000006708 antioxidants Nutrition 0.000 description 6
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 6
- 239000002537 cosmetic Substances 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 239000003974 emollient agent Substances 0.000 description 6
- 230000014509 gene expression Effects 0.000 description 6
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 6
- VVOAZFWZEDHOOU-UHFFFAOYSA-N honokiol Natural products OC1=CC=C(CC=C)C=C1C1=CC(CC=C)=CC=C1O VVOAZFWZEDHOOU-UHFFFAOYSA-N 0.000 description 6
- 150000002632 lipids Chemical class 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- 229920001223 polyethylene glycol Polymers 0.000 description 6
- 229940124597 therapeutic agent Drugs 0.000 description 6
- 229940088594 vitamin Drugs 0.000 description 6
- 235000013343 vitamin Nutrition 0.000 description 6
- 239000011782 vitamin Substances 0.000 description 6
- 229930003231 vitamin Natural products 0.000 description 6
- 241000203809 Actinomycetales Species 0.000 description 5
- LZZYPRNAOMGNLH-UHFFFAOYSA-M Cetrimonium bromide Chemical compound [Br-].CCCCCCCCCCCCCCCC[N+](C)(C)C LZZYPRNAOMGNLH-UHFFFAOYSA-M 0.000 description 5
- 239000004909 Moisturizer Substances 0.000 description 5
- 230000000845 anti-microbial effect Effects 0.000 description 5
- 238000003556 assay Methods 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 238000003501 co-culture Methods 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 230000001333 moisturizer Effects 0.000 description 5
- 230000036961 partial effect Effects 0.000 description 5
- 244000052769 pathogen Species 0.000 description 5
- 239000003755 preservative agent Substances 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 229940055019 propionibacterium acne Drugs 0.000 description 5
- 230000009759 skin aging Effects 0.000 description 5
- 239000002904 solvent Substances 0.000 description 5
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 4
- 239000004166 Lanolin Substances 0.000 description 4
- POJWUDADGALRAB-UHFFFAOYSA-N allantoin Chemical compound NC(=O)NC1NC(=O)NC1=O POJWUDADGALRAB-UHFFFAOYSA-N 0.000 description 4
- 239000003443 antiviral agent Substances 0.000 description 4
- 229940008099 dimethicone Drugs 0.000 description 4
- 239000004205 dimethyl polysiloxane Substances 0.000 description 4
- 235000013870 dimethyl polysiloxane Nutrition 0.000 description 4
- 239000000284 extract Substances 0.000 description 4
- 230000036541 health Effects 0.000 description 4
- 239000004615 ingredient Substances 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 235000019388 lanolin Nutrition 0.000 description 4
- 229940039717 lanolin Drugs 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 238000002844 melting Methods 0.000 description 4
- 230000008018 melting Effects 0.000 description 4
- DWPCPZJAHOETAG-UHFFFAOYSA-N meso-lanthionine Natural products OC(=O)C(N)CSCC(N)C(O)=O DWPCPZJAHOETAG-UHFFFAOYSA-N 0.000 description 4
- 244000005700 microbiome Species 0.000 description 4
- 210000000056 organ Anatomy 0.000 description 4
- 230000001717 pathogenic effect Effects 0.000 description 4
- 229920000435 poly(dimethylsiloxane) Polymers 0.000 description 4
- 229940002612 prodrug Drugs 0.000 description 4
- 239000000651 prodrug Substances 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 239000004094 surface-active agent Substances 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 3
- NLMKTBGFQGKQEV-UHFFFAOYSA-N 2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-hexadecoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethanol Chemical compound CCCCCCCCCCCCCCCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO NLMKTBGFQGKQEV-UHFFFAOYSA-N 0.000 description 3
- 229920001817 Agar Polymers 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- BXZVVICBKDXVGW-NKWVEPMBSA-N Didanosine Chemical compound O1[C@H](CO)CC[C@@H]1N1C(NC=NC2=O)=C2N=C1 BXZVVICBKDXVGW-NKWVEPMBSA-N 0.000 description 3
- 108700039887 Essential Genes Proteins 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- ATGQXSBKTQANOH-UWVGARPKSA-N N-oleoylphytosphingosine Chemical compound CCCCCCCCCCCCCC[C@@H](O)[C@@H](O)[C@H](CO)NC(=O)CCCCCCC\C=C/CCCCCCCC ATGQXSBKTQANOH-UWVGARPKSA-N 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- 241000300848 Propionibacterium acnes HL086PA1 Species 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 239000008272 agar Substances 0.000 description 3
- 150000001298 alcohols Chemical class 0.000 description 3
- 235000011399 aloe vera Nutrition 0.000 description 3
- 230000033228 biological regulation Effects 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 229940099417 ceramide 2 Drugs 0.000 description 3
- 229940044176 ceramide 3 Drugs 0.000 description 3
- 229940056318 ceteth-20 Drugs 0.000 description 3
- 229960000541 cetyl alcohol Drugs 0.000 description 3
- 229940107161 cholesterol Drugs 0.000 description 3
- 235000012000 cholesterol Nutrition 0.000 description 3
- 239000000470 constituent Substances 0.000 description 3
- RNPXCFINMKSQPQ-UHFFFAOYSA-N dicetyl hydrogen phosphate Chemical compound CCCCCCCCCCCCCCCCOP(O)(=O)OCCCCCCCCCCCCCCCC RNPXCFINMKSQPQ-UHFFFAOYSA-N 0.000 description 3
- 229960002656 didanosine Drugs 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 230000036039 immunity Effects 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 3
- 239000003960 organic solvent Substances 0.000 description 3
- 235000019271 petrolatum Nutrition 0.000 description 3
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 3
- 239000010452 phosphate Substances 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 230000000770 proinflammatory effect Effects 0.000 description 3
- 239000000516 sunscreening agent Substances 0.000 description 3
- 210000001635 urinary tract Anatomy 0.000 description 3
- 150000003722 vitamin derivatives Chemical class 0.000 description 3
- ALSTYHKOOCGGFT-KTKRTIGZSA-N (9Z)-octadecen-1-ol Chemical compound CCCCCCCC\C=C/CCCCCCCCO ALSTYHKOOCGGFT-KTKRTIGZSA-N 0.000 description 2
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 2
- WNWHHMBRJJOGFJ-UHFFFAOYSA-N 16-methylheptadecan-1-ol Chemical compound CC(C)CCCCCCCCCCCCCCCO WNWHHMBRJJOGFJ-UHFFFAOYSA-N 0.000 description 2
- MPDGHEJMBKOTSU-YKLVYJNSSA-N 18beta-glycyrrhetic acid Chemical compound C([C@H]1C2=CC(=O)[C@H]34)[C@@](C)(C(O)=O)CC[C@]1(C)CC[C@@]2(C)[C@]4(C)CC[C@@H]1[C@]3(C)CC[C@H](O)C1(C)C MPDGHEJMBKOTSU-YKLVYJNSSA-N 0.000 description 2
- FLPJVCMIKUWSDR-UHFFFAOYSA-N 2-(4-formylphenoxy)acetamide Chemical compound NC(=O)COC1=CC=C(C=O)C=C1 FLPJVCMIKUWSDR-UHFFFAOYSA-N 0.000 description 2
- OKQHSIGMOWQUIK-UHFFFAOYSA-N 2-[(2-aminopurin-9-yl)methoxy]ethanol Chemical compound NC1=NC=C2N=CN(COCCO)C2=N1 OKQHSIGMOWQUIK-UHFFFAOYSA-N 0.000 description 2
- WRMNZCZEMHIOCP-UHFFFAOYSA-N 2-phenylethanol Chemical compound OCCC1=CC=CC=C1 WRMNZCZEMHIOCP-UHFFFAOYSA-N 0.000 description 2
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 2
- ALYNCZNDIQEVRV-UHFFFAOYSA-N 4-aminobenzoic acid Chemical compound NC1=CC=C(C(O)=O)C=C1 ALYNCZNDIQEVRV-UHFFFAOYSA-N 0.000 description 2
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 2
- 108010006533 ATP-Binding Cassette Transporters Proteins 0.000 description 2
- 102000005416 ATP-Binding Cassette Transporters Human genes 0.000 description 2
- POJWUDADGALRAB-PVQJCKRUSA-N Allantoin Natural products NC(=O)N[C@@H]1NC(=O)NC1=O POJWUDADGALRAB-PVQJCKRUSA-N 0.000 description 2
- 241001116389 Aloe Species 0.000 description 2
- 244000063299 Bacillus subtilis Species 0.000 description 2
- 235000014469 Bacillus subtilis Nutrition 0.000 description 2
- LFYJSSARVMHQJB-UHFFFAOYSA-N Backuchiol Natural products CC(C)=CCCC(C)(C=C)C=CC1=CC=C(O)C=C1 LFYJSSARVMHQJB-UHFFFAOYSA-N 0.000 description 2
- XMSXQFUHVRWGNA-UHFFFAOYSA-N Decamethylcyclopentasiloxane Chemical compound C[Si]1(C)O[Si](C)(C)O[Si](C)(C)O[Si](C)(C)O[Si](C)(C)O1 XMSXQFUHVRWGNA-UHFFFAOYSA-N 0.000 description 2
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- BYTORXDZJWWIKR-UHFFFAOYSA-N Hinokiol Natural products CC(C)c1cc2CCC3C(C)(CO)C(O)CCC3(C)c2cc1O BYTORXDZJWWIKR-UHFFFAOYSA-N 0.000 description 2
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 2
- PWKSKIMOESPYIA-BYPYZUCNSA-N L-N-acetyl-Cysteine Chemical compound CC(=O)N[C@@H](CS)C(O)=O PWKSKIMOESPYIA-BYPYZUCNSA-N 0.000 description 2
- DWPCPZJAHOETAG-IMJSIDKUSA-N L-lanthionine Chemical compound OC(=O)[C@@H](N)CSC[C@H](N)C(O)=O DWPCPZJAHOETAG-IMJSIDKUSA-N 0.000 description 2
- 241001673966 Magnolia officinalis Species 0.000 description 2
- 238000007476 Maximum Likelihood Methods 0.000 description 2
- 241000736262 Microbiota Species 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- LRHPLDYGYMQRHN-UHFFFAOYSA-N N-Butanol Chemical compound CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 2
- 239000005642 Oleic acid Substances 0.000 description 2
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 2
- WVXOAWPSZWSWDX-UHFFFAOYSA-K P(=O)(=O)C(=O)[O-].[Na+].[Na+].[Na+].P(=O)(=O)C(=O)[O-].P(=O)(=O)C(=O)[O-] Chemical compound P(=O)(=O)C(=O)[O-].[Na+].[Na+].[Na+].P(=O)(=O)C(=O)[O-].P(=O)(=O)C(=O)[O-] WVXOAWPSZWSWDX-UHFFFAOYSA-K 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 239000004264 Petrolatum Substances 0.000 description 2
- 229920002675 Polyoxyl Polymers 0.000 description 2
- 229920001214 Polysorbate 60 Polymers 0.000 description 2
- 241000301178 Propionibacterium acnes HL056PA1 Species 0.000 description 2
- 241000300919 Propionibacterium acnes HL110PA3 Species 0.000 description 2
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 description 2
- REFJWTPEDVJJIY-UHFFFAOYSA-N Quercetin Chemical compound C=1C(O)=CC(O)=C(C(C=2O)=O)C=1OC=2C1=CC=C(O)C(O)=C1 REFJWTPEDVJJIY-UHFFFAOYSA-N 0.000 description 2
- 108700005075 Regulator Genes Proteins 0.000 description 2
- 241001303601 Rosacea Species 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 2
- 241000191963 Staphylococcus epidermidis Species 0.000 description 2
- XNKLLVCARDGLGL-JGVFFNPUSA-N Stavudine Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1C=C[C@@H](CO)O1 XNKLLVCARDGLGL-JGVFFNPUSA-N 0.000 description 2
- 235000021355 Stearic acid Nutrition 0.000 description 2
- GWEVSGVZZGPLCZ-UHFFFAOYSA-N Titan oxide Chemical compound O=[Ti]=O GWEVSGVZZGPLCZ-UHFFFAOYSA-N 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- WREGKURFCTUGRC-POYBYMJQSA-N Zalcitabine Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](CO)CC1 WREGKURFCTUGRC-POYBYMJQSA-N 0.000 description 2
- XLOMVQKBTHCTTD-UHFFFAOYSA-N Zinc monoxide Chemical compound [Zn]=O XLOMVQKBTHCTTD-UHFFFAOYSA-N 0.000 description 2
- 229960004150 aciclovir Drugs 0.000 description 2
- MKUXAQIIEYXACX-UHFFFAOYSA-N aciclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCO)C=N2 MKUXAQIIEYXACX-UHFFFAOYSA-N 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 229960000458 allantoin Drugs 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 230000003078 antioxidant effect Effects 0.000 description 2
- DFYRUELUNQRZTB-UHFFFAOYSA-N apocynin Chemical compound COC1=CC(C(C)=O)=CC=C1O DFYRUELUNQRZTB-UHFFFAOYSA-N 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- LFYJSSARVMHQJB-GOSISDBHSA-N bakuchinol Natural products CC(C)=CCC[C@@](C)(C=C)C=CC1=CC=C(O)C=C1 LFYJSSARVMHQJB-GOSISDBHSA-N 0.000 description 2
- LFYJSSARVMHQJB-QIXNEVBVSA-N bakuchiol Chemical compound CC(C)=CCC[C@@](C)(C=C)\C=C\C1=CC=C(O)C=C1 LFYJSSARVMHQJB-QIXNEVBVSA-N 0.000 description 2
- 229940117895 bakuchiol Drugs 0.000 description 2
- KXXXNMZPAJTCQY-UHFFFAOYSA-N bakuchiol Natural products CC(C)CCCC(C)(C=C)C=Cc1ccc(O)cc1 KXXXNMZPAJTCQY-UHFFFAOYSA-N 0.000 description 2
- LWQQLNNNIPYSNX-UROSTWAQSA-N calcipotriol Chemical compound C1([C@H](O)/C=C/[C@@H](C)[C@@H]2[C@]3(CCCC(/[C@@H]3CC2)=C\C=C\2C([C@@H](O)C[C@H](O)C/2)=C)C)CC1 LWQQLNNNIPYSNX-UROSTWAQSA-N 0.000 description 2
- 229960002882 calcipotriol Drugs 0.000 description 2
- 235000013877 carbamide Nutrition 0.000 description 2
- 210000002421 cell wall Anatomy 0.000 description 2
- 229940106189 ceramide Drugs 0.000 description 2
- 150000001783 ceramides Chemical class 0.000 description 2
- 229940081733 cetearyl alcohol Drugs 0.000 description 2
- 229940074979 cetyl palmitate Drugs 0.000 description 2
- 229940119217 chamomile extract Drugs 0.000 description 2
- 235000020221 chamomile extract Nutrition 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- RTIXKCRFFJGDFG-UHFFFAOYSA-N chrysin Chemical compound C=1C(O)=CC(O)=C(C(C=2)=O)C=1OC=2C1=CC=CC=C1 RTIXKCRFFJGDFG-UHFFFAOYSA-N 0.000 description 2
- 239000001926 citrus aurantium l. subsp. bergamia wright et arn. oil Substances 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 230000003750 conditioning effect Effects 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- CVSVTCORWBXHQV-UHFFFAOYSA-N creatine Chemical compound NC(=[NH2+])N(C)CC([O-])=O CVSVTCORWBXHQV-UHFFFAOYSA-N 0.000 description 2
- 229940086555 cyclomethicone Drugs 0.000 description 2
- WHBIGIKBNXZKFE-UHFFFAOYSA-N delavirdine Chemical compound CC(C)NC1=CC=CN=C1N1CCN(C(=O)C=2NC3=CC=C(NS(C)(=O)=O)C=C3C=2)CC1 WHBIGIKBNXZKFE-UHFFFAOYSA-N 0.000 description 2
- 229940093541 dicetylphosphate Drugs 0.000 description 2
- MTHSVFCYNBDYFN-UHFFFAOYSA-N diethylene glycol Chemical compound OCCOCCO MTHSVFCYNBDYFN-UHFFFAOYSA-N 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- OSVXSBDYLRYLIG-UHFFFAOYSA-N dioxidochlorine(.) Chemical compound O=Cl=O OSVXSBDYLRYLIG-UHFFFAOYSA-N 0.000 description 2
- SYELZBGXAIXKHU-UHFFFAOYSA-N dodecyldimethylamine N-oxide Chemical compound CCCCCCCCCCCC[N+](C)(C)[O-] SYELZBGXAIXKHU-UHFFFAOYSA-N 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000003205 fragrance Substances 0.000 description 2
- 229960002963 ganciclovir Drugs 0.000 description 2
- IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 150000002334 glycols Chemical class 0.000 description 2
- UBHWBODXJBSFLH-UHFFFAOYSA-N hexadecan-1-ol;octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO.CCCCCCCCCCCCCCCCCCO UBHWBODXJBSFLH-UHFFFAOYSA-N 0.000 description 2
- PXDJXZJSCPSGGI-UHFFFAOYSA-N hexadecanoic acid hexadecyl ester Natural products CCCCCCCCCCCCCCCCOC(=O)CCCCCCCCCCCCCCC PXDJXZJSCPSGGI-UHFFFAOYSA-N 0.000 description 2
- FVYXIJYOAGAUQK-UHFFFAOYSA-N honokiol Chemical compound C1=C(CC=C)C(O)=CC=C1C1=CC(CC=C)=CC=C1O FVYXIJYOAGAUQK-UHFFFAOYSA-N 0.000 description 2
- 239000003906 humectant Substances 0.000 description 2
- 229960004716 idoxuridine Drugs 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 2
- MWDZOUNAPSSOEL-UHFFFAOYSA-N kaempferol Natural products OC1=C(C(=O)c2cc(O)cc(O)c2O1)c3ccc(O)cc3 MWDZOUNAPSSOEL-UHFFFAOYSA-N 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 2
- 244000005706 microflora Species 0.000 description 2
- 239000002480 mineral oil Substances 0.000 description 2
- 235000010446 mineral oil Nutrition 0.000 description 2
- JRKSTJIPGYBLNV-UHFFFAOYSA-N n-[3-[dodecanoyl(2-hydroxyethyl)amino]-2-hydroxypropyl]-n-(2-hydroxyethyl)dodecanamide Chemical compound CCCCCCCCCCCC(=O)N(CCO)CC(O)CN(CCO)C(=O)CCCCCCCCCCC JRKSTJIPGYBLNV-UHFFFAOYSA-N 0.000 description 2
- PDRAHDYJNDYBNK-UHFFFAOYSA-N n-[3-[hexadecanoyl(2-hydroxyethyl)amino]-2-hydroxypropyl]-n-(2-hydroxyethyl)hexadecanamide Chemical compound CCCCCCCCCCCCCCCC(=O)N(CCO)CC(O)CN(CCO)C(=O)CCCCCCCCCCCCCCC PDRAHDYJNDYBNK-UHFFFAOYSA-N 0.000 description 2
- NQDJXKOVJZTUJA-UHFFFAOYSA-N nevirapine Chemical compound C12=NC=CC=C2C(=O)NC=2C(C)=CC=NC=2N1C1CC1 NQDJXKOVJZTUJA-UHFFFAOYSA-N 0.000 description 2
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 2
- 229960002969 oleic acid Drugs 0.000 description 2
- 229940055577 oleyl alcohol Drugs 0.000 description 2
- XMLQWXUVTXCDDL-UHFFFAOYSA-N oleyl alcohol Natural products CCCCCCC=CCCCCCCCCCCO XMLQWXUVTXCDDL-UHFFFAOYSA-N 0.000 description 2
- 125000001312 palmitoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 229940100460 peg-100 stearate Drugs 0.000 description 2
- 229940066842 petrolatum Drugs 0.000 description 2
- 239000006041 probiotic Substances 0.000 description 2
- 230000000529 probiotic effect Effects 0.000 description 2
- 235000018291 probiotics Nutrition 0.000 description 2
- BDERNNFJNOPAEC-UHFFFAOYSA-N propan-1-ol Chemical class CCCO BDERNNFJNOPAEC-UHFFFAOYSA-N 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 2
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 2
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N squalane Chemical compound CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 2
- 229960004274 stearic acid Drugs 0.000 description 2
- 239000008117 stearic acid Substances 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 230000000475 sunscreen effect Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 239000012049 topical pharmaceutical composition Substances 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- VSQQQLOSPVPRAZ-RRKCRQDMSA-N trifluridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(C(F)(F)F)=C1 VSQQQLOSPVPRAZ-RRKCRQDMSA-N 0.000 description 2
- 229960003962 trifluridine Drugs 0.000 description 2
- 239000004034 viscosity adjusting agent Substances 0.000 description 2
- 235000019166 vitamin D Nutrition 0.000 description 2
- 239000011710 vitamin D Substances 0.000 description 2
- 230000037303 wrinkles Effects 0.000 description 2
- 229960000523 zalcitabine Drugs 0.000 description 2
- 239000011787 zinc oxide Substances 0.000 description 2
- 235000014692 zinc oxide Nutrition 0.000 description 2
- WTVHAMTYZJGJLJ-UHFFFAOYSA-N (+)-(4S,8R)-8-epi-beta-bisabolol Natural products CC(C)=CCCC(C)C1(O)CCC(C)=CC1 WTVHAMTYZJGJLJ-UHFFFAOYSA-N 0.000 description 1
- AYIRNRDRBQJXIF-NXEZZACHSA-N (-)-Florfenicol Chemical compound CS(=O)(=O)C1=CC=C([C@@H](O)[C@@H](CF)NC(=O)C(Cl)Cl)C=C1 AYIRNRDRBQJXIF-NXEZZACHSA-N 0.000 description 1
- RGZSQWQPBWRIAQ-CABCVRRESA-N (-)-alpha-Bisabolol Chemical compound CC(C)=CCC[C@](C)(O)[C@H]1CCC(C)=CC1 RGZSQWQPBWRIAQ-CABCVRRESA-N 0.000 description 1
- HEOCBCNFKCOKBX-RELGSGGGSA-N (1s,2e,4r)-4,7,7-trimethyl-2-[(4-methylphenyl)methylidene]bicyclo[2.2.1]heptan-3-one Chemical compound C1=CC(C)=CC=C1\C=C/1C(=O)[C@]2(C)CC[C@H]\1C2(C)C HEOCBCNFKCOKBX-RELGSGGGSA-N 0.000 description 1
- XMAYWYJOQHXEEK-OZXSUGGESA-N (2R,4S)-ketoconazole Chemical compound C1CN(C(=O)C)CCN1C(C=C1)=CC=C1OC[C@@H]1O[C@@](CN2C=NC=C2)(C=2C(=CC(Cl)=CC=2)Cl)OC1 XMAYWYJOQHXEEK-OZXSUGGESA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- HBJOXQRURQPDEX-MHXMMLMNSA-N (2s,4r)-n-[(1s,2s)-2-chloro-1-[(2r,3r,4s,5r,6r)-3,4,5-trihydroxy-6-methylsulfanyloxan-2-yl]propyl]-4-ethylpiperidine-2-carboxamide Chemical compound C1[C@H](CC)CCN[C@@H]1C(=O)N[C@H]([C@H](C)Cl)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 HBJOXQRURQPDEX-MHXMMLMNSA-N 0.000 description 1
- JETQIUPBHQNHNZ-NJBDSQKTSA-N (2s,5r,6r)-3,3-dimethyl-7-oxo-6-[[(2r)-2-phenyl-2-sulfoacetyl]amino]-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid Chemical compound C1([C@H](C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)S(O)(=O)=O)=CC=CC=C1 JETQIUPBHQNHNZ-NJBDSQKTSA-N 0.000 description 1
- GRRNUXAQVGOGFE-SVNOMHMPSA-N (3'r,3as,4s,4's,5'r,6r,6'r,7s,7as)-4-[(1s,2r,3s,5r,6s)-3-amino-2,6-dihydroxy-5-(methylamino)cyclohexyl]oxy-6'-[(1s)-1-amino-2-hydroxyethyl]-6-(hydroxymethyl)spiro[4,6,7,7a-tetrahydro-3ah-[1,3]dioxolo[4,5-c]pyran-2,2'-oxane]-3',4',5',7-tetrol Chemical compound O[C@H]1[C@H](NC)C[C@H](N)[C@@H](O)[C@@H]1O[C@H]1[C@H]2OC3([C@@H]([C@@H](O)[C@@H](O)[C@@H]([C@@H](N)CO)O3)O)O[C@H]2[C@@H](O)[C@@H](CO)O1 GRRNUXAQVGOGFE-SVNOMHMPSA-N 0.000 description 1
- JNIIDKODPGHQSS-MPSMQSNBSA-N (3s)-3,6-diamino-n-[[(2s,5s,8z,11s,15s)-15-amino-11-[(6r)-2-amino-1,4,5,6-tetrahydropyrimidin-6-yl]-8-[(carbamoylamino)methylidene]-2-(hydroxymethyl)-3,6,9,12,16-pentaoxo-1,4,7,10,13-pentazacyclohexadec-5-yl]methyl]hexanamide Chemical compound N1C(=O)\C(=C\NC(N)=O)NC(=O)[C@H](CNC(=O)C[C@@H](N)CCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CNC(=O)[C@@H]1[C@@H]1NC(N)=NCC1 JNIIDKODPGHQSS-MPSMQSNBSA-N 0.000 description 1
- FRXNXDHFQYZYNA-GOTGUIIGSA-N (3s)-3,6-diamino-n-[[(2s,5s,8z,11s,15s)-15-amino-11-[(6r)-2-amino-1,4,5,6-tetrahydropyrimidin-6-yl]-8-[(carbamoylamino)methylidene]-2-methyl-3,6,9,12,16-pentaoxo-1,4,7,10,13-pentazacyclohexadec-5-yl]methyl]hexanamide Chemical compound N1C(=O)\C(=C\NC(N)=O)NC(=O)[C@H](CNC(=O)C[C@@H](N)CCCN)NC(=O)[C@H](C)NC(=O)[C@@H](N)CNC(=O)[C@@H]1[C@@H]1NC(N)=NCC1 FRXNXDHFQYZYNA-GOTGUIIGSA-N 0.000 description 1
- RAUQZDNDLCIQFJ-REHNUXHNSA-N (4s,4as,5as,6s,12ar)-4-(dimethylamino)-1,6,10,11,12a-pentahydroxy-n-[[4-(2-hydroxyethyl)piperazin-1-yl]methyl]-6-methyl-3,12-dioxo-4,4a,5,5a-tetrahydrotetracene-2-carboxamide Chemical compound OC([C@@]1(O)C(=O)C=2[C@@H]([C@](C3=CC=CC(O)=C3C=2O)(C)O)C[C@H]1[C@@H](C1=O)N(C)C)=C1C(=O)NCN1CCN(CCO)CC1 RAUQZDNDLCIQFJ-REHNUXHNSA-N 0.000 description 1
- FAMUIRDLAWWMCQ-AQFAATAFSA-N (4s,4as,5as,6s,12ar)-n-[[4-[n-(diaminomethylidene)carbamimidoyl]piperazin-1-yl]methyl]-4-(dimethylamino)-1,6,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4,4a,5,5a-tetrahydrotetracene-2-carboxamide Chemical compound OC([C@@]1(O)C(=O)C=2[C@@H]([C@](C3=CC=CC(O)=C3C=2O)(C)O)C[C@H]1[C@@H](C1=O)N(C)C)=C1C(=O)NCN1CCN(C(=N)N=C(N)N)CC1 FAMUIRDLAWWMCQ-AQFAATAFSA-N 0.000 description 1
- XSPUSVIQHBDITA-KXDGEKGBSA-N (6r,7r)-7-[[(2e)-2-(2-amino-1,3-thiazol-4-yl)-2-methoxyiminoacetyl]amino]-3-[(5-methyltetrazol-2-yl)methyl]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)/C(=N/OC)C=2N=C(N)SC=2)CC=1CN1N=NC(C)=N1 XSPUSVIQHBDITA-KXDGEKGBSA-N 0.000 description 1
- WDLWHQDACQUCJR-ZAMMOSSLSA-N (6r,7r)-7-[[(2r)-2-azaniumyl-2-(4-hydroxyphenyl)acetyl]amino]-8-oxo-3-[(e)-prop-1-enyl]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)/C=C/C)C(O)=O)=CC=C(O)C=C1 WDLWHQDACQUCJR-ZAMMOSSLSA-N 0.000 description 1
- MINDHVHHQZYEEK-UHFFFAOYSA-N (E)-(2S,3R,4R,5S)-5-[(2S,3S,4S,5S)-2,3-epoxy-5-hydroxy-4-methylhexyl]tetrahydro-3,4-dihydroxy-(beta)-methyl-2H-pyran-2-crotonic acid ester with 9-hydroxynonanoic acid Natural products CC(O)C(C)C1OC1CC1C(O)C(O)C(CC(C)=CC(=O)OCCCCCCCCC(O)=O)OC1 MINDHVHHQZYEEK-UHFFFAOYSA-N 0.000 description 1
- RXZBMPWDPOLZGW-XMRMVWPWSA-N (E)-roxithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=N/OCOCCOC)/[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 RXZBMPWDPOLZGW-XMRMVWPWSA-N 0.000 description 1
- IWKXBHQELWQLHF-CAPFRKAQSA-N (ne)-n-[(2-amino-3-propan-2-ylsulfonylbenzimidazol-5-yl)-phenylmethylidene]hydroxylamine Chemical compound C1=C2N(S(=O)(=O)C(C)C)C(N)=NC2=CC=C1C(=N\O)\C1=CC=CC=C1 IWKXBHQELWQLHF-CAPFRKAQSA-N 0.000 description 1
- FFJCNSLCJOQHKM-CLFAGFIQSA-N (z)-1-[(z)-octadec-9-enoxy]octadec-9-ene Chemical compound CCCCCCCC\C=C/CCCCCCCCOCCCCCCCC\C=C/CCCCCCCC FFJCNSLCJOQHKM-CLFAGFIQSA-N 0.000 description 1
- JCIIKRHCWVHVFF-UHFFFAOYSA-N 1,2,4-thiadiazol-5-amine;hydrochloride Chemical compound Cl.NC1=NC=NS1 JCIIKRHCWVHVFF-UHFFFAOYSA-N 0.000 description 1
- 229940043375 1,5-pentanediol Drugs 0.000 description 1
- UBCHPRBFMUDMNC-UHFFFAOYSA-N 1-(1-adamantyl)ethanamine Chemical compound C1C(C2)CC3CC2CC1(C(N)C)C3 UBCHPRBFMUDMNC-UHFFFAOYSA-N 0.000 description 1
- QITVRBREBFELAB-HCWSKCQFSA-N 1-[(2R,3R,4S,5R)-2-azido-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]pyrimidine-2,4-dione Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@@]1(N=[N+]=[N-])N1C(=O)NC(=O)C=C1 QITVRBREBFELAB-HCWSKCQFSA-N 0.000 description 1
- IPVFGAYTKQKGBM-BYPJNBLXSA-N 1-[(2r,3s,4r,5r)-3-fluoro-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-iodopyrimidine-2,4-dione Chemical compound F[C@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 IPVFGAYTKQKGBM-BYPJNBLXSA-N 0.000 description 1
- XKKCQTLDIPIRQD-JGVFFNPUSA-N 1-[(2r,5s)-5-(hydroxymethyl)oxolan-2-yl]-5-methylpyrimidine-2,4-dione Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)CC1 XKKCQTLDIPIRQD-JGVFFNPUSA-N 0.000 description 1
- MKXBOPXRKXGSTI-PJKMHFRUSA-N 1-[(2s,4s,5r)-2-fluoro-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-methylpyrimidine-2,4-dione Chemical compound O=C1NC(=O)C(C)=CN1[C@]1(F)O[C@H](CO)[C@@H](O)C1 MKXBOPXRKXGSTI-PJKMHFRUSA-N 0.000 description 1
- HBOMLICNUCNMMY-UHFFFAOYSA-N 1-[4-azido-5-(hydroxymethyl)oxolan-2-yl]-5-methylpyrimidine-2,4-dione Chemical compound O=C1NC(=O)C(C)=CN1C1OC(CO)C(N=[N+]=[N-])C1 HBOMLICNUCNMMY-UHFFFAOYSA-N 0.000 description 1
- CMCBDXRRFKYBDG-UHFFFAOYSA-N 1-dodecoxydodecane Chemical compound CCCCCCCCCCCCOCCCCCCCCCCCC CMCBDXRRFKYBDG-UHFFFAOYSA-N 0.000 description 1
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 1
- HBXWUCXDUUJDRB-UHFFFAOYSA-N 1-octadecoxyoctadecane Chemical compound CCCCCCCCCCCCCCCCCCOCCCCCCCCCCCCCCCCCC HBXWUCXDUUJDRB-UHFFFAOYSA-N 0.000 description 1
- ZQCIPRGNRQXXSK-UHFFFAOYSA-N 1-octadecoxypropan-2-ol Chemical compound CCCCCCCCCCCCCCCCCCOCC(C)O ZQCIPRGNRQXXSK-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- JLGKQTAYUIMGRK-UHFFFAOYSA-N 1-{2-[(7-chloro-1-benzothiophen-3-yl)methoxy]-2-(2,4-dichlorophenyl)ethyl}imidazole Chemical compound ClC1=CC(Cl)=CC=C1C(OCC=1C2=CC=CC(Cl)=C2SC=1)CN1C=NC=C1 JLGKQTAYUIMGRK-UHFFFAOYSA-N 0.000 description 1
- FRPZMMHWLSIFAZ-UHFFFAOYSA-N 10-undecenoic acid Chemical compound OC(=O)CCCCCCCCC=C FRPZMMHWLSIFAZ-UHFFFAOYSA-N 0.000 description 1
- LGEZTMRIZWCDLW-UHFFFAOYSA-N 14-methylpentadecyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCCCCCCCC(C)C LGEZTMRIZWCDLW-UHFFFAOYSA-N 0.000 description 1
- JSOVGYMVTPPEND-UHFFFAOYSA-N 16-methylheptadecyl 2,2-dimethylpropanoate Chemical compound CC(C)CCCCCCCCCCCCCCCOC(=O)C(C)(C)C JSOVGYMVTPPEND-UHFFFAOYSA-N 0.000 description 1
- WVXRAFOPTSTNLL-NKWVEPMBSA-N 2',3'-dideoxyadenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1CC[C@@H](CO)O1 WVXRAFOPTSTNLL-NKWVEPMBSA-N 0.000 description 1
- MEZZCSHVIGVWFI-UHFFFAOYSA-N 2,2'-Dihydroxy-4-methoxybenzophenone Chemical compound OC1=CC(OC)=CC=C1C(=O)C1=CC=CC=C1O MEZZCSHVIGVWFI-UHFFFAOYSA-N 0.000 description 1
- WVPAABNYMHNFJG-QDVBXLKVSA-N 2,2-dimethylpropanoyloxymethyl (6r,7r)-7-[[(z)-2-(2-amino-1,3-thiazol-4-yl)pent-2-enoyl]amino]-3-(carbamoyloxymethyl)-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate Chemical compound N([C@@H]1C(N2C(=C(COC(N)=O)CS[C@@H]21)C(=O)OCOC(=O)C(C)(C)C)=O)C(=O)\C(=C/CC)C1=CSC(N)=N1 WVPAABNYMHNFJG-QDVBXLKVSA-N 0.000 description 1
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- DBHODFSFBXJZNY-UHFFFAOYSA-N 2,4-dichlorobenzyl alcohol Chemical compound OCC1=CC=C(Cl)C=C1Cl DBHODFSFBXJZNY-UHFFFAOYSA-N 0.000 description 1
- IEORSVTYLWZQJQ-UHFFFAOYSA-N 2-(2-nonylphenoxy)ethanol Chemical compound CCCCCCCCCC1=CC=CC=C1OCCO IEORSVTYLWZQJQ-UHFFFAOYSA-N 0.000 description 1
- ILCOCZBHMDEIAI-UHFFFAOYSA-N 2-(2-octadecoxyethoxy)ethanol Chemical compound CCCCCCCCCCCCCCCCCCOCCOCCO ILCOCZBHMDEIAI-UHFFFAOYSA-N 0.000 description 1
- HNUQMTZUNUBOLQ-UHFFFAOYSA-N 2-[2-[2-[2-[2-[2-[2-[2-[2-(2-octadecoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethanol Chemical compound CCCCCCCCCCCCCCCCCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO HNUQMTZUNUBOLQ-UHFFFAOYSA-N 0.000 description 1
- AMRBZKOCOOPYNY-QXMHVHEDSA-N 2-[dimethyl-[(z)-octadec-9-enyl]azaniumyl]acetate Chemical compound CCCCCCCC\C=C/CCCCCCCC[N+](C)(C)CC([O-])=O AMRBZKOCOOPYNY-QXMHVHEDSA-N 0.000 description 1
- OCLZPNCLRLDXJC-NTSWFWBYSA-N 2-amino-9-[(2r,5s)-5-(hydroxymethyl)oxolan-2-yl]-3h-purin-6-one Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@H]1CC[C@@H](CO)O1 OCLZPNCLRLDXJC-NTSWFWBYSA-N 0.000 description 1
- JGUMTYWKIBJSTN-UHFFFAOYSA-N 2-ethylhexyl 4-[[4,6-bis[4-(2-ethylhexoxycarbonyl)anilino]-1,3,5-triazin-2-yl]amino]benzoate Chemical compound C1=CC(C(=O)OCC(CC)CCCC)=CC=C1NC1=NC(NC=2C=CC(=CC=2)C(=O)OCC(CC)CCCC)=NC(NC=2C=CC(=CC=2)C(=O)OCC(CC)CCCC)=N1 JGUMTYWKIBJSTN-UHFFFAOYSA-N 0.000 description 1
- OSCJHTSDLYVCQC-UHFFFAOYSA-N 2-ethylhexyl 4-[[4-[4-(tert-butylcarbamoyl)anilino]-6-[4-(2-ethylhexoxycarbonyl)anilino]-1,3,5-triazin-2-yl]amino]benzoate Chemical compound C1=CC(C(=O)OCC(CC)CCCC)=CC=C1NC1=NC(NC=2C=CC(=CC=2)C(=O)NC(C)(C)C)=NC(NC=2C=CC(=CC=2)C(=O)OCC(CC)CCCC)=N1 OSCJHTSDLYVCQC-UHFFFAOYSA-N 0.000 description 1
- GGBPWDGQNOAAQC-UHFFFAOYSA-N 2-ethylhexyl hexadecanoate;2-octylhexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(CC)CCCC.CCCCCCCCCCCCCCC(C(O)=O)CCCCCCCC GGBPWDGQNOAAQC-UHFFFAOYSA-N 0.000 description 1
- WSSJONWNBBTCMG-UHFFFAOYSA-N 2-hydroxybenzoic acid (3,3,5-trimethylcyclohexyl) ester Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C1=CC=CC=C1O WSSJONWNBBTCMG-UHFFFAOYSA-N 0.000 description 1
- RFVNOJDQRGSOEL-UHFFFAOYSA-N 2-hydroxyethyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCO RFVNOJDQRGSOEL-UHFFFAOYSA-N 0.000 description 1
- ICIDSZQHPUZUHC-UHFFFAOYSA-N 2-octadecoxyethanol Chemical compound CCCCCCCCCCCCCCCCCCOCCO ICIDSZQHPUZUHC-UHFFFAOYSA-N 0.000 description 1
- LEACJMVNYZDSKR-UHFFFAOYSA-N 2-octyldodecan-1-ol Chemical compound CCCCCCCCCCC(CO)CCCCCCCC LEACJMVNYZDSKR-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- QJQNWKPSKDLCOX-UHFFFAOYSA-N 3,3-diamino-2-hydroxybutanoic acid Chemical compound NC(C(C(=O)O)O)(C)N QJQNWKPSKDLCOX-UHFFFAOYSA-N 0.000 description 1
- UIVPNOBLHXUKDX-UHFFFAOYSA-N 3,5,5-trimethylhexyl 3,5,5-trimethylhexanoate Chemical compound CC(C)(C)CC(C)CCOC(=O)CC(C)CC(C)(C)C UIVPNOBLHXUKDX-UHFFFAOYSA-N 0.000 description 1
- XPFCZYUVICHKDS-UHFFFAOYSA-N 3-methylbutane-1,3-diol Chemical compound CC(C)(O)CCO XPFCZYUVICHKDS-UHFFFAOYSA-N 0.000 description 1
- WREGKURFCTUGRC-UHFFFAOYSA-N 4-Amino-1-[5-(hydroxymethyl)oxolan-2-yl]pyrimidin-2-one Chemical compound O=C1N=C(N)C=CN1C1OC(CO)CC1 WREGKURFCTUGRC-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- LTDCCBLBAQXNKP-SHYZEUOFSA-N 4-amino-1-[(2r,3r,5s)-3-fluoro-5-(hydroxymethyl)oxolan-2-yl]pyrimidin-2-one Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](F)C[C@@H](CO)O1 LTDCCBLBAQXNKP-SHYZEUOFSA-N 0.000 description 1
- GIMSJJHKKXRFGV-BYPJNBLXSA-N 4-amino-1-[(2r,3s,4r,5r)-3-fluoro-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-iodopyrimidin-2-one Chemical compound C1=C(I)C(N)=NC(=O)N1[C@H]1[C@@H](F)[C@H](O)[C@@H](CO)O1 GIMSJJHKKXRFGV-BYPJNBLXSA-N 0.000 description 1
- YVMBAUWDIGJRNY-BESUKNQGSA-N 4o8o7q7iu4 Chemical compound C1C(=O)C[C@H](O)\C=C(/C)\C=C\CNC(=O)\C=C\[C@@H](C)[C@@H](C(C)C)OC(=O)C2=CCCN2C(=O)C2=COC1=N2.N([C@@H]1C(=O)N[C@@H](C(N2CCC[C@H]2C(=O)N(C)[C@@H](CC=2C=CC(=CC=2)N(C)C)C(=O)N2CCC(=O)C[C@H]2C(=O)N[C@H](C(=O)O[C@@H]1C)C=1C=CC=CC=1)=O)CC)C(=O)C1=NC=CC=C1O YVMBAUWDIGJRNY-BESUKNQGSA-N 0.000 description 1
- NYCXYKOXLNBYID-UHFFFAOYSA-N 5,7-Dihydroxychromone Natural products O1C=CC(=O)C=2C1=CC(O)=CC=2O NYCXYKOXLNBYID-UHFFFAOYSA-N 0.000 description 1
- ASOVUCJFCHQGTH-UHFFFAOYSA-N 6-(4-hydroxy-3-methoxyphenyl)hexane-2,4-dione Chemical compound COC1=CC(CCC(=O)CC(C)=O)=CC=C1O ASOVUCJFCHQGTH-UHFFFAOYSA-N 0.000 description 1
- ACAZKHULUUVWCY-UHFFFAOYSA-N 6beta-hexanoylamino-penicillanic acid Natural products S1C(C)(C)C(C(O)=O)N2C(=O)C(NC(=O)CCCCC)C21 ACAZKHULUUVWCY-UHFFFAOYSA-N 0.000 description 1
- SLWSQPYUSBXANQ-BAJZRUMYSA-N 9-[(2r,3r,5s)-3-fluoro-5-(hydroxymethyl)oxolan-2-yl]-3h-purin-6-one Chemical compound O1[C@H](CO)C[C@@H](F)[C@@H]1N1C(NC=NC2=O)=C2N=C1 SLWSQPYUSBXANQ-BAJZRUMYSA-N 0.000 description 1
- DPSPPJIUMHPXMA-UHFFFAOYSA-N 9-fluoro-5-methyl-1-oxo-6,7-dihydro-1H,5H-pyrido[3,2,1-ij]quinoline-2-carboxylic acid Chemical compound C1CC(C)N2C=C(C(O)=O)C(=O)C3=C2C1=CC(F)=C3 DPSPPJIUMHPXMA-UHFFFAOYSA-N 0.000 description 1
- 101150093961 ANP32A gene Proteins 0.000 description 1
- 208000020154 Acnes Diseases 0.000 description 1
- 244000144927 Aloe barbadensis Species 0.000 description 1
- 235000002961 Aloe barbadensis Nutrition 0.000 description 1
- APKFDSVGJQXUKY-KKGHZKTASA-N Amphotericin-B Natural products O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1C=CC=CC=CC=CC=CC=CC=C[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-KKGHZKTASA-N 0.000 description 1
- 108700042778 Antimicrobial Peptides Proteins 0.000 description 1
- 102000044503 Antimicrobial Peptides Human genes 0.000 description 1
- 241000203069 Archaea Species 0.000 description 1
- 235000003261 Artemisia vulgaris Nutrition 0.000 description 1
- 240000006891 Artemisia vulgaris Species 0.000 description 1
- 101100010253 Bacillus subtilis (strain 168) dnaN gene Proteins 0.000 description 1
- 241000186016 Bifidobacterium bifidum Species 0.000 description 1
- 244000017106 Bixa orellana Species 0.000 description 1
- 235000006010 Bixa orellana Nutrition 0.000 description 1
- RAFGELQLHMBRHD-VFYVRILKSA-N Bixin Natural products COC(=O)C=CC(=C/C=C/C(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C(=O)O)/C)C RAFGELQLHMBRHD-VFYVRILKSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- BWNWKKNJDBZGSM-RRKCRQDMSA-N BrC(C=1C(NC(N([C@H]2C[C@H](O)[C@@H](CO)O2)C=1)=O)=O)(Br)Br Chemical compound BrC(C=1C(NC(N([C@H]2C[C@H](O)[C@@H](CO)O2)C=1)=O)=O)(Br)Br BWNWKKNJDBZGSM-RRKCRQDMSA-N 0.000 description 1
- 239000004255 Butylated hydroxyanisole Substances 0.000 description 1
- 239000004322 Butylated hydroxytoluene Substances 0.000 description 1
- NLZUEZXRPGMBCV-UHFFFAOYSA-N Butylhydroxytoluene Chemical compound CC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 NLZUEZXRPGMBCV-UHFFFAOYSA-N 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 229930188120 Carbomycin Natural products 0.000 description 1
- UKXFZNMZXWBSGH-UHFFFAOYSA-N Carbomycin A Natural products COC1C(OC2OC(C)C(OC3CC(C)(O)C(OC(=O)CC(C)C)C(C)O3)C(C2O)N(C)C)C(CC=O)CC(C)C(=O)C=CC4OC4CC(C)OC(=O)CC1C(=O)C UKXFZNMZXWBSGH-UHFFFAOYSA-N 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- UQLLWWBDSUHNEB-CZUORRHYSA-N Cefaprin Chemical compound N([C@H]1[C@@H]2N(C1=O)C(=C(CS2)COC(=O)C)C(O)=O)C(=O)CSC1=CC=NC=C1 UQLLWWBDSUHNEB-CZUORRHYSA-N 0.000 description 1
- QYQDKDWGWDOFFU-IUODEOHRSA-N Cefotiam Chemical compound CN(C)CCN1N=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)CC=3N=C(N)SC=3)[C@H]2SC1 QYQDKDWGWDOFFU-IUODEOHRSA-N 0.000 description 1
- GNWUOVJNSFPWDD-XMZRARIVSA-M Cefoxitin sodium Chemical compound [Na+].N([C@]1(OC)C(N2C(=C(COC(N)=O)CS[C@@H]21)C([O-])=O)=O)C(=O)CC1=CC=CS1 GNWUOVJNSFPWDD-XMZRARIVSA-M 0.000 description 1
- HOKIDJSKDBPKTQ-GLXFQSAKSA-N Cephalosporin C Natural products S1CC(COC(=O)C)=C(C(O)=O)N2C(=O)[C@@H](NC(=O)CCC[C@@H](N)C(O)=O)[C@@H]12 HOKIDJSKDBPKTQ-GLXFQSAKSA-N 0.000 description 1
- LXWBXEWUSAABOA-UHFFFAOYSA-N Cephamycin-C Natural products S1CC(COC(N)=O)=C(C(O)=O)N2C(=O)C(OC)(NC(=O)CCCC(N)C(O)=O)C21 LXWBXEWUSAABOA-UHFFFAOYSA-N 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 239000004155 Chlorine dioxide Substances 0.000 description 1
- 239000004099 Chlortetracycline Substances 0.000 description 1
- BHIHHJWSQVIVOR-RRKCRQDMSA-N ClC(C=1C(NC(N([C@H]2C[C@H](O)[C@@H](CO)O2)C=1)=O)=O)(Cl)Cl Chemical compound ClC(C=1C(NC(N([C@H]2C[C@H](O)[C@@H](CO)O2)C=1)=O)=O)(Cl)Cl BHIHHJWSQVIVOR-RRKCRQDMSA-N 0.000 description 1
- QCDFBFJGMNKBDO-UHFFFAOYSA-N Clioquinol Chemical compound C1=CN=C2C(O)=C(I)C=C(Cl)C2=C1 QCDFBFJGMNKBDO-UHFFFAOYSA-N 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- 240000008067 Cucumis sativus Species 0.000 description 1
- 235000010799 Cucumis sativus var sativus Nutrition 0.000 description 1
- 241000928573 Cutibacterium Species 0.000 description 1
- 241000625997 Cutibacterium acnes subsp. acnes Species 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- ZAKOWWREFLAJOT-CEFNRUSXSA-N D-alpha-tocopherylacetate Chemical compound CC(=O)OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C ZAKOWWREFLAJOT-CEFNRUSXSA-N 0.000 description 1
- SNPLKNRPJHDVJA-ZETCQYMHSA-N D-panthenol Chemical compound OCC(C)(C)[C@@H](O)C(=O)NCCCO SNPLKNRPJHDVJA-ZETCQYMHSA-N 0.000 description 1
- QMLVECGLEOSESV-RYUDHWBXSA-N Danofloxacin Chemical compound C([C@@H]1C[C@H]2CN1C)N2C(C(=CC=1C(=O)C(C(O)=O)=C2)F)=CC=1N2C1CC1 QMLVECGLEOSESV-RYUDHWBXSA-N 0.000 description 1
- JDRSMPFHFNXQRB-CMTNHCDUSA-N Decyl beta-D-threo-hexopyranoside Chemical compound CCCCCCCCCCO[C@@H]1O[C@H](CO)C(O)[C@H](O)C1O JDRSMPFHFNXQRB-CMTNHCDUSA-N 0.000 description 1
- FMTDIUIBLCQGJB-UHFFFAOYSA-N Demethylchlortetracyclin Natural products C1C2C(O)C3=C(Cl)C=CC(O)=C3C(=O)C2=C(O)C2(O)C1C(N(C)C)C(O)=C(C(N)=O)C2=O FMTDIUIBLCQGJB-UHFFFAOYSA-N 0.000 description 1
- LXBIFEVIBLOUGU-UHFFFAOYSA-N Deoxymannojirimycin Natural products OCC1NCC(O)C(O)C1O LXBIFEVIBLOUGU-UHFFFAOYSA-N 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 101100038183 Dictyostelium discoideum polr2a gene Proteins 0.000 description 1
- JWCSIUVGFCSJCK-CAVRMKNVSA-N Disodium Moxalactam Chemical compound N([C@]1(OC)C(N2C(=C(CSC=3N(N=NN=3)C)CO[C@@H]21)C(O)=O)=O)C(=O)C(C(O)=O)C1=CC=C(O)C=C1 JWCSIUVGFCSJCK-CAVRMKNVSA-N 0.000 description 1
- 239000003109 Disodium ethylene diamine tetraacetate Substances 0.000 description 1
- 239000001692 EU approved anti-caking agent Substances 0.000 description 1
- XPOQHMRABVBWPR-UHFFFAOYSA-N Efavirenz Natural products O1C(=O)NC2=CC=C(Cl)C=C2C1(C(F)(F)F)C#CC1CC1 XPOQHMRABVBWPR-UHFFFAOYSA-N 0.000 description 1
- 241000194032 Enterococcus faecalis Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 1
- 229930006677 Erythromycin A Natural products 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- CTKXFMQHOOWWEB-UHFFFAOYSA-N Ethylene oxide/propylene oxide copolymer Chemical compound CCCOC(C)COCCO CTKXFMQHOOWWEB-UHFFFAOYSA-N 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- UIOFUWFRIANQPC-JKIFEVAISA-N Floxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=C(F)C=CC=C1Cl UIOFUWFRIANQPC-JKIFEVAISA-N 0.000 description 1
- BIDUPMYXGFNAEJ-UHFFFAOYSA-N Fortimicin A Natural products OC1C(N(C)C(=O)CN)C(OC)C(O)C(N)C1OC1C(N)CCC(C(C)N)O1 BIDUPMYXGFNAEJ-UHFFFAOYSA-N 0.000 description 1
- WFMQYKIRAVMXSU-UHFFFAOYSA-N Fortimicin AE Natural products NC1C(O)C(OC)C(NC)C(O)C1OC1C(N)CCC(C(C)N)O1 WFMQYKIRAVMXSU-UHFFFAOYSA-N 0.000 description 1
- WFMQYKIRAVMXSU-LCVFDZPESA-N Fortimicin B Chemical compound N[C@H]1[C@H](O)[C@H](OC)[C@@H](NC)[C@@H](O)[C@@H]1O[C@@H]1[C@H](N)CC[C@@H]([C@H](C)N)O1 WFMQYKIRAVMXSU-LCVFDZPESA-N 0.000 description 1
- IECPWNUMDGFDKC-UHFFFAOYSA-N Fusicsaeure Natural products C12C(O)CC3C(=C(CCC=C(C)C)C(O)=O)C(OC(C)=O)CC3(C)C1(C)CCC1C2(C)CCC(O)C1C IECPWNUMDGFDKC-UHFFFAOYSA-N 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- DNYGXMICFMACRA-XHEDQWPISA-N Gentamicin C2b Chemical compound O1[C@H](CNC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N DNYGXMICFMACRA-XHEDQWPISA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- MPDGHEJMBKOTSU-UHFFFAOYSA-N Glycyrrhetinsaeure Natural products C12C(=O)C=C3C4CC(C)(C(O)=O)CCC4(C)CCC3(C)C1(C)CCC1C2(C)CCC(O)C1(C)C MPDGHEJMBKOTSU-UHFFFAOYSA-N 0.000 description 1
- CTETYYAZBPJBHE-UHFFFAOYSA-N Haloprogin Chemical compound ClC1=CC(Cl)=C(OCC#CI)C=C1Cl CTETYYAZBPJBHE-UHFFFAOYSA-N 0.000 description 1
- 241000208680 Hamamelis mollis Species 0.000 description 1
- 239000004354 Hydroxyethyl cellulose Substances 0.000 description 1
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 description 1
- GRRNUXAQVGOGFE-UHFFFAOYSA-N Hygromycin-B Natural products OC1C(NC)CC(N)C(O)C1OC1C2OC3(C(C(O)C(O)C(C(N)CO)O3)O)OC2C(O)C(CO)O1 GRRNUXAQVGOGFE-UHFFFAOYSA-N 0.000 description 1
- 241000282620 Hylobates sp. Species 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 101710116034 Immunity protein Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 238000006043 Intramolecular Michael addition reaction Methods 0.000 description 1
- MIFYHUACUWQUKT-UHFFFAOYSA-N Isopenicillin N Natural products OC(=O)C1C(C)(C)SC2C(NC(=O)CCCC(N)C(O)=O)C(=O)N21 MIFYHUACUWQUKT-UHFFFAOYSA-N 0.000 description 1
- 241000504910 Kitasatospora cheerisanensis KCTC 2395 Species 0.000 description 1
- 241000210627 Kitasatospora mediocidica KCTC 9733 Species 0.000 description 1
- 241000772426 Kitasatospora setae KM-6054 Species 0.000 description 1
- 241000060682 Kitasatospora sp. Species 0.000 description 1
- 239000011786 L-ascorbyl-6-palmitate Substances 0.000 description 1
- QAQJMLQRFWZOBN-LAUBAEHRSA-N L-ascorbyl-6-palmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](O)[C@H]1OC(=O)C(O)=C1O QAQJMLQRFWZOBN-LAUBAEHRSA-N 0.000 description 1
- XAGMUUZPGZWTRP-ZETCQYMHSA-N LSM-5745 Chemical compound C([C@@H](N1C2=C(C(C(C(O)=O)=C1)=O)C=C1F)C)OC2=C1C1(N)CC1 XAGMUUZPGZWTRP-ZETCQYMHSA-N 0.000 description 1
- 101100419195 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) rpsC2 gene Proteins 0.000 description 1
- 101100363550 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) rpsE2 gene Proteins 0.000 description 1
- 101100088535 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) rplP gene Proteins 0.000 description 1
- OJMMVQQUTAEWLP-UHFFFAOYSA-N Lincomycin Natural products CN1CC(CCC)CC1C(=O)NC(C(C)O)C1C(O)C(O)C(O)C(SC)O1 OJMMVQQUTAEWLP-UHFFFAOYSA-N 0.000 description 1
- 108090000301 Membrane transport proteins Proteins 0.000 description 1
- 102000003939 Membrane transport proteins Human genes 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 101100037096 Methanococcus maripaludis (strain S2 / LL) rpl6 gene Proteins 0.000 description 1
- 101100038261 Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB) rpo2C gene Proteins 0.000 description 1
- 101100254826 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) rps5 gene Proteins 0.000 description 1
- QWZLBLDNRUUYQI-UHFFFAOYSA-M Methylbenzethonium chloride Chemical compound [Cl-].CC1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 QWZLBLDNRUUYQI-UHFFFAOYSA-M 0.000 description 1
- BYBLEWFAAKGYCD-UHFFFAOYSA-N Miconazole Chemical compound ClC1=CC(Cl)=CC=C1COC(C=1C(=CC(Cl)=CC=1)Cl)CN1C=NC=C1 BYBLEWFAAKGYCD-UHFFFAOYSA-N 0.000 description 1
- DMUAPQTXSSNEDD-QALJCMCCSA-N Midecamycin Chemical compound C1[C@](O)(C)[C@@H](OC(=O)CC)[C@H](C)O[C@H]1O[C@H]1[C@H](N(C)C)[C@@H](O)[C@H](O[C@@H]2[C@H]([C@H](OC(=O)CC)CC(=O)O[C@H](C)C/C=C/C=C/[C@H](O)[C@H](C)C[C@@H]2CC=O)OC)O[C@@H]1C DMUAPQTXSSNEDD-QALJCMCCSA-N 0.000 description 1
- 229930192051 Mikamycin Natural products 0.000 description 1
- 108010046774 Mikamycin Proteins 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- HRHKSTOGXBBQCB-UHFFFAOYSA-N Mitomycin E Natural products O=C1C(N)=C(C)C(=O)C2=C1C(COC(N)=O)C1(OC)C3N(C)C3CN12 HRHKSTOGXBBQCB-UHFFFAOYSA-N 0.000 description 1
- 244000179970 Monarda didyma Species 0.000 description 1
- 235000010672 Monarda didyma Nutrition 0.000 description 1
- 241000588655 Moraxella catarrhalis Species 0.000 description 1
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 1
- AOMUHOFOVNGZAN-UHFFFAOYSA-N N,N-bis(2-hydroxyethyl)dodecanamide Chemical compound CCCCCCCCCCCC(=O)N(CCO)CCO AOMUHOFOVNGZAN-UHFFFAOYSA-N 0.000 description 1
- BBAFBDLICMHBNU-MFZOPHKMSA-N N-(2-hydroxyoctadecanoyl)-4-hydroxysphinganine Chemical compound CCCCCCCCCCCCCCCCC(O)C(=O)N[C@@H](CO)[C@H](O)[C@H](O)CCCCCCCCCCCCCC BBAFBDLICMHBNU-MFZOPHKMSA-N 0.000 description 1
- WAYLDHLWVYQNSQ-KEFDUYNTSA-N N-2-hydroxylignoceroylsphingosine Chemical compound CCCCCCCCCCCCCCCCCCCCCCC(O)C(=O)N[C@@H](CO)[C@H](O)\C=C\CCCCCCCCCCCCC WAYLDHLWVYQNSQ-KEFDUYNTSA-N 0.000 description 1
- PVCJKHHOXFKFRP-UHFFFAOYSA-N N-acetylethanolamine Chemical compound CC(=O)NCCO PVCJKHHOXFKFRP-UHFFFAOYSA-N 0.000 description 1
- 241001195348 Nusa Species 0.000 description 1
- YBGZDTIWKVFICR-JLHYYAGUSA-N Octyl 4-methoxycinnamic acid Chemical compound CCCCC(CC)COC(=O)\C=C\C1=CC=C(OC)C=C1 YBGZDTIWKVFICR-JLHYYAGUSA-N 0.000 description 1
- 239000004104 Oleandomycin Substances 0.000 description 1
- RZPAKFUAFGMUPI-UHFFFAOYSA-N Oleandomycin Natural products O1C(C)C(O)C(OC)CC1OC1C(C)C(=O)OC(C)C(C)C(O)C(C)C(=O)C2(OC2)CC(C)C(OC2C(C(CC(C)O2)N(C)C)O)C1C RZPAKFUAFGMUPI-UHFFFAOYSA-N 0.000 description 1
- 239000004100 Oxytetracycline Substances 0.000 description 1
- 101150029686 Pak gene Proteins 0.000 description 1
- 206010033733 Papule Diseases 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- 108010057150 Peplomycin Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108010013639 Peptidoglycan Proteins 0.000 description 1
- 101100091878 Plasmodium falciparum (isolate 3D7) rpoC2 gene Proteins 0.000 description 1
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 229920002701 Polyoxyl 40 Stearate Polymers 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 229920001219 Polysorbate 40 Polymers 0.000 description 1
- 206010063493 Premature ageing Diseases 0.000 description 1
- 208000032038 Premature aging Diseases 0.000 description 1
- 241001430313 Propionibacteriaceae Species 0.000 description 1
- 241000314500 Propionibacterium acidifaciens DSM 21887 Species 0.000 description 1
- 241000301104 Propionibacterium acnes HL037PA1 Species 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 101100352651 Pseudomonas sp. (strain WBC-3) pnpA gene Proteins 0.000 description 1
- ZVOLCUVKHLEPEV-UHFFFAOYSA-N Quercetagetin Natural products C1=C(O)C(O)=CC=C1C1=C(O)C(=O)C2=C(O)C(O)=C(O)C=C2O1 ZVOLCUVKHLEPEV-UHFFFAOYSA-N 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 238000011530 RNeasy Mini Kit Methods 0.000 description 1
- 101150078442 RPL5 gene Proteins 0.000 description 1
- 206010037888 Rash pustular Diseases 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- HWTZYBCRDDUBJY-UHFFFAOYSA-N Rhynchosin Natural products C1=C(O)C(O)=CC=C1C1=C(O)C(=O)C2=CC(O)=C(O)C=C2O1 HWTZYBCRDDUBJY-UHFFFAOYSA-N 0.000 description 1
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 1
- URWAJWIAIPFPJE-UHFFFAOYSA-N Rickamicin Natural products O1CC(O)(C)C(NC)C(O)C1OC1C(O)C(OC2C(CC=C(CN)O2)N)C(N)CC1N URWAJWIAIPFPJE-UHFFFAOYSA-N 0.000 description 1
- HJYYPODYNSCCOU-ZDHWWVNNSA-N Rifamycin SV Natural products COC1C=COC2(C)Oc3c(C)c(O)c4c(O)c(NC(=O)C(=C/C=C/C(C)C(O)C(C)C(O)C(C)C(OC(=O)C)C1C)C)cc(O)c4c3C2=O HJYYPODYNSCCOU-ZDHWWVNNSA-N 0.000 description 1
- 101150102982 RpS10 gene Proteins 0.000 description 1
- 235000019485 Safflower oil Nutrition 0.000 description 1
- 241001558929 Sclerotium <basidiomycota> Species 0.000 description 1
- 206010039792 Seborrhoea Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 229930192786 Sisomicin Natural products 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- 229920002385 Sodium hyaluronate Polymers 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 241000187180 Streptomyces sp. Species 0.000 description 1
- 241000204060 Streptomycetaceae Species 0.000 description 1
- 108010053950 Teicoplanin Proteins 0.000 description 1
- 244000141804 Theobroma grandiflorum Species 0.000 description 1
- 235000002424 Theobroma grandiflorum Nutrition 0.000 description 1
- WKDDRNSBRWANNC-UHFFFAOYSA-N Thienamycin Natural products C1C(SCCN)=C(C(O)=O)N2C(=O)C(C(O)C)C21 WKDDRNSBRWANNC-UHFFFAOYSA-N 0.000 description 1
- 108010021119 Trichosanthin Proteins 0.000 description 1
- 239000004182 Tylosin Substances 0.000 description 1
- 229930194936 Tylosin Natural products 0.000 description 1
- 101150049278 US20 gene Proteins 0.000 description 1
- OIRDTQYFTABQOQ-UHTZMRCNSA-N Vidarabine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O OIRDTQYFTABQOQ-UHTZMRCNSA-N 0.000 description 1
- 229930003779 Vitamin B12 Natural products 0.000 description 1
- 229930003316 Vitamin D Natural products 0.000 description 1
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 1
- 240000006365 Vitis vinifera Species 0.000 description 1
- 235000014787 Vitis vinifera Nutrition 0.000 description 1
- OEWBEINAQKIQLZ-CMRBMDBWSA-N [(2s)-2-[(2r)-3,4-bis(2-hexyldecanoyloxy)-5-oxo-2h-furan-2-yl]-2-(2-hexyldecanoyloxy)ethyl] 2-hexyldecanoate Chemical compound CCCCCCCCC(CCCCCC)C(=O)OC[C@H](OC(=O)C(CCCCCC)CCCCCCCC)[C@H]1OC(=O)C(OC(=O)C(CCCCCC)CCCCCCCC)=C1OC(=O)C(CCCCCC)CCCCCCCC OEWBEINAQKIQLZ-CMRBMDBWSA-N 0.000 description 1
- WYWZRNAHINYAEF-AWEZNQCLSA-N [(2s)-2-ethylhexyl] 4-(dimethylamino)benzoate Chemical compound CCCC[C@H](CC)COC(=O)C1=CC=C(N(C)C)C=C1 WYWZRNAHINYAEF-AWEZNQCLSA-N 0.000 description 1
- FQVHOULQCKDUCY-OGHXVOSASA-N [(2s,3s,4r,6s)-6-[(2r,3s,4r,5r,6s)-6-[[(1s,3r,7r,8s,9s,10r,12r,14e,16s)-7-acetyloxy-8-methoxy-3,12-dimethyl-5,13-dioxo-10-(2-oxoethyl)-4,17-dioxabicyclo[14.1.0]heptadec-14-en-9-yl]oxy]-4-(dimethylamino)-5-hydroxy-2-methyloxan-3-yl]oxy-4-hydroxy-2,4-dimeth Chemical compound O([C@@H]1[C@@H](C)O[C@H]([C@@H]([C@H]1N(C)C)O)O[C@H]1[C@@H](CC=O)C[C@@H](C)C(=O)/C=C/[C@@H]2O[C@H]2C[C@@H](C)OC(=O)C[C@H]([C@@H]1OC)OC(C)=O)[C@H]1C[C@@](C)(O)[C@@H](OC(=O)CC(C)C)[C@H](C)O1 FQVHOULQCKDUCY-OGHXVOSASA-N 0.000 description 1
- KBEMFSMODRNJHE-BAJZRUMYSA-N [(2s,4r,5r)-5-(6-aminopurin-9-yl)-4-fluorooxolan-2-yl]methanol Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)C[C@H]1F KBEMFSMODRNJHE-BAJZRUMYSA-N 0.000 description 1
- ZWBTYMGEBZUQTK-PVLSIAFMSA-N [(7S,9E,11S,12R,13S,14R,15R,16R,17S,18S,19E,21Z)-2,15,17,32-tetrahydroxy-11-methoxy-3,7,12,14,16,18,22-heptamethyl-1'-(2-methylpropyl)-6,23-dioxospiro[8,33-dioxa-24,27,29-triazapentacyclo[23.6.1.14,7.05,31.026,30]tritriaconta-1(32),2,4,9,19,21,24,26,30-nonaene-28,4'-piperidine]-13-yl] acetate Chemical compound CO[C@H]1\C=C\O[C@@]2(C)Oc3c(C2=O)c2c4NC5(CCN(CC(C)C)CC5)N=c4c(=NC(=O)\C(C)=C/C=C/[C@H](C)[C@H](O)[C@@H](C)[C@@H](O)[C@@H](C)[C@H](OC(C)=O)[C@@H]1C)c(O)c2c(O)c3C ZWBTYMGEBZUQTK-PVLSIAFMSA-N 0.000 description 1
- XFGCTBYTRMLWCB-MRSVHRRQSA-N [(z)-[(3s,9s,12s,15s)-15-amino-9-(aminomethyl)-3-[(6r)-2-amino-1,4,5,6-tetrahydropyrimidin-6-yl]-12-(hydroxymethyl)-2,5,8,11,14-pentaoxo-1,4,7,10,13-pentazacyclohexadec-6-ylidene]methyl]urea Chemical compound N1C(=O)\C(=C\NC(N)=O)NC(=O)[C@H](CN)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CNC(=O)[C@@H]1[C@@H]1NC(N)=NCC1 XFGCTBYTRMLWCB-MRSVHRRQSA-N 0.000 description 1
- MHBQQDNEPQYCOS-CBQPQWBASA-N [(z)-[(3s,9s,12s,15s)-15-amino-9-(aminomethyl)-3-[(6r)-2-amino-1,4,5,6-tetrahydropyrimidin-6-yl]-12-methyl-2,5,8,11,14-pentaoxo-1,4,7,10,13-pentazacyclohexadec-6-ylidene]methyl]urea Chemical compound N1C(=O)\C(=C\NC(N)=O)NC(=O)[C@H](CN)NC(=O)[C@H](C)NC(=O)[C@@H](N)CNC(=O)[C@@H]1[C@@H]1NC(N)=NCC1 MHBQQDNEPQYCOS-CBQPQWBASA-N 0.000 description 1
- DFPAKSUCGFBDDF-ZQBYOMGUSA-N [14c]-nicotinamide Chemical compound N[14C](=O)C1=CC=CN=C1 DFPAKSUCGFBDDF-ZQBYOMGUSA-N 0.000 description 1
- MIUIRGGKIICMBP-NFOZDHADSA-N [27-oxo-27-[[(2s,3s,4r)-1,3,4-trihydroxyoctadecan-2-yl]amino]heptacosyl] octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCCCCCCCCCCCCCCCCCCCCC(=O)N[C@@H](CO)[C@H](O)[C@H](O)CCCCCCCCCCCCCC MIUIRGGKIICMBP-NFOZDHADSA-N 0.000 description 1
- ZGBFGAHZKZQSLG-UMCOJZBLSA-N [30-oxo-30-[[(e,2s,3r,6r)-1,3,6-trihydroxyoctadec-4-en-2-yl]amino]triacontyl] (9z,12z)-octadeca-9,12-dienoate Chemical compound CCCCCCCCCCCC[C@@H](O)\C=C\[C@@H](O)[C@H](CO)NC(=O)CCCCCCCCCCCCCCCCCCCCCCCCCCCCCOC(=O)CCCCCCC\C=C/C\C=C/CCCCC ZGBFGAHZKZQSLG-UMCOJZBLSA-N 0.000 description 1
- 239000003082 abrasive agent Substances 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- XOYXESIZZFUVRD-UVSAJTFZSA-M acemannan Chemical compound CC(=O)O[C@@H]1[C@H](O)[C@@H](OC)O[C@H](CO)[C@H]1O[C@@H]1[C@@H](O)[C@@H](OC(C)=O)[C@H](O[C@@H]2[C@H]([C@@H](OC(C)=O)[C@H](O[C@@H]3[C@H]([C@@H](O)[C@H](O[C@@H]4[C@H]([C@@H](OC(C)=O)[C@H](O[C@@H]5[C@H]([C@@H](OC(C)=O)[C@H](O[C@@H]6[C@H]([C@@H](OC(C)=O)[C@H](O[C@@H]7[C@H]([C@@H](OC(C)=O)[C@H](OC)[C@@H](CO)O7)O)[C@@H](CO)O6)O)[C@H](O5)C([O-])=O)O)[C@@H](CO)O4)O)[C@@H](CO)O3)NC(C)=O)[C@@H](CO)O2)O)[C@@H](CO)O1 XOYXESIZZFUVRD-UVSAJTFZSA-M 0.000 description 1
- 229960005327 acemannan Drugs 0.000 description 1
- 229950008644 adicillin Drugs 0.000 description 1
- 239000003463 adsorbent Substances 0.000 description 1
- 230000001476 alcoholic effect Effects 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N aldehydo-D-ribose Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 229950008560 almecillin Drugs 0.000 description 1
- RGZSQWQPBWRIAQ-LSDHHAIUSA-N alpha-Bisabolol Natural products CC(C)=CCC[C@@](C)(O)[C@@H]1CCC(C)=CC1 RGZSQWQPBWRIAQ-LSDHHAIUSA-N 0.000 description 1
- RAFGELQLHMBRHD-UHFFFAOYSA-N alpha-Fuc-(1-2)-beta-Gal-(1-3)-(beta-GlcNAc-(1-6))-GalNAc-ol Natural products COC(=O)C=CC(C)=CC=CC(C)=CC=CC=C(C)C=CC=C(C)C=CC(O)=O RAFGELQLHMBRHD-UHFFFAOYSA-N 0.000 description 1
- SNAAJJQQZSMGQD-UHFFFAOYSA-N aluminum magnesium Chemical compound [Mg].[Al] SNAAJJQQZSMGQD-UHFFFAOYSA-N 0.000 description 1
- DKNWSYNQZKUICI-UHFFFAOYSA-N amantadine Chemical compound C1C(C2)CC3CC2CC1(N)C3 DKNWSYNQZKUICI-UHFFFAOYSA-N 0.000 description 1
- 229960003805 amantadine Drugs 0.000 description 1
- 229960004050 aminobenzoic acid Drugs 0.000 description 1
- APKFDSVGJQXUKY-INPOYWNPSA-N amphotericin B Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 1
- 229960003942 amphotericin b Drugs 0.000 description 1
- 239000001670 anatto Substances 0.000 description 1
- 235000012665 annatto Nutrition 0.000 description 1
- 239000000058 anti acne agent Substances 0.000 description 1
- 230000003712 anti-aging effect Effects 0.000 description 1
- 230000000843 anti-fungal effect Effects 0.000 description 1
- 230000001166 anti-perspirative effect Effects 0.000 description 1
- 229940124340 antiacne agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 229940125715 antihistaminic agent Drugs 0.000 description 1
- 239000000739 antihistaminic agent Substances 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 239000003213 antiperspirant Substances 0.000 description 1
- 239000003904 antiprotozoal agent Substances 0.000 description 1
- 229940027983 antiseptic and disinfectant quaternary ammonium compound Drugs 0.000 description 1
- 239000002216 antistatic agent Substances 0.000 description 1
- 229930188866 apocynin Natural products 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 239000008135 aqueous vehicle Substances 0.000 description 1
- BTFJIXJJCSYFAL-UHFFFAOYSA-N arachidyl alcohol Natural products CCCCCCCCCCCCCCCCCCCCO BTFJIXJJCSYFAL-UHFFFAOYSA-N 0.000 description 1
- 235000010385 ascorbyl palmitate Nutrition 0.000 description 1
- 239000003212 astringent agent Substances 0.000 description 1
- BIDUPMYXGFNAEJ-APGVDKLISA-N astromicin Chemical compound O[C@@H]1[C@H](N(C)C(=O)CN)[C@@H](OC)[C@@H](O)[C@H](N)[C@H]1O[C@@H]1[C@H](N)CC[C@@H]([C@H](C)N)O1 BIDUPMYXGFNAEJ-APGVDKLISA-N 0.000 description 1
- XNEFYCZVKIDDMS-UHFFFAOYSA-N avobenzone Chemical compound C1=CC(OC)=CC=C1C(=O)CC(=O)C1=CC=C(C(C)(C)C)C=C1 XNEFYCZVKIDDMS-UHFFFAOYSA-N 0.000 description 1
- 229960005193 avobenzone Drugs 0.000 description 1
- 235000021302 avocado oil Nutrition 0.000 description 1
- 239000008163 avocado oil Substances 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 235000013871 bee wax Nutrition 0.000 description 1
- 239000012166 beeswax Substances 0.000 description 1
- 229940070718 behentrimonium Drugs 0.000 description 1
- YSJGOMATDFSEED-UHFFFAOYSA-M behentrimonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCCCCCC[N+](C)(C)C YSJGOMATDFSEED-UHFFFAOYSA-M 0.000 description 1
- 229940095077 behentrimonium methosulfate Drugs 0.000 description 1
- XVAMCHGMPYWHNL-UHFFFAOYSA-N bemotrizinol Chemical compound OC1=CC(OCC(CC)CCCC)=CC=C1C1=NC(C=2C=CC(OC)=CC=2)=NC(C=2C(=CC(OCC(CC)CCCC)=CC=2)O)=N1 XVAMCHGMPYWHNL-UHFFFAOYSA-N 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- JTBVPHBMCXEPOX-UHFFFAOYSA-N benzoic acid;formaldehyde Chemical compound O=C.OC(=O)C1=CC=CC=C1 JTBVPHBMCXEPOX-UHFFFAOYSA-N 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- 229960004217 benzyl alcohol Drugs 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- PSPRNQOVLYLHSA-CPCZMJQVSA-N benzylpenillic acid Chemical compound CC([C@@H](N12)C(O)=O)(C)SC1C(C(O)=O)N=C2CC1=CC=CC=C1 PSPRNQOVLYLHSA-CPCZMJQVSA-N 0.000 description 1
- 229940002008 bifidobacterium bifidum Drugs 0.000 description 1
- 239000003833 bile salt Substances 0.000 description 1
- 229940093761 bile salts Drugs 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000001851 biosynthetic effect Effects 0.000 description 1
- 229940036350 bisabolol Drugs 0.000 description 1
- HHGZABIIYIWLGA-UHFFFAOYSA-N bisabolol Natural products CC1CCC(C(C)(O)CCC=C(C)C)CC1 HHGZABIIYIWLGA-UHFFFAOYSA-N 0.000 description 1
- FQUNFJULCYSSOP-UHFFFAOYSA-N bisoctrizole Chemical compound N1=C2C=CC=CC2=NN1C1=CC(C(C)(C)CC(C)(C)C)=CC(CC=2C(=C(C=C(C=2)C(C)(C)CC(C)(C)C)N2N=C3C=CC=CC3=N2)O)=C1O FQUNFJULCYSSOP-UHFFFAOYSA-N 0.000 description 1
- 235000012978 bixa orellana Nutrition 0.000 description 1
- RAFGELQLHMBRHD-SLEZCNMESA-N bixin Chemical compound COC(=O)\C=C\C(\C)=C/C=C/C(/C)=C/C=C/C=C(\C)/C=C/C=C(\C)/C=C/C(O)=O RAFGELQLHMBRHD-SLEZCNMESA-N 0.000 description 1
- 238000005282 brightening Methods 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 235000014121 butter Nutrition 0.000 description 1
- 235000019282 butylated hydroxyanisole Nutrition 0.000 description 1
- CZBZUDVBLSSABA-UHFFFAOYSA-N butylated hydroxyanisole Chemical compound COC1=CC=C(O)C(C(C)(C)C)=C1.COC1=CC=C(O)C=C1C(C)(C)C CZBZUDVBLSSABA-UHFFFAOYSA-N 0.000 description 1
- 229940043253 butylated hydroxyanisole Drugs 0.000 description 1
- 235000010354 butylated hydroxytoluene Nutrition 0.000 description 1
- 229940095259 butylated hydroxytoluene Drugs 0.000 description 1
- 229940105847 calamine Drugs 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- JNIIDKODPGHQSS-UHFFFAOYSA-N capreomycin IA Natural products N1C(=O)C(=CNC(N)=O)NC(=O)C(CNC(=O)CC(N)CCCN)NC(=O)C(CO)NC(=O)C(N)CNC(=O)C1C1NC(N)=NCC1 JNIIDKODPGHQSS-UHFFFAOYSA-N 0.000 description 1
- FRXNXDHFQYZYNA-UHFFFAOYSA-N capreomycin IB Natural products N1C(=O)C(=CNC(N)=O)NC(=O)C(CNC(=O)CC(N)CCCN)NC(=O)C(C)NC(=O)C(N)CNC(=O)C1C1NC(N)=NCC1 FRXNXDHFQYZYNA-UHFFFAOYSA-N 0.000 description 1
- XFGCTBYTRMLWCB-UHFFFAOYSA-N capreomycin IIA Natural products N1C(=O)C(=CNC(N)=O)NC(=O)C(CN)NC(=O)C(CO)NC(=O)C(N)CNC(=O)C1C1NC(N)=NCC1 XFGCTBYTRMLWCB-UHFFFAOYSA-N 0.000 description 1
- MHBQQDNEPQYCOS-UHFFFAOYSA-N capreomycin IIB Natural products N1C(=O)C(=CNC(N)=O)NC(=O)C(CN)NC(=O)C(C)NC(=O)C(N)CNC(=O)C1C1NC(N)=NCC1 MHBQQDNEPQYCOS-UHFFFAOYSA-N 0.000 description 1
- KHAVLLBUVKBTBG-UHFFFAOYSA-N caproleic acid Natural products OC(=O)CCCCCCCC=C KHAVLLBUVKBTBG-UHFFFAOYSA-N 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- UIMOJFJSJSIGLV-JNHMLNOCSA-N carumonam Chemical compound O=C1N(S(O)(=O)=O)[C@H](COC(=O)N)[C@@H]1NC(=O)C(=N/OCC(O)=O)\C1=CSC(N)=N1 UIMOJFJSJSIGLV-JNHMLNOCSA-N 0.000 description 1
- 229960000662 carumonam Drugs 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 229960005361 cefaclor Drugs 0.000 description 1
- QYIYFLOTGYLRGG-GPCCPHFNSA-N cefaclor Chemical compound C1([C@H](C(=O)N[C@@H]2C(N3C(=C(Cl)CS[C@@H]32)C(O)=O)=O)N)=CC=CC=C1 QYIYFLOTGYLRGG-GPCCPHFNSA-N 0.000 description 1
- 229960004841 cefadroxil Drugs 0.000 description 1
- NBFNMSULHIODTC-CYJZLJNKSA-N cefadroxil monohydrate Chemical compound O.C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=C(O)C=C1 NBFNMSULHIODTC-CYJZLJNKSA-N 0.000 description 1
- DIGADQKVPFDJSI-SPYBWZPUSA-N cefalexin pivoxil Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(=O)OCOC(=O)C(C)(C)C)=CC=CC=C1 DIGADQKVPFDJSI-SPYBWZPUSA-N 0.000 description 1
- 229960003866 cefaloridine Drugs 0.000 description 1
- CZTQZXZIADLWOZ-CRAIPNDOSA-N cefaloridine Chemical compound O=C([C@@H](NC(=O)CC=1SC=CC=1)[C@H]1SC2)N1C(C(=O)[O-])=C2C[N+]1=CC=CC=C1 CZTQZXZIADLWOZ-CRAIPNDOSA-N 0.000 description 1
- 229960000603 cefalotin Drugs 0.000 description 1
- 229960003012 cefamandole Drugs 0.000 description 1
- OLVCFLKTBJRLHI-AXAPSJFSSA-N cefamandole Chemical compound CN1N=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)[C@H](O)C=3C=CC=CC=3)[C@H]2SC1 OLVCFLKTBJRLHI-AXAPSJFSSA-N 0.000 description 1
- 229960004350 cefapirin Drugs 0.000 description 1
- 229960002420 cefatrizine Drugs 0.000 description 1
- ACXMTAJLYQCRGF-PBFPGSCMSA-N cefatrizine Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)[C@H](N)C=2C=CC(O)=CC=2)CC=1CSC1=CN=N[N]1 ACXMTAJLYQCRGF-PBFPGSCMSA-N 0.000 description 1
- 229960005312 cefazedone Drugs 0.000 description 1
- VTLCNEGVSVJLDN-MLGOLLRUSA-N cefazedone Chemical compound S1C(C)=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)CN3C=C(Cl)C(=O)C(Cl)=C3)[C@H]2SC1 VTLCNEGVSVJLDN-MLGOLLRUSA-N 0.000 description 1
- 229960001139 cefazolin Drugs 0.000 description 1
- MLYYVTUWGNIJIB-BXKDBHETSA-N cefazolin Chemical compound S1C(C)=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)CN3N=NN=C3)[C@H]2SC1 MLYYVTUWGNIJIB-BXKDBHETSA-N 0.000 description 1
- 229960001817 cefbuperazone Drugs 0.000 description 1
- SMSRCGPDNDCXFR-CYWZMYCQSA-N cefbuperazone Chemical compound O=C1C(=O)N(CC)CCN1C(=O)N[C@H]([C@H](C)O)C(=O)N[C@]1(OC)C(=O)N2C(C(O)=O)=C(CSC=3N(N=NN=3)C)CS[C@@H]21 SMSRCGPDNDCXFR-CYWZMYCQSA-N 0.000 description 1
- 229950004627 cefcapene pivoxil Drugs 0.000 description 1
- JUVHVMCKLDZLGN-TVNFHGJBSA-N cefclidin Chemical compound N([C@@H]1C(N2C(=C(C[N+]34CCC(CC3)(CC4)C(N)=O)CS[C@@H]21)C([O-])=O)=O)C(=O)\C(=N/OC)C1=NSC(N)=N1 JUVHVMCKLDZLGN-TVNFHGJBSA-N 0.000 description 1
- 229950011467 cefclidin Drugs 0.000 description 1
- 229960003719 cefdinir Drugs 0.000 description 1
- RTXOFQZKPXMALH-GHXIOONMSA-N cefdinir Chemical compound S1C(N)=NC(C(=N\O)\C(=O)N[C@@H]2C(N3C(=C(C=C)CS[C@@H]32)C(O)=O)=O)=C1 RTXOFQZKPXMALH-GHXIOONMSA-N 0.000 description 1
- 229960004069 cefditoren Drugs 0.000 description 1
- KMIPKYQIOVAHOP-YLGJWRNMSA-N cefditoren Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1\C=C/C=1SC=NC=1C KMIPKYQIOVAHOP-YLGJWRNMSA-N 0.000 description 1
- 229960003791 cefmenoxime Drugs 0.000 description 1
- HJJDBAOLQAWBMH-YCRCPZNHSA-N cefmenoxime Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1CSC1=NN=NN1C HJJDBAOLQAWBMH-YCRCPZNHSA-N 0.000 description 1
- 229960002025 cefminox Drugs 0.000 description 1
- JSDXOWVAHXDYCU-VXSYNFHWSA-N cefminox Chemical compound S([C@@H]1[C@@](C(N1C=1C(O)=O)=O)(NC(=O)CSC[C@@H](N)C(O)=O)OC)CC=1CSC1=NN=NN1C JSDXOWVAHXDYCU-VXSYNFHWSA-N 0.000 description 1
- 229960001958 cefodizime Drugs 0.000 description 1
- XDZKBRJLTGRPSS-BGZQYGJUSA-N cefodizime Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1CSC1=NC(C)=C(CC(O)=O)S1 XDZKBRJLTGRPSS-BGZQYGJUSA-N 0.000 description 1
- 229960004489 cefonicid Drugs 0.000 description 1
- DYAIAHUQIPBDIP-AXAPSJFSSA-N cefonicid Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)[C@H](O)C=2C=CC=CC=2)CC=1CSC1=NN=NN1CS(O)(=O)=O DYAIAHUQIPBDIP-AXAPSJFSSA-N 0.000 description 1
- 229960004682 cefoperazone Drugs 0.000 description 1
- GCFBRXLSHGKWDP-XCGNWRKASA-N cefoperazone Chemical compound O=C1C(=O)N(CC)CCN1C(=O)N[C@H](C=1C=CC(O)=CC=1)C(=O)N[C@@H]1C(=O)N2C(C(O)=O)=C(CSC=3N(N=NN=3)C)CS[C@@H]21 GCFBRXLSHGKWDP-XCGNWRKASA-N 0.000 description 1
- 229960004292 ceforanide Drugs 0.000 description 1
- SLAYUXIURFNXPG-CRAIPNDOSA-N ceforanide Chemical compound NCC1=CC=CC=C1CC(=O)N[C@@H]1C(=O)N2C(C(O)=O)=C(CSC=3N(N=NN=3)CC(O)=O)CS[C@@H]21 SLAYUXIURFNXPG-CRAIPNDOSA-N 0.000 description 1
- 229960004261 cefotaxime Drugs 0.000 description 1
- AZZMGZXNTDTSME-JUZDKLSSSA-M cefotaxime sodium Chemical compound [Na+].N([C@@H]1C(N2C(=C(COC(C)=O)CS[C@@H]21)C([O-])=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 AZZMGZXNTDTSME-JUZDKLSSSA-M 0.000 description 1
- 229960005495 cefotetan Drugs 0.000 description 1
- SRZNHPXWXCNNDU-RHBCBLIFSA-N cefotetan Chemical compound N([C@]1(OC)C(N2C(=C(CSC=3N(N=NN=3)C)CS[C@@H]21)C(O)=O)=O)C(=O)C1SC(=C(C(N)=O)C(O)=O)S1 SRZNHPXWXCNNDU-RHBCBLIFSA-N 0.000 description 1
- 229960001242 cefotiam Drugs 0.000 description 1
- 229960002682 cefoxitin Drugs 0.000 description 1
- LNZMRLHZGOBKAN-KAWPREARSA-N cefpimizole Chemical compound N1=CNC(C(=O)N[C@@H](C(=O)N[C@@H]2C(N3C(=C(C[N+]=4C=CC(CCS(O)(=O)=O)=CC=4)CS[C@@H]32)C([O-])=O)=O)C=2C=CC=CC=2)=C1C(=O)O LNZMRLHZGOBKAN-KAWPREARSA-N 0.000 description 1
- 229950004036 cefpimizole Drugs 0.000 description 1
- 229960005446 cefpiramide Drugs 0.000 description 1
- PWAUCHMQEXVFJR-PMAPCBKXSA-N cefpiramide Chemical compound C1=NC(C)=CC(O)=C1C(=O)N[C@H](C=1C=CC(O)=CC=1)C(=O)N[C@@H]1C(=O)N2C(C(O)=O)=C(CSC=3N(N=NN=3)C)CS[C@@H]21 PWAUCHMQEXVFJR-PMAPCBKXSA-N 0.000 description 1
- 229960000466 cefpirome Drugs 0.000 description 1
- DKOQGJHPHLTOJR-WHRDSVKCSA-N cefpirome Chemical compound N([C@@H]1C(N2C(=C(C[N+]=3C=4CCCC=4C=CC=3)CS[C@@H]21)C([O-])=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 DKOQGJHPHLTOJR-WHRDSVKCSA-N 0.000 description 1
- 229960002580 cefprozil Drugs 0.000 description 1
- 229960002588 cefradine Drugs 0.000 description 1
- 229960003844 cefroxadine Drugs 0.000 description 1
- RDMOROXKXONCAL-UEKVPHQBSA-N cefroxadine Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)OC)C(O)=O)=CCC=CC1 RDMOROXKXONCAL-UEKVPHQBSA-N 0.000 description 1
- 229960003202 cefsulodin Drugs 0.000 description 1
- SYLKGLMBLAAGSC-QLVMHMETSA-N cefsulodin Chemical compound C1=CC(C(=O)N)=CC=[N+]1CC1=C(C([O-])=O)N2C(=O)[C@@H](NC(=O)[C@@H](C=3C=CC=CC=3)S(O)(=O)=O)[C@H]2SC1 SYLKGLMBLAAGSC-QLVMHMETSA-N 0.000 description 1
- 229960000484 ceftazidime Drugs 0.000 description 1
- ORFOPKXBNMVMKC-DWVKKRMSSA-N ceftazidime Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC(C)(C)C(O)=O)C=2N=C(N)SC=2)CC=1C[N+]1=CC=CC=C1 ORFOPKXBNMVMKC-DWVKKRMSSA-N 0.000 description 1
- 229950000679 cefteram Drugs 0.000 description 1
- 229960004366 ceftezole Drugs 0.000 description 1
- DZMVCVMFETWNIU-LDYMZIIASA-N ceftezole Chemical compound O=C([C@@H](NC(=O)CN1N=NN=C1)[C@H]1SC2)N1C(C(=O)O)=C2CSC1=NN=CS1 DZMVCVMFETWNIU-LDYMZIIASA-N 0.000 description 1
- 229960004086 ceftibuten Drugs 0.000 description 1
- UNJFKXSSGBWRBZ-BJCIPQKHSA-N ceftibuten Chemical compound S1C(N)=NC(C(=C\CC(O)=O)\C(=O)N[C@@H]2C(N3C(=CCS[C@@H]32)C(O)=O)=O)=C1 UNJFKXSSGBWRBZ-BJCIPQKHSA-N 0.000 description 1
- 229960005229 ceftiofur Drugs 0.000 description 1
- ZBHXIWJRIFEVQY-IHMPYVIRSA-N ceftiofur Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1CSC(=O)C1=CC=CO1 ZBHXIWJRIFEVQY-IHMPYVIRSA-N 0.000 description 1
- 229960001991 ceftizoxime Drugs 0.000 description 1
- NNULBSISHYWZJU-LLKWHZGFSA-N ceftizoxime Chemical compound N([C@@H]1C(N2C(=CCS[C@@H]21)C(O)=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 NNULBSISHYWZJU-LLKWHZGFSA-N 0.000 description 1
- 229960004755 ceftriaxone Drugs 0.000 description 1
- VAAUVRVFOQPIGI-SPQHTLEESA-N ceftriaxone Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1CSC1=NC(=O)C(=O)NN1C VAAUVRVFOQPIGI-SPQHTLEESA-N 0.000 description 1
- 229960001668 cefuroxime Drugs 0.000 description 1
- JFPVXVDWJQMJEE-IZRZKJBUSA-N cefuroxime Chemical compound N([C@@H]1C(N2C(=C(COC(N)=O)CS[C@@H]21)C(O)=O)=O)C(=O)\C(=N/OC)C1=CC=CO1 JFPVXVDWJQMJEE-IZRZKJBUSA-N 0.000 description 1
- 229950000807 cefuzonam Drugs 0.000 description 1
- CXHKZHZLDMQGFF-ZSDSSEDPSA-N cefuzonam Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1CSC1=CN=NS1 CXHKZHZLDMQGFF-ZSDSSEDPSA-N 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 229940106164 cephalexin Drugs 0.000 description 1
- ZAIPMKNFIOOWCQ-UEKVPHQBSA-N cephalexin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=CC=C1 ZAIPMKNFIOOWCQ-UEKVPHQBSA-N 0.000 description 1
- HOKIDJSKDBPKTQ-GLXFQSAKSA-M cephalosporin C(1-) Chemical compound S1CC(COC(=O)C)=C(C([O-])=O)N2C(=O)[C@@H](NC(=O)CCC[C@@H]([NH3+])C([O-])=O)[C@@H]12 HOKIDJSKDBPKTQ-GLXFQSAKSA-M 0.000 description 1
- VUFGUVLLDPOSBC-XRZFDKQNSA-M cephalothin sodium Chemical compound [Na+].N([C@H]1[C@@H]2N(C1=O)C(=C(CS2)COC(=O)C)C([O-])=O)C(=O)CC1=CC=CS1 VUFGUVLLDPOSBC-XRZFDKQNSA-M 0.000 description 1
- LXWBXEWUSAABOA-VXSYNFHWSA-N cephamycin C Chemical compound S1CC(COC(N)=O)=C(C(O)=O)N2C(=O)[C@@](OC)(NC(=O)CCC[C@@H](N)C(O)=O)[C@H]21 LXWBXEWUSAABOA-VXSYNFHWSA-N 0.000 description 1
- RDLPVSKMFDYCOR-UEKVPHQBSA-N cephradine Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CCC=CC1 RDLPVSKMFDYCOR-UEKVPHQBSA-N 0.000 description 1
- 229940048864 ceramide 1 Drugs 0.000 description 1
- 229940073669 ceteareth 20 Drugs 0.000 description 1
- 229940073642 ceteareth-30 Drugs 0.000 description 1
- 229940082500 cetostearyl alcohol Drugs 0.000 description 1
- 229960002798 cetrimide Drugs 0.000 description 1
- 229960001927 cetylpyridinium chloride Drugs 0.000 description 1
- YMKDRGPMQRFJGP-UHFFFAOYSA-M cetylpyridinium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCC[N+]1=CC=CC=C1 YMKDRGPMQRFJGP-UHFFFAOYSA-M 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- DDTDNCYHLGRFBM-YZEKDTGTSA-N chembl2367892 Chemical compound CC(=O)N[C@H]1[C@@H](O)[C@H](O)[C@H](CO)O[C@H]1O[C@@H]([C@H]1C(N[C@@H](C2=CC(O)=CC(O[C@@H]3[C@H]([C@H](O)[C@H](O)[C@@H](CO)O3)O)=C2C=2C(O)=CC=C(C=2)[C@@H](NC(=O)[C@@H]2NC(=O)[C@@H]3C=4C=C(O)C=C(C=4)OC=4C(O)=CC=C(C=4)[C@@H](N)C(=O)N[C@H](CC=4C=C(Cl)C(O5)=CC=4)C(=O)N3)C(=O)N1)C(O)=O)=O)C(C=C1Cl)=CC=C1OC1=C(O[C@H]3[C@H]([C@@H](O)[C@H](O)[C@H](CO)O3)NC(C)=O)C5=CC2=C1 DDTDNCYHLGRFBM-YZEKDTGTSA-N 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 235000019398 chlorine dioxide Nutrition 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- CYDMQBQPVICBEU-UHFFFAOYSA-N chlorotetracycline Natural products C1=CC(Cl)=C2C(O)(C)C3CC4C(N(C)C)C(O)=C(C(N)=O)C(=O)C4(O)C(O)=C3C(=O)C2=C1O CYDMQBQPVICBEU-UHFFFAOYSA-N 0.000 description 1
- SKPLBLUECSEIFO-UHFFFAOYSA-N chlorphenesin carbamate Chemical compound NC(=O)OCC(O)COC1=CC=C(Cl)C=C1 SKPLBLUECSEIFO-UHFFFAOYSA-N 0.000 description 1
- 229960004475 chlortetracycline Drugs 0.000 description 1
- CYDMQBQPVICBEU-XRNKAMNCSA-N chlortetracycline Chemical compound C1=CC(Cl)=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(O)=C(C(N)=O)C(=O)[C@@]4(O)C(O)=C3C(=O)C2=C1O CYDMQBQPVICBEU-XRNKAMNCSA-N 0.000 description 1
- 235000019365 chlortetracycline Nutrition 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 208000037893 chronic inflammatory disorder Diseases 0.000 description 1
- 229940043370 chrysin Drugs 0.000 description 1
- 235000015838 chrysin Nutrition 0.000 description 1
- 229960003749 ciclopirox Drugs 0.000 description 1
- SCKYRAXSEDYPSA-UHFFFAOYSA-N ciclopirox Chemical compound ON1C(=O)C=C(C)C=C1C1CCCCC1 SCKYRAXSEDYPSA-UHFFFAOYSA-N 0.000 description 1
- CMDKPGRTAQVGFQ-RMKNXTFCSA-N cinoxate Chemical compound CCOCCOC(=O)\C=C\C1=CC=C(OC)C=C1 CMDKPGRTAQVGFQ-RMKNXTFCSA-N 0.000 description 1
- 229960001063 cinoxate Drugs 0.000 description 1
- 229960002227 clindamycin Drugs 0.000 description 1
- KDLRVYVGXIQJDK-AWPVFWJPSA-N clindamycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@H](C)Cl)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 KDLRVYVGXIQJDK-AWPVFWJPSA-N 0.000 description 1
- 229960005228 clioquinol Drugs 0.000 description 1
- JKXQBIZCQJLVOS-GSNLGQFWSA-N clometocillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C(OC)C1=CC=C(Cl)C(Cl)=C1 JKXQBIZCQJLVOS-GSNLGQFWSA-N 0.000 description 1
- 229960001351 clometocillin Drugs 0.000 description 1
- 229960004094 clomocycline Drugs 0.000 description 1
- BXVOHUQQUBSHLD-XCTBDMBQSA-N clomocycline Chemical compound C1=CC(Cl)=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(=O)C(=C(/O)NCO)/C(=O)[C@@]4(O)C(=O)C3=C(O)C2=C1O BXVOHUQQUBSHLD-XCTBDMBQSA-N 0.000 description 1
- 229960004022 clotrimazole Drugs 0.000 description 1
- VNFPBHJOKIVQEB-UHFFFAOYSA-N clotrimazole Chemical compound ClC1=CC=CC=C1C(N1C=NC=C1)(C=1C=CC=CC=1)C1=CC=CC=C1 VNFPBHJOKIVQEB-UHFFFAOYSA-N 0.000 description 1
- 229960003326 cloxacillin Drugs 0.000 description 1
- LQOLIRLGBULYKD-JKIFEVAISA-N cloxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1Cl LQOLIRLGBULYKD-JKIFEVAISA-N 0.000 description 1
- AGVAZMGAQJOSFJ-WZHZPDAFSA-M cobalt(2+);[(2r,3s,4r,5s)-5-(5,6-dimethylbenzimidazol-1-yl)-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl] [(2r)-1-[3-[(1r,2r,3r,4z,7s,9z,12s,13s,14z,17s,18s,19r)-2,13,18-tris(2-amino-2-oxoethyl)-7,12,17-tris(3-amino-3-oxopropyl)-3,5,8,8,13,15,18,19-octamethyl-2 Chemical compound [Co+2].N#[C-].[N-]([C@@H]1[C@H](CC(N)=O)[C@@]2(C)CCC(=O)NC[C@@H](C)OP(O)(=O)O[C@H]3[C@H]([C@H](O[C@@H]3CO)N3C4=CC(C)=C(C)C=C4N=C3)O)\C2=C(C)/C([C@H](C\2(C)C)CCC(N)=O)=N/C/2=C\C([C@H]([C@@]/2(CC(N)=O)C)CCC(N)=O)=N\C\2=C(C)/C2=N[C@]1(C)[C@@](C)(CC(N)=O)[C@@H]2CCC(N)=O AGVAZMGAQJOSFJ-WZHZPDAFSA-M 0.000 description 1
- MRUAUOIMASANKQ-UHFFFAOYSA-N cocamidopropyl betaine Chemical compound CCCCCCCCCCCC(=O)NCCC[N+](C)(C)CC([O-])=O MRUAUOIMASANKQ-UHFFFAOYSA-N 0.000 description 1
- 229940073507 cocamidopropyl betaine Drugs 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 230000037319 collagen production Effects 0.000 description 1
- 229940052366 colloidal oatmeal Drugs 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 230000002301 combined effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 229960003624 creatine Drugs 0.000 description 1
- 239000006046 creatine Substances 0.000 description 1
- 229960004244 cyclacillin Drugs 0.000 description 1
- HGBLNBBNRORJKI-WCABBAIRSA-N cyclacillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C1(N)CCCCC1 HGBLNBBNRORJKI-WCABBAIRSA-N 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- ZAKOWWREFLAJOT-UHFFFAOYSA-N d-alpha-Tocopheryl acetate Natural products CC(=O)OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C ZAKOWWREFLAJOT-UHFFFAOYSA-N 0.000 description 1
- 230000000254 damaging effect Effects 0.000 description 1
- 229960004385 danofloxacin Drugs 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 229940073499 decyl glucoside Drugs 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000018044 dehydration Effects 0.000 description 1
- 238000006297 dehydration reaction Methods 0.000 description 1
- 229960005319 delavirdine Drugs 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 239000002781 deodorant agent Substances 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 229960001378 dequalinium chloride Drugs 0.000 description 1
- LTNZEXKYNRNOGT-UHFFFAOYSA-N dequalinium chloride Chemical compound [Cl-].[Cl-].C1=CC=C2[N+](CCCCCCCCCC[N+]3=C4C=CC=CC4=C(N)C=C3C)=C(C)C=C(N)C2=C1 LTNZEXKYNRNOGT-UHFFFAOYSA-N 0.000 description 1
- 229950000330 desciclovir Drugs 0.000 description 1
- 230000001687 destabilization Effects 0.000 description 1
- SOROIESOUPGGFO-UHFFFAOYSA-N diazolidinylurea Chemical compound OCNC(=O)N(CO)C1N(CO)C(=O)N(CO)C1=O SOROIESOUPGGFO-UHFFFAOYSA-N 0.000 description 1
- 229960001083 diazolidinylurea Drugs 0.000 description 1
- 229960004698 dichlorobenzyl alcohol Drugs 0.000 description 1
- YFAGHNZHGGCZAX-JKIFEVAISA-N dicloxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=C(Cl)C=CC=C1Cl YFAGHNZHGGCZAX-JKIFEVAISA-N 0.000 description 1
- 229960001585 dicloxacillin Drugs 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- FDATWRLUYRHCJE-UHFFFAOYSA-N diethylamino hydroxybenzoyl hexyl benzoate Chemical compound CCCCCCOC(=O)C1=CC=CC=C1C(=O)C1=CC=C(N(CC)CC)C=C1O FDATWRLUYRHCJE-UHFFFAOYSA-N 0.000 description 1
- 229960001630 diethylamino hydroxybenzoyl hexyl benzoate Drugs 0.000 description 1
- 229960004960 dioxybenzone Drugs 0.000 description 1
- WLOHNSSYAXHWNR-NXPDYKKBSA-N dirithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H]2O[C@H](COCCOC)N[C@H]([C@@H]2C)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 WLOHNSSYAXHWNR-NXPDYKKBSA-N 0.000 description 1
- 229960004100 dirithromycin Drugs 0.000 description 1
- 235000019301 disodium ethylene diamine tetraacetate Nutrition 0.000 description 1
- GLCJMPWWQKKJQZ-UHFFFAOYSA-L disodium;2-[4-(4,6-disulfonato-1h-benzimidazol-2-yl)phenyl]-1h-benzimidazole-4,6-disulfonate;hydron Chemical compound [Na+].[Na+].C1=C(S(O)(=O)=O)C=C2NC(C3=CC=C(C=C3)C3=NC4=C(C=C(C=C4N3)S(=O)(=O)O)S([O-])(=O)=O)=NC2=C1S([O-])(=O)=O GLCJMPWWQKKJQZ-UHFFFAOYSA-L 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 101150003155 dnaG gene Proteins 0.000 description 1
- QIVLQXGSQSFTIF-UHFFFAOYSA-M docosyl(trimethyl)azanium;methyl sulfate Chemical compound COS([O-])(=O)=O.CCCCCCCCCCCCCCCCCCCCCC[N+](C)(C)C QIVLQXGSQSFTIF-UHFFFAOYSA-M 0.000 description 1
- JBIWCJUYHHGXTC-AKNGSSGZSA-N doxycycline Chemical compound O=C1C2=C(O)C=CC=C2[C@H](C)[C@@H]2C1=C(O)[C@]1(O)C(=O)C(C(N)=O)=C(O)[C@@H](N(C)C)[C@@H]1[C@H]2O JBIWCJUYHHGXTC-AKNGSSGZSA-N 0.000 description 1
- MCPKSFINULVDNX-UHFFFAOYSA-N drometrizole Chemical compound CC1=CC=C(O)C(N2N=C3C=CC=CC3=N2)=C1 MCPKSFINULVDNX-UHFFFAOYSA-N 0.000 description 1
- 229960000979 drometrizole Drugs 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- LXBIFEVIBLOUGU-JGWLITMVSA-N duvoglustat Chemical compound OC[C@H]1NC[C@H](O)[C@@H](O)[C@@H]1O LXBIFEVIBLOUGU-JGWLITMVSA-N 0.000 description 1
- HEAHZSUCFKFERC-UHFFFAOYSA-N ecamsule Chemical compound CC1(C)C2CCC1(CS(O)(=O)=O)C(=O)C2=CC(C=C1)=CC=C1C=C1C(=O)C2(CS(O)(=O)=O)CCC1C2(C)C HEAHZSUCFKFERC-UHFFFAOYSA-N 0.000 description 1
- XPOQHMRABVBWPR-ZDUSSCGKSA-N efavirenz Chemical compound C([C@]1(C2=CC(Cl)=CC=C2NC(=O)O1)C(F)(F)F)#CC1CC1 XPOQHMRABVBWPR-ZDUSSCGKSA-N 0.000 description 1
- 229960003804 efavirenz Drugs 0.000 description 1
- 239000008387 emulsifying waxe Substances 0.000 description 1
- 229960003720 enoxolone Drugs 0.000 description 1
- 229960000655 ensulizole Drugs 0.000 description 1
- UVCJGUGAGLDPAA-UHFFFAOYSA-N ensulizole Chemical compound N1C2=CC(S(=O)(=O)O)=CC=C2N=C1C1=CC=CC=C1 UVCJGUGAGLDPAA-UHFFFAOYSA-N 0.000 description 1
- 229940032049 enterococcus faecalis Drugs 0.000 description 1
- 229950008161 enviroxime Drugs 0.000 description 1
- 229960004697 enzacamene Drugs 0.000 description 1
- 229960002457 epicillin Drugs 0.000 description 1
- RPBAFSBGYDKNRG-NJBDSQKTSA-N epicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CCC=CC1 RPBAFSBGYDKNRG-NJBDSQKTSA-N 0.000 description 1
- 229960003276 erythromycin Drugs 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 229960001617 ethyl hydroxybenzoate Drugs 0.000 description 1
- 235000010228 ethyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004403 ethyl p-hydroxybenzoate Substances 0.000 description 1
- NUVBSKCKDOMJSU-UHFFFAOYSA-N ethylparaben Chemical compound CCOC(=O)C1=CC=C(O)C=C1 NUVBSKCKDOMJSU-UHFFFAOYSA-N 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 239000003925 fat Substances 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- VZPPEUOYDWPUKO-MQWDNKACSA-N fenbenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C=1C=CC=CC=1)OC1=CC=CC=C1 VZPPEUOYDWPUKO-MQWDNKACSA-N 0.000 description 1
- 229950002965 fenbenicillin Drugs 0.000 description 1
- 229950003564 fiacitabine Drugs 0.000 description 1
- 229950008802 fialuridine Drugs 0.000 description 1
- 239000010408 film Substances 0.000 description 1
- 229960002878 flomoxef Drugs 0.000 description 1
- UHRBTBZOWWGKMK-DOMZBBRYSA-N flomoxef Chemical compound O([C@@H]1[C@@](C(N1C=1C(O)=O)=O)(NC(=O)CSC(F)F)OC)CC=1CSC1=NN=NN1CCO UHRBTBZOWWGKMK-DOMZBBRYSA-N 0.000 description 1
- 229960003760 florfenicol Drugs 0.000 description 1
- 229960004273 floxacillin Drugs 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- RFHAOTPXVQNOHP-UHFFFAOYSA-N fluconazole Chemical compound C1=NC=NN1CC(C=1C(=CC(F)=CC=1)F)(O)CN1C=NC=N1 RFHAOTPXVQNOHP-UHFFFAOYSA-N 0.000 description 1
- 229960004884 fluconazole Drugs 0.000 description 1
- 229960000702 flumequine Drugs 0.000 description 1
- 235000021588 free fatty acids Nutrition 0.000 description 1
- SJWWTRQNNRNTPU-ABBNZJFMSA-N fucoxanthin Chemical compound C[C@@]1(O)C[C@@H](OC(=O)C)CC(C)(C)C1=C=C\C(C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)C(=O)C[C@]1(C(C[C@H](O)C2)(C)C)[C@]2(C)O1 SJWWTRQNNRNTPU-ABBNZJFMSA-N 0.000 description 1
- AQLRNQCFQNNMJA-UHFFFAOYSA-N fucoxanthin Natural products CC(=O)OC1CC(C)(C)C(=C=CC(=CC=CC(=CC=CC=C(/C)C=CC=C(/C)C(=O)CC23OC2(C)CC(O)CC3(C)C)C)CO)C(C)(O)C1 AQLRNQCFQNNMJA-UHFFFAOYSA-N 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 229960004675 fusidic acid Drugs 0.000 description 1
- IECPWNUMDGFDKC-MZJAQBGESA-N fusidic acid Chemical compound O[C@@H]([C@@H]12)C[C@H]3\C(=C(/CCC=C(C)C)C(O)=O)[C@@H](OC(C)=O)C[C@]3(C)[C@@]2(C)CC[C@@H]2[C@]1(C)CC[C@@H](O)[C@H]2C IECPWNUMDGFDKC-MZJAQBGESA-N 0.000 description 1
- FOYKKGHVWRFIBD-UHFFFAOYSA-N gamma-tocopherol acetate Natural products CC(=O)OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1 FOYKKGHVWRFIBD-UHFFFAOYSA-N 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 239000003193 general anesthetic agent Substances 0.000 description 1
- 210000004392 genitalia Anatomy 0.000 description 1
- DNYGXMICFMACRA-UHFFFAOYSA-N gentamicin C1A Natural products O1C(CNC)CCC(N)C1OC1C(O)C(OC2C(C(NC)C(C)(O)CO2)O)C(N)CC1N DNYGXMICFMACRA-UHFFFAOYSA-N 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 150000002327 glycerophospholipids Chemical class 0.000 description 1
- 229940075529 glyceryl stearate Drugs 0.000 description 1
- ZBRCAASZBMWIDA-QFPUCQTMSA-N glyconiazide Chemical compound C(/[C@H](O)[C@@H]1[C@@H]([C@H](O)C(=O)O1)O)=N\NC(=O)C1=CC=NC=C1 ZBRCAASZBMWIDA-QFPUCQTMSA-N 0.000 description 1
- 229950007053 glyconiazide Drugs 0.000 description 1
- 235000002532 grape seed extract Nutrition 0.000 description 1
- 235000020688 green tea extract Nutrition 0.000 description 1
- 229940094952 green tea extract Drugs 0.000 description 1
- 230000009036 growth inhibition Effects 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229950007488 guamecycline Drugs 0.000 description 1
- 229960001906 haloprogin Drugs 0.000 description 1
- 229910052864 hemimorphite Inorganic materials 0.000 description 1
- 239000012676 herbal extract Substances 0.000 description 1
- 229960003884 hetacillin Drugs 0.000 description 1
- DXVUYOAEDJXBPY-NFFDBFGFSA-N hetacillin Chemical compound C1([C@@H]2C(=O)N(C(N2)(C)C)[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 DXVUYOAEDJXBPY-NFFDBFGFSA-N 0.000 description 1
- 229960004881 homosalate Drugs 0.000 description 1
- 229940106579 hops extract Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000001906 humulus lupulus l. absolute Substances 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 150000001261 hydroxy acids Chemical class 0.000 description 1
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 description 1
- MPGWGYQTRSNGDD-UHFFFAOYSA-N hypericin Chemical compound OC1=CC(O)=C(C2=O)C3=C1C1C(O)=CC(=O)C(C4=O)=C1C1=C3C3=C2C(O)=CC(C)=C3C2=C1C4=C(O)C=C2C MPGWGYQTRSNGDD-UHFFFAOYSA-N 0.000 description 1
- 229940005608 hypericin Drugs 0.000 description 1
- PHOKTTKFQUYZPI-UHFFFAOYSA-N hypericin Natural products Cc1cc(O)c2c3C(=O)C(=Cc4c(O)c5c(O)cc(O)c6c7C(=O)C(=Cc8c(C)c1c2c(c78)c(c34)c56)O)O PHOKTTKFQUYZPI-UHFFFAOYSA-N 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- ZCTXEAQXZGPWFG-UHFFFAOYSA-N imidurea Chemical compound O=C1NC(=O)N(CO)C1NC(=O)NCNC(=O)NC1C(=O)NC(=O)N1CO ZCTXEAQXZGPWFG-UHFFFAOYSA-N 0.000 description 1
- 229960002182 imipenem Drugs 0.000 description 1
- ZSKVGTPCRGIANV-ZXFLCMHBSA-N imipenem Chemical compound C1C(SCC\N=C\N)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21 ZSKVGTPCRGIANV-ZXFLCMHBSA-N 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 101150077178 infC gene Proteins 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 239000002085 irritant Substances 0.000 description 1
- UDIIBEDMEYAVNG-ZKFPOVNWSA-N isepamicin Chemical compound O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CN)O2)O)[C@@H](N)C[C@H]1NC(=O)[C@@H](O)CN UDIIBEDMEYAVNG-ZKFPOVNWSA-N 0.000 description 1
- 229960000798 isepamicin Drugs 0.000 description 1
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 1
- 229940078545 isocetyl stearate Drugs 0.000 description 1
- 229940100554 isononyl isononanoate Drugs 0.000 description 1
- 229960004144 josamycin Drugs 0.000 description 1
- XJSFLOJWULLJQS-NGVXBBESSA-N josamycin Chemical compound CO[C@H]1[C@H](OC(C)=O)CC(=O)O[C@H](C)C\C=C\C=C\[C@H](O)[C@H](C)C[C@H](CC=O)[C@@H]1O[C@H]1[C@H](O)[C@@H](N(C)C)[C@H](O[C@@H]2O[C@@H](C)[C@H](OC(=O)CC(C)C)[C@](C)(O)C2)[C@@H](C)O1 XJSFLOJWULLJQS-NGVXBBESSA-N 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 229960004125 ketoconazole Drugs 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- 239000004310 lactic acid Substances 0.000 description 1
- 229960000433 latamoxef Drugs 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 101150063482 lepA gene Proteins 0.000 description 1
- 229960005287 lincomycin Drugs 0.000 description 1
- OJMMVQQUTAEWLP-KIDUDLJLSA-N lincomycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@@H](C)O)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 OJMMVQQUTAEWLP-KIDUDLJLSA-N 0.000 description 1
- 108010051201 lipid I Proteins 0.000 description 1
- ULXTYUPMJXVUHQ-OVTFQNCVSA-N lipid II Chemical compound OC(=O)[C@@H](C)NC(=O)[C@@H](C)NC(=O)[C@H](CCCCN)NC(=O)CC[C@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]1[C@@H](NC(C)=O)[C@@H](OP(O)(=O)OP(O)(=O)OC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(/C)CC\C=C(/C)CCC=C(C)C)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O)[C@@H](CO)O1 ULXTYUPMJXVUHQ-OVTFQNCVSA-N 0.000 description 1
- 230000003859 lipid peroxidation Effects 0.000 description 1
- KBEMFSMODRNJHE-JFWOZONXSA-N lodenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)C[C@@H]1F KBEMFSMODRNJHE-JFWOZONXSA-N 0.000 description 1
- ZEKZLJVOYLTDKK-UHFFFAOYSA-N lomefloxacin Chemical compound FC1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCNC(C)C1 ZEKZLJVOYLTDKK-UHFFFAOYSA-N 0.000 description 1
- 229960002422 lomefloxacin Drugs 0.000 description 1
- 229960001977 loracarbef Drugs 0.000 description 1
- JAPHQRWPEGVNBT-UTUOFQBUSA-N loracarbef Chemical compound C1([C@H](C(=O)N[C@@H]2C(N3C(=C(Cl)CC[C@@H]32)C([O-])=O)=O)[NH3+])=CC=CC=C1 JAPHQRWPEGVNBT-UTUOFQBUSA-N 0.000 description 1
- IQPNAANSBPBGFQ-UHFFFAOYSA-N luteolin Chemical compound C=1C(O)=CC(O)=C(C(C=2)=O)C=1OC=2C1=CC=C(O)C(O)=C1 IQPNAANSBPBGFQ-UHFFFAOYSA-N 0.000 description 1
- 235000009498 luteolin Nutrition 0.000 description 1
- LRDGATPGVJTWLJ-UHFFFAOYSA-N luteolin Natural products OC1=CC(O)=CC(C=2OC3=CC(O)=CC(O)=C3C(=O)C=2)=C1 LRDGATPGVJTWLJ-UHFFFAOYSA-N 0.000 description 1
- 229960004196 lymecycline Drugs 0.000 description 1
- AHEVKYYGXVEWNO-UEPZRUIBSA-N lymecycline Chemical compound C1=CC=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(O)=C(C(=O)NCNCCCC[C@H](N)C(O)=O)C(=O)[C@@]4(O)C(O)=C3C(=O)C2=C1O AHEVKYYGXVEWNO-UEPZRUIBSA-N 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 230000003061 melanogenesis Effects 0.000 description 1
- SOXAGEOHPCXXIO-DVOMOZLQSA-N menthyl anthranilate Chemical compound CC(C)[C@@H]1CC[C@@H](C)C[C@H]1OC(=O)C1=CC=CC=C1N SOXAGEOHPCXXIO-DVOMOZLQSA-N 0.000 description 1
- 229960002248 meradimate Drugs 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 238000002705 metabolomic analysis Methods 0.000 description 1
- 230000001431 metabolomic effect Effects 0.000 description 1
- 229960003806 metampicillin Drugs 0.000 description 1
- FZECHKJQHUVANE-MCYUEQNJSA-N metampicillin Chemical compound C1([C@@H](N=C)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 FZECHKJQHUVANE-MCYUEQNJSA-N 0.000 description 1
- 229940042016 methacycline Drugs 0.000 description 1
- MHIGBKBJSQVXNH-IWVLMIASSA-N methacycline Chemical compound C=C([C@H]1[C@@H]2O)C3=CC=CC(O)=C3C(=O)C1=C(O)[C@@]1(O)[C@@H]2[C@H](N(C)C)C(O)=C(C(N)=O)C1=O MHIGBKBJSQVXNH-IWVLMIASSA-N 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 229960002285 methylbenzethonium chloride Drugs 0.000 description 1
- WPHGSKGZRAQSGP-UHFFFAOYSA-N methylenecyclohexane Natural products C1CCCC2CC21 WPHGSKGZRAQSGP-UHFFFAOYSA-N 0.000 description 1
- HRHKSTOGXBBQCB-VFWICMBZSA-N methylmitomycin Chemical compound O=C1C(N)=C(C)C(=O)C2=C1[C@@H](COC(N)=O)[C@@]1(OC)[C@H]3N(C)[C@H]3CN12 HRHKSTOGXBBQCB-VFWICMBZSA-N 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- YPBATNHYBCGSSN-VWPFQQQWSA-N mezlocillin Chemical compound N([C@@H](C(=O)N[C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C=1C=CC=CC=1)C(=O)N1CCN(S(C)(=O)=O)C1=O YPBATNHYBCGSSN-VWPFQQQWSA-N 0.000 description 1
- 229960000198 mezlocillin Drugs 0.000 description 1
- 229960002509 miconazole Drugs 0.000 description 1
- 239000004200 microcrystalline wax Substances 0.000 description 1
- 235000019808 microcrystalline wax Nutrition 0.000 description 1
- 229960004744 micronomicin Drugs 0.000 description 1
- 229960002757 midecamycin Drugs 0.000 description 1
- 229950007764 mikamycin Drugs 0.000 description 1
- 229940042472 mineral oil Drugs 0.000 description 1
- 238000005065 mining Methods 0.000 description 1
- 229960004023 minocycline Drugs 0.000 description 1
- DYKFCLLONBREIL-KVUCHLLUSA-N minocycline Chemical compound C([C@H]1C2)C3=C(N(C)C)C=CC(O)=C3C(=O)C1=C(O)[C@@]1(O)[C@@H]2[C@H](N(C)C)C(O)=C(C(N)=O)C1=O DYKFCLLONBREIL-KVUCHLLUSA-N 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 230000003020 moisturizing effect Effects 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- LPUQAYUQRXPFSQ-DFWYDOINSA-M monosodium L-glutamate Chemical compound [Na+].[O-]C(=O)[C@@H](N)CCC(O)=O LPUQAYUQRXPFSQ-DFWYDOINSA-M 0.000 description 1
- 229960003128 mupirocin Drugs 0.000 description 1
- 229930187697 mupirocin Natural products 0.000 description 1
- DDHVILIIHBIMQU-YJGQQKNPSA-L mupirocin calcium hydrate Chemical compound O.O.[Ca+2].C[C@H](O)[C@H](C)[C@@H]1O[C@H]1C[C@@H]1[C@@H](O)[C@@H](O)[C@H](C\C(C)=C\C(=O)OCCCCCCCCC([O-])=O)OC1.C[C@H](O)[C@H](C)[C@@H]1O[C@H]1C[C@@H]1[C@@H](O)[C@@H](O)[C@H](C\C(C)=C\C(=O)OCCCCCCCCC([O-])=O)OC1 DDHVILIIHBIMQU-YJGQQKNPSA-L 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 229940078812 myristyl myristate Drugs 0.000 description 1
- 229940049292 n-(3-(dimethylamino)propyl)octadecanamide Drugs 0.000 description 1
- JXTPJDDICSTXJX-UHFFFAOYSA-N n-Triacontane Natural products CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC JXTPJDDICSTXJX-UHFFFAOYSA-N 0.000 description 1
- WWVIUVHFPSALDO-UHFFFAOYSA-N n-[3-(dimethylamino)propyl]octadecanamide Chemical compound CCCCCCCCCCCCCCCCCC(=O)NCCCN(C)C WWVIUVHFPSALDO-UHFFFAOYSA-N 0.000 description 1
- GPXLMGHLHQJAGZ-JTDSTZFVSA-N nafcillin Chemical compound C1=CC=CC2=C(C(=O)N[C@@H]3C(N4[C@H](C(C)(C)S[C@@H]43)C(O)=O)=O)C(OCC)=CC=C21 GPXLMGHLHQJAGZ-JTDSTZFVSA-N 0.000 description 1
- 229960000515 nafcillin Drugs 0.000 description 1
- 229960000689 nevirapine Drugs 0.000 description 1
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 description 1
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 1
- 229920000847 nonoxynol Polymers 0.000 description 1
- 101150073438 nusA gene Proteins 0.000 description 1
- 229960000988 nystatin Drugs 0.000 description 1
- VQOXZBDYSJBXMA-NQTDYLQESA-N nystatin A1 Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/CC/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 VQOXZBDYSJBXMA-NQTDYLQESA-N 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- WNIFXKPDILJURQ-JKPOUOEOSA-N octadecyl (2s,4as,6ar,6as,6br,8ar,10s,12as,14br)-10-hydroxy-2,4a,6a,6b,9,9,12a-heptamethyl-13-oxo-3,4,5,6,6a,7,8,8a,10,11,12,14b-dodecahydro-1h-picene-2-carboxylate Chemical compound C1C[C@H](O)C(C)(C)[C@@H]2CC[C@@]3(C)[C@]4(C)CC[C@@]5(C)CC[C@@](C(=O)OCCCCCCCCCCCCCCCCCC)(C)C[C@H]5C4=CC(=O)[C@@H]3[C@]21C WNIFXKPDILJURQ-JKPOUOEOSA-N 0.000 description 1
- KSCKTBJJRVPGKM-UHFFFAOYSA-N octan-1-olate;titanium(4+) Chemical compound [Ti+4].CCCCCCCC[O-].CCCCCCCC[O-].CCCCCCCC[O-].CCCCCCCC[O-] KSCKTBJJRVPGKM-UHFFFAOYSA-N 0.000 description 1
- 229960001679 octinoxate Drugs 0.000 description 1
- 229960003921 octisalate Drugs 0.000 description 1
- FMJSMJQBSVNSBF-UHFFFAOYSA-N octocrylene Chemical group C=1C=CC=CC=1C(=C(C#N)C(=O)OCC(CC)CCCC)C1=CC=CC=C1 FMJSMJQBSVNSBF-UHFFFAOYSA-N 0.000 description 1
- 229960000601 octocrylene Drugs 0.000 description 1
- 229940066429 octoxynol Drugs 0.000 description 1
- 229920002113 octoxynol Polymers 0.000 description 1
- WCJLCOAEJIHPCW-UHFFFAOYSA-N octyl 2-hydroxybenzoate Chemical compound CCCCCCCCOC(=O)C1=CC=CC=C1O WCJLCOAEJIHPCW-UHFFFAOYSA-N 0.000 description 1
- IIGMITQLXAGZTL-UHFFFAOYSA-N octyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCC IIGMITQLXAGZTL-UHFFFAOYSA-N 0.000 description 1
- 230000037312 oily skin Effects 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 229960002351 oleandomycin Drugs 0.000 description 1
- RZPAKFUAFGMUPI-KGIGTXTPSA-N oleandomycin Chemical compound O1[C@@H](C)[C@H](O)[C@@H](OC)C[C@@H]1O[C@@H]1[C@@H](C)C(=O)O[C@H](C)[C@H](C)[C@H](O)[C@@H](C)C(=O)[C@]2(OC2)C[C@H](C)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C RZPAKFUAFGMUPI-KGIGTXTPSA-N 0.000 description 1
- 235000019367 oleandomycin Nutrition 0.000 description 1
- 235000021313 oleic acid Nutrition 0.000 description 1
- DXGLGDHPHMLXJC-UHFFFAOYSA-N oxybenzone Chemical compound OC1=CC(OC)=CC=C1C(=O)C1=CC=CC=C1 DXGLGDHPHMLXJC-UHFFFAOYSA-N 0.000 description 1
- 229960001173 oxybenzone Drugs 0.000 description 1
- 229960000625 oxytetracycline Drugs 0.000 description 1
- IWVCMVBTMGNXQD-PXOLEDIWSA-N oxytetracycline Chemical compound C1=CC=C2[C@](O)(C)[C@H]3[C@H](O)[C@H]4[C@H](N(C)C)C(O)=C(C(N)=O)C(=O)[C@@]4(O)C(O)=C3C(=O)C2=C1O IWVCMVBTMGNXQD-PXOLEDIWSA-N 0.000 description 1
- 235000019366 oxytetracycline Nutrition 0.000 description 1
- 229960002638 padimate o Drugs 0.000 description 1
- HXYVTAGFYLMHSO-UHFFFAOYSA-N palmitoyl ethanolamide Chemical compound CCCCCCCCCCCCCCCC(=O)NCCO HXYVTAGFYLMHSO-UHFFFAOYSA-N 0.000 description 1
- 229940101267 panthenol Drugs 0.000 description 1
- 235000020957 pantothenol Nutrition 0.000 description 1
- 239000011619 pantothenol Substances 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 229960002625 pazufloxacin Drugs 0.000 description 1
- NLOOMWLTUVBWAW-HLLBOEOZSA-N penamecillin Chemical compound N([C@H]1[C@@H]2N(C1=O)[C@H](C(S2)(C)C)C(=O)OCOC(=O)C)C(=O)CC1=CC=CC=C1 NLOOMWLTUVBWAW-HLLBOEOZSA-N 0.000 description 1
- 229960000596 penamecillin Drugs 0.000 description 1
- MIFYHUACUWQUKT-GPUHXXMPSA-N penicillin N Chemical compound OC(=O)[C@H]1C(C)(C)S[C@@H]2[C@H](NC(=O)CCC[C@@H](N)C(O)=O)C(=O)N21 MIFYHUACUWQUKT-GPUHXXMPSA-N 0.000 description 1
- QULKGELYPOJSLP-WCABBAIRSA-N penicillin O Chemical compound OC(=O)[C@H]1C(C)(C)S[C@@H]2[C@H](NC(=O)CSCC=C)C(=O)N21 QULKGELYPOJSLP-WCABBAIRSA-N 0.000 description 1
- 229940056360 penicillin g Drugs 0.000 description 1
- 150000002960 penicillins Chemical class 0.000 description 1
- XDRYMKDFEDOLFX-UHFFFAOYSA-N pentamidine Chemical compound C1=CC(C(=N)N)=CC=C1OCCCCCOC1=CC=C(C(N)=N)C=C1 XDRYMKDFEDOLFX-UHFFFAOYSA-N 0.000 description 1
- 229960004448 pentamidine Drugs 0.000 description 1
- WCVRQHFDJLLWFE-UHFFFAOYSA-N pentane-1,2-diol Chemical compound CCCC(O)CO WCVRQHFDJLLWFE-UHFFFAOYSA-N 0.000 description 1
- QIMGFXOHTOXMQP-GFAGFCTOSA-N peplomycin Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCCN[C@@H](C)C=1C=CC=CC=1)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C QIMGFXOHTOXMQP-GFAGFCTOSA-N 0.000 description 1
- 229950003180 peplomycin Drugs 0.000 description 1
- 230000008447 perception Effects 0.000 description 1
- 101150047627 pgk gene Proteins 0.000 description 1
- 101150079312 pgk1 gene Proteins 0.000 description 1
- 101150095149 pgkA gene Proteins 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- NONJJLVGHLVQQM-JHXYUMNGSA-N phenethicillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C(C)OC1=CC=CC=C1 NONJJLVGHLVQQM-JHXYUMNGSA-N 0.000 description 1
- 229960004894 pheneticillin Drugs 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- 229940057874 phenyl trimethicone Drugs 0.000 description 1
- 229940067107 phenylethyl alcohol Drugs 0.000 description 1
- 229940096826 phenylmercuric acetate Drugs 0.000 description 1
- PDTFCHSETJBPTR-UHFFFAOYSA-N phenylmercuric nitrate Chemical compound [O-][N+](=O)O[Hg]C1=CC=CC=C1 PDTFCHSETJBPTR-UHFFFAOYSA-N 0.000 description 1
- 125000001095 phosphatidyl group Chemical group 0.000 description 1
- 150000003014 phosphoric acid esters Chemical class 0.000 description 1
- 239000000049 pigment Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229960001635 pirlimycin Drugs 0.000 description 1
- BTSZTGGZJQFALU-UHFFFAOYSA-N piroctone olamine Chemical compound NCCO.CC(C)(C)CC(C)CC1=CC(C)=CC(=O)N1O BTSZTGGZJQFALU-UHFFFAOYSA-N 0.000 description 1
- 229940081510 piroctone olamine Drugs 0.000 description 1
- 229960003342 pivampicillin Drugs 0.000 description 1
- ZEMIJUDPLILVNQ-ZXFNITATSA-N pivampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)[C@H](C(S3)(C)C)C(=O)OCOC(=O)C(C)(C)C)=CC=CC=C1 ZEMIJUDPLILVNQ-ZXFNITATSA-N 0.000 description 1
- 101150037544 pnp gene Proteins 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920001993 poloxamer 188 Polymers 0.000 description 1
- 229940044519 poloxamer 188 Drugs 0.000 description 1
- 229920001992 poloxamer 407 Polymers 0.000 description 1
- 229940044476 poloxamer 407 Drugs 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 239000000249 polyoxyethylene sorbitan monopalmitate Substances 0.000 description 1
- 235000010483 polyoxyethylene sorbitan monopalmitate Nutrition 0.000 description 1
- 239000001818 polyoxyethylene sorbitan monostearate Substances 0.000 description 1
- 235000010989 polyoxyethylene sorbitan monostearate Nutrition 0.000 description 1
- 229940100498 polysilicone-15 Drugs 0.000 description 1
- 229920002282 polysilicones-15 Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229940068977 polysorbate 20 Drugs 0.000 description 1
- 229940101027 polysorbate 40 Drugs 0.000 description 1
- 229940113124 polysorbate 60 Drugs 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229940068965 polysorbates Drugs 0.000 description 1
- 229950004406 porfiromycin Drugs 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- DVGGLGXQSFURLP-FIZCXTQCSA-N potengriffioside A Natural products O[C@@H]1[C@@H](COC(=O)C=Cc2ccc(O)cc2)O[C@@H](Oc2c(oc3cc(O)cc(O)c3c2=O)-c2ccc(O)cc2)[C@H](O)[C@H]1O DVGGLGXQSFURLP-FIZCXTQCSA-N 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 229940078491 ppg-15 stearyl ether Drugs 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 239000000473 propyl gallate Substances 0.000 description 1
- 235000010388 propyl gallate Nutrition 0.000 description 1
- 229940075579 propyl gallate Drugs 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- SSKVDVBQSWQEGJ-UHFFFAOYSA-N pseudohypericin Natural products C12=C(O)C=C(O)C(C(C=3C(O)=CC(O)=C4C=33)=O)=C2C3=C2C3=C4C(C)=CC(O)=C3C(=O)C3=C(O)C=C(O)C1=C32 SSKVDVBQSWQEGJ-UHFFFAOYSA-N 0.000 description 1
- 208000029561 pustule Diseases 0.000 description 1
- 150000003856 quaternary ammonium compounds Chemical class 0.000 description 1
- 235000005875 quercetin Nutrition 0.000 description 1
- 229960001285 quercetin Drugs 0.000 description 1
- GPMSLJIYNWBYEL-TYNCELHUSA-N quinacillin Chemical compound C1=CC=C2N=C(C(O)=O)C(C(=O)N[C@H]3[C@H]4SC([C@@H](N4C3=O)C(O)=O)(C)C)=NC2=C1 GPMSLJIYNWBYEL-TYNCELHUSA-N 0.000 description 1
- 229950009721 quinacillin Drugs 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 229960000329 ribavirin Drugs 0.000 description 1
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 1
- 108010037379 ribosome releasing factor Proteins 0.000 description 1
- NSKGQURZWSPSBC-NLZFXWNVSA-N ribostamycin Chemical compound N[C@H]1[C@H](O)[C@@H](O)[C@H](CN)O[C@@H]1O[C@@H]1[C@@H](O[C@H]2[C@@H]([C@@H](O)[C@H](CO)O2)O)[C@H](O)[C@@H](N)C[C@H]1N NSKGQURZWSPSBC-NLZFXWNVSA-N 0.000 description 1
- 229960003485 ribostamycin Drugs 0.000 description 1
- 229930190553 ribostamycin Natural products 0.000 description 1
- NSKGQURZWSPSBC-UHFFFAOYSA-N ribostamycin A Natural products NC1C(O)C(O)C(CN)OC1OC1C(OC2C(C(O)C(CO)O2)O)C(O)C(N)CC1N NSKGQURZWSPSBC-UHFFFAOYSA-N 0.000 description 1
- 229960000885 rifabutin Drugs 0.000 description 1
- 229950003104 rifamide Drugs 0.000 description 1
- JQXXHWHPUNPDRT-WLSIYKJHSA-N rifampicin Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C([O-])=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N1CC[NH+](C)CC1 JQXXHWHPUNPDRT-WLSIYKJHSA-N 0.000 description 1
- 229960001225 rifampicin Drugs 0.000 description 1
- HJYYPODYNSCCOU-ODRIEIDWSA-N rifamycin SV Chemical compound OC1=C(C(O)=C2C)C3=C(O)C=C1NC(=O)\C(C)=C/C=C/[C@H](C)[C@H](O)[C@@H](C)[C@@H](O)[C@@H](C)[C@H](OC(C)=O)[C@H](C)[C@@H](OC)\C=C\O[C@@]1(C)OC2=C3C1=O HJYYPODYNSCCOU-ODRIEIDWSA-N 0.000 description 1
- VFYNXKZVOUXHDX-VDPUEHCXSA-N rifamycin b diethylamide Chemical compound CC1=C(O)C(C=2O)=C3C(OCC(=O)N(CC)CC)=CC=2NC(=O)\C(C)=C/C=C/[C@H](C)[C@H](O)[C@@H](C)[C@@H](O)[C@@H](C)[C@H](OC(C)=O)[C@H](C)[C@@H](OC)\C=C\O[C@@]2(C)OC1=C3C2=O VFYNXKZVOUXHDX-VDPUEHCXSA-N 0.000 description 1
- 229940109171 rifamycin sv Drugs 0.000 description 1
- 229960002599 rifapentine Drugs 0.000 description 1
- WDZCUPBHRAEYDL-GZAUEHORSA-N rifapentine Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C(O)=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N(CC1)CCN1C1CCCC1 WDZCUPBHRAEYDL-GZAUEHORSA-N 0.000 description 1
- 229960003040 rifaximin Drugs 0.000 description 1
- NZCRJKRKKOLAOJ-XRCRFVBUSA-N rifaximin Chemical compound OC1=C(C(O)=C2C)C3=C4N=C5C=C(C)C=CN5C4=C1NC(=O)\C(C)=C/C=C/[C@H](C)[C@H](O)[C@@H](C)[C@@H](O)[C@@H](C)[C@H](OC(C)=O)[C@H](C)[C@@H](OC)\C=C\O[C@@]1(C)OC2=C3C1=O NZCRJKRKKOLAOJ-XRCRFVBUSA-N 0.000 description 1
- 229960000888 rimantadine Drugs 0.000 description 1
- IKQNRQOUOZJHTR-UWBRJAPDSA-N ritipenem Chemical compound S1C(COC(N)=O)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21 IKQNRQOUOZJHTR-UWBRJAPDSA-N 0.000 description 1
- 229950004286 ritipenem Drugs 0.000 description 1
- 229960005009 rolitetracycline Drugs 0.000 description 1
- HMEYVGGHISAPJR-IAHYZSEUSA-N rolitetracycline Chemical compound O=C([C@@]1(O)C(O)=C2[C@@H]([C@](C3=CC=CC(O)=C3C2=O)(C)O)C[C@H]1[C@@H](C=1O)N(C)C)C=1C(=O)NCN1CCCC1 HMEYVGGHISAPJR-IAHYZSEUSA-N 0.000 description 1
- IUPCWCLVECYZRV-JZMZINANSA-N rosaramicin Chemical compound O([C@@H]1[C@@H](C)[C@H](O)CC(=O)O[C@@H]([C@H]([C@@H]2O[C@@]2(C)/C=C/C(=O)[C@H](C)C[C@@H]1CC=O)C)CC)[C@@H]1O[C@H](C)C[C@H](N(C)C)[C@H]1O IUPCWCLVECYZRV-JZMZINANSA-N 0.000 description 1
- 229950001447 rosaramicin Drugs 0.000 description 1
- 229960005224 roxithromycin Drugs 0.000 description 1
- 101150060526 rpl1 gene Proteins 0.000 description 1
- 101150079275 rplA gene Proteins 0.000 description 1
- 101150015255 rplB gene Proteins 0.000 description 1
- 101150077293 rplC gene Proteins 0.000 description 1
- 101150028073 rplD gene Proteins 0.000 description 1
- 101150083684 rplE gene Proteins 0.000 description 1
- 101150034310 rplF gene Proteins 0.000 description 1
- 101150100282 rplK gene Proteins 0.000 description 1
- 101150118024 rplK1 gene Proteins 0.000 description 1
- 101150050931 rplL gene Proteins 0.000 description 1
- 101150104526 rplM gene Proteins 0.000 description 1
- 101150053568 rplP gene Proteins 0.000 description 1
- 101150001987 rplS gene Proteins 0.000 description 1
- 101150071779 rplT gene Proteins 0.000 description 1
- 101150096944 rpmA gene Proteins 0.000 description 1
- 101150047139 rpo1N gene Proteins 0.000 description 1
- 101150085857 rpo2 gene Proteins 0.000 description 1
- 101150029016 rpo3 gene Proteins 0.000 description 1
- 101150037064 rpoA gene Proteins 0.000 description 1
- 101150090202 rpoB gene Proteins 0.000 description 1
- 101150102864 rpoD gene Proteins 0.000 description 1
- 101150078369 rpsB gene Proteins 0.000 description 1
- 101150018028 rpsC gene Proteins 0.000 description 1
- 101150027173 rpsE gene Proteins 0.000 description 1
- 101150103887 rpsJ gene Proteins 0.000 description 1
- 101150061587 rpsS gene Proteins 0.000 description 1
- 235000005713 safflower oil Nutrition 0.000 description 1
- 239000003813 safflower oil Substances 0.000 description 1
- 229950000614 sancycline Drugs 0.000 description 1
- XDVCLKFLRAWGIT-ADOAZJKMSA-N sancycline Chemical compound C([C@H]1C2)C3=CC=CC(O)=C3C(=O)C1=C(O)[C@@]1(O)[C@@H]2[C@H](N(C)C)C(O)=C(C(N)=O)C1=O XDVCLKFLRAWGIT-ADOAZJKMSA-N 0.000 description 1
- 210000002374 sebum Anatomy 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 229960005429 sertaconazole Drugs 0.000 description 1
- 101150117326 sigA gene Proteins 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 239000002210 silicon-based material Substances 0.000 description 1
- 229960005456 sisomicin Drugs 0.000 description 1
- URWAJWIAIPFPJE-YFMIWBNJSA-N sisomycin Chemical compound O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H](CC=C(CN)O2)N)[C@@H](N)C[C@H]1N URWAJWIAIPFPJE-YFMIWBNJSA-N 0.000 description 1
- 244000005714 skin microbiome Species 0.000 description 1
- 101150073293 smpB gene Proteins 0.000 description 1
- 235000010378 sodium ascorbate Nutrition 0.000 description 1
- PPASLZSBLFJQEF-RKJRWTFHSA-M sodium ascorbate Substances [Na+].OC[C@@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RKJRWTFHSA-M 0.000 description 1
- 229960005055 sodium ascorbate Drugs 0.000 description 1
- WXMKPNITSTVMEF-UHFFFAOYSA-M sodium benzoate Chemical compound [Na+].[O-]C(=O)C1=CC=CC=C1 WXMKPNITSTVMEF-UHFFFAOYSA-M 0.000 description 1
- 235000010234 sodium benzoate Nutrition 0.000 description 1
- 239000004299 sodium benzoate Substances 0.000 description 1
- 229940001607 sodium bisulfite Drugs 0.000 description 1
- NRHMKIHPTBHXPF-TUJRSCDTSA-M sodium cholate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 NRHMKIHPTBHXPF-TUJRSCDTSA-M 0.000 description 1
- 229940079781 sodium cocoyl glutamate Drugs 0.000 description 1
- FHHPUSMSKHSNKW-SMOYURAASA-M sodium deoxycholate Chemical compound [Na+].C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 FHHPUSMSKHSNKW-SMOYURAASA-M 0.000 description 1
- 229940010747 sodium hyaluronate Drugs 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 229940048109 sodium methyl cocoyl taurate Drugs 0.000 description 1
- 235000010268 sodium methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- PPASLZSBLFJQEF-RXSVEWSESA-M sodium-L-ascorbate Chemical compound [Na+].OC[C@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RXSVEWSESA-M 0.000 description 1
- YWIVKILSMZOHHF-QJZPQSOGSA-N sodium;(2s,3s,4s,5r,6r)-6-[(2s,3r,4r,5s,6r)-3-acetamido-2-[(2s,3s,4r,5r,6r)-6-[(2r,3r,4r,5s,6r)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2- Chemical compound [Na+].CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 YWIVKILSMZOHHF-QJZPQSOGSA-N 0.000 description 1
- PESXGULMKCKJCC-UHFFFAOYSA-M sodium;4-methoxycarbonylphenolate Chemical compound [Na+].COC(=O)C1=CC=C([O-])C=C1 PESXGULMKCKJCC-UHFFFAOYSA-M 0.000 description 1
- CRPCXAMJWCDHFM-UHFFFAOYSA-M sodium;5-oxopyrrolidine-2-carboxylate Chemical compound [Na+].[O-]C(=O)C1CCC(=O)N1 CRPCXAMJWCDHFM-UHFFFAOYSA-M 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- DZZWHBIBMUVIIW-DTORHVGOSA-N sparfloxacin Chemical compound C1[C@@H](C)N[C@@H](C)CN1C1=C(F)C(N)=C2C(=O)C(C(O)=O)=CN(C3CC3)C2=C1F DZZWHBIBMUVIIW-DTORHVGOSA-N 0.000 description 1
- 229960004954 sparfloxacin Drugs 0.000 description 1
- 229960000268 spectinomycin Drugs 0.000 description 1
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 1
- 150000003408 sphingolipids Chemical class 0.000 description 1
- 229940032094 squalane Drugs 0.000 description 1
- 229960001203 stavudine Drugs 0.000 description 1
- 229940114926 stearate Drugs 0.000 description 1
- 229940098760 steareth-2 Drugs 0.000 description 1
- 229940100459 steareth-20 Drugs 0.000 description 1
- WNIFXKPDILJURQ-UHFFFAOYSA-N stearyl glycyrrhizinate Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C)CCC5(C)CCC(C(=O)OCCCCCCCCCCCCCCCCCC)(C)CC5C4=CC(=O)C3C21C WNIFXKPDILJURQ-UHFFFAOYSA-N 0.000 description 1
- 239000002294 steroidal antiinflammatory agent Substances 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 229960004932 sulbenicillin Drugs 0.000 description 1
- CXVGEDCSTKKODG-UHFFFAOYSA-N sulisobenzone Chemical compound C1=C(S(O)(=O)=O)C(OC)=CC(O)=C1C(=O)C1=CC=CC=C1 CXVGEDCSTKKODG-UHFFFAOYSA-N 0.000 description 1
- 229960000368 sulisobenzone Drugs 0.000 description 1
- OPYGFNJSCUDTBT-PMLPCWDUSA-N sultamicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(=O)OCOC(=O)[C@H]2C(S(=O)(=O)[C@H]3N2C(C3)=O)(C)C)(C)C)=CC=CC=C1 OPYGFNJSCUDTBT-PMLPCWDUSA-N 0.000 description 1
- 229960001326 sultamicillin Drugs 0.000 description 1
- FIAFUQMPZJWCLV-UHFFFAOYSA-N suramin Chemical compound OS(=O)(=O)C1=CC(S(O)(=O)=O)=C2C(NC(=O)C3=CC=C(C(=C3)NC(=O)C=3C=C(NC(=O)NC=4C=C(C=CC=4)C(=O)NC=4C(=CC=C(C=4)C(=O)NC=4C5=C(C=C(C=C5C(=CC=4)S(O)(=O)=O)S(O)(=O)=O)S(O)(=O)=O)C)C=CC=3)C)=CC=C(S(O)(=O)=O)C2=C1 FIAFUQMPZJWCLV-UHFFFAOYSA-N 0.000 description 1
- 229960005314 suramin Drugs 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 229960002780 talampicillin Drugs 0.000 description 1
- SOROUYSPFADXSN-SUWVAFIASA-N talampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(=O)OC2C3=CC=CC=C3C(=O)O2)(C)C)=CC=CC=C1 SOROUYSPFADXSN-SUWVAFIASA-N 0.000 description 1
- 229940111630 tea tree oil Drugs 0.000 description 1
- 239000010677 tea tree oil Substances 0.000 description 1
- 229960001608 teicoplanin Drugs 0.000 description 1
- 229960001114 temocillin Drugs 0.000 description 1
- BVCKFLJARNKCSS-DWPRYXJFSA-N temocillin Chemical compound N([C@]1(OC)C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C(C(O)=O)C=1C=CSC=1 BVCKFLJARNKCSS-DWPRYXJFSA-N 0.000 description 1
- IWVCMVBTMGNXQD-UHFFFAOYSA-N terramycin dehydrate Natural products C1=CC=C2C(O)(C)C3C(O)C4C(N(C)C)C(O)=C(C(N)=O)C(=O)C4(O)C(O)=C3C(=O)C2=C1O IWVCMVBTMGNXQD-UHFFFAOYSA-N 0.000 description 1
- OFVLGDICTFRJMM-WESIUVDSSA-N tetracycline Chemical compound C1=CC=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(O)=C(C(N)=O)C(=O)[C@@]4(O)C(O)=C3C(=O)C2=C1O OFVLGDICTFRJMM-WESIUVDSSA-N 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- DZKXJUASMGQEMA-UHFFFAOYSA-N tetradecyl tetradecanoate Chemical compound CCCCCCCCCCCCCCOC(=O)CCCCCCCCCCCCC DZKXJUASMGQEMA-UHFFFAOYSA-N 0.000 description 1
- 229940119168 tetrahexyldecyl ascorbate Drugs 0.000 description 1
- OULAJFUGPPVRBK-UHFFFAOYSA-N tetratriacontyl alcohol Natural products CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCO OULAJFUGPPVRBK-UHFFFAOYSA-N 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 239000012749 thinning agent Substances 0.000 description 1
- 150000003568 thioethers Chemical class 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 229960004885 tiamulin Drugs 0.000 description 1
- UURAUHCOJAIIRQ-QGLSALSOSA-N tiamulin Chemical compound CCN(CC)CCSCC(=O)O[C@@H]1C[C@@](C)(C=C)[C@@H](O)[C@H](C)[C@@]23CC[C@@H](C)[C@]1(C)[C@@H]2C(=O)CC3 UURAUHCOJAIIRQ-QGLSALSOSA-N 0.000 description 1
- 229960004659 ticarcillin Drugs 0.000 description 1
- OHKOGUYZJXTSFX-KZFFXBSXSA-N ticarcillin Chemical compound C=1([C@@H](C(O)=O)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)C=CSC=1 OHKOGUYZJXTSFX-KZFFXBSXSA-N 0.000 description 1
- VAMSVIZLXJOLHZ-QWFSEIHXSA-N tigemonam Chemical compound O=C1N(OS(O)(=O)=O)C(C)(C)[C@@H]1NC(=O)C(=N/OCC(O)=O)\C1=CSC(N)=N1 VAMSVIZLXJOLHZ-QWFSEIHXSA-N 0.000 description 1
- 229950010206 tigemonam Drugs 0.000 description 1
- LTRRTGCXRIMDTF-UHFFFAOYSA-N tiliroside Natural products OC1C(COC(=O)C=Cc2ccc(O)cc2)OC(OC3=C(Oc4cc(O)cc(O)c4C3)c5ccc(O)c(O)c5)C(O)C1O LTRRTGCXRIMDTF-UHFFFAOYSA-N 0.000 description 1
- 229960000223 tilmicosin Drugs 0.000 description 1
- JTSDBFGMPLKDCD-XVFHVFLVSA-N tilmicosin Chemical compound O([C@@H]1[C@@H](C)[C@H](O)CC(=O)O[C@@H]([C@H](/C=C(\C)/C=C/C(=O)[C@H](C)C[C@@H]1CCN1C[C@H](C)C[C@H](C)C1)CO[C@H]1[C@@H]([C@H](OC)[C@H](O)[C@@H](C)O1)OC)CC)[C@@H]1O[C@H](C)[C@@H](O)[C@H](N(C)C)[C@H]1O JTSDBFGMPLKDCD-XVFHVFLVSA-N 0.000 description 1
- 239000004408 titanium dioxide Substances 0.000 description 1
- 229960005196 titanium dioxide Drugs 0.000 description 1
- 229960000707 tobramycin Drugs 0.000 description 1
- NLVFBUXFDBBNBW-PBSUHMDJSA-N tobramycin Chemical compound N[C@@H]1C[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N NLVFBUXFDBBNBW-PBSUHMDJSA-N 0.000 description 1
- 239000011732 tocopherol Substances 0.000 description 1
- 229930003799 tocopherol Natural products 0.000 description 1
- 125000002640 tocopherol group Chemical class 0.000 description 1
- 235000019149 tocopherols Nutrition 0.000 description 1
- FUSNMLFNXJSCDI-UHFFFAOYSA-N tolnaftate Chemical compound C=1C=C2C=CC=CC2=CC=1OC(=S)N(C)C1=CC=CC(C)=C1 FUSNMLFNXJSCDI-UHFFFAOYSA-N 0.000 description 1
- 229960004880 tolnaftate Drugs 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 229940025703 topical product Drugs 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- DVGGLGXQSFURLP-VWMSDXGPSA-N tribuloside Chemical compound C([C@@H]1[C@H]([C@@H]([C@@H](O)[C@H](OC=2C(C3=C(O)C=C(O)C=C3OC=2C=2C=CC(O)=CC=2)=O)O1)O)O)OC(=O)\C=C\C1=CC=C(O)C=C1 DVGGLGXQSFURLP-VWMSDXGPSA-N 0.000 description 1
- LINXHFKHZLOLEI-UHFFFAOYSA-N trimethyl-[phenyl-bis(trimethylsilyloxy)silyl]oxysilane Chemical compound C[Si](C)(C)O[Si](O[Si](C)(C)C)(O[Si](C)(C)C)C1=CC=CC=C1 LINXHFKHZLOLEI-UHFFFAOYSA-N 0.000 description 1
- ZQTYRTSKQFQYPQ-UHFFFAOYSA-N trisiloxane Chemical compound [SiH3]O[SiH2]O[SiH3] ZQTYRTSKQFQYPQ-UHFFFAOYSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- UEVAMYPIMMOEFW-UHFFFAOYSA-N trolamine salicylate Chemical compound OCCN(CCO)CCO.OC(=O)C1=CC=CC=C1O UEVAMYPIMMOEFW-UHFFFAOYSA-N 0.000 description 1
- 229940030300 trolamine salicylate Drugs 0.000 description 1
- 229960000497 trovafloxacin Drugs 0.000 description 1
- WVPSKSLAZQPAKQ-CDMJZVDBSA-N trovafloxacin Chemical compound C([C@H]1[C@@H]([C@H]1C1)N)N1C(C(=CC=1C(=O)C(C(O)=O)=C2)F)=NC=1N2C1=CC=C(F)C=C1F WVPSKSLAZQPAKQ-CDMJZVDBSA-N 0.000 description 1
- 239000012137 tryptone Substances 0.000 description 1
- 101150033948 tsf gene Proteins 0.000 description 1
- 229960004059 tylosin Drugs 0.000 description 1
- WBPYTXDJUQJLPQ-VMXQISHHSA-N tylosin Chemical compound O([C@@H]1[C@@H](C)O[C@H]([C@@H]([C@H]1N(C)C)O)O[C@@H]1[C@@H](C)[C@H](O)CC(=O)O[C@@H]([C@H](/C=C(\C)/C=C/C(=O)[C@H](C)C[C@@H]1CC=O)CO[C@H]1[C@@H]([C@H](OC)[C@H](O)[C@@H](C)O1)OC)CC)[C@H]1C[C@@](C)(O)[C@@H](O)[C@H](C)O1 WBPYTXDJUQJLPQ-VMXQISHHSA-N 0.000 description 1
- 235000019375 tylosin Nutrition 0.000 description 1
- 229960002703 undecylenic acid Drugs 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 150000003672 ureas Chemical class 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 229960003636 vidarabine Drugs 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 235000019155 vitamin A Nutrition 0.000 description 1
- 239000011719 vitamin A Substances 0.000 description 1
- 235000019163 vitamin B12 Nutrition 0.000 description 1
- 239000011715 vitamin B12 Substances 0.000 description 1
- 150000003710 vitamin D derivatives Chemical class 0.000 description 1
- 235000019165 vitamin E Nutrition 0.000 description 1
- 239000011709 vitamin E Substances 0.000 description 1
- 235000019168 vitamin K Nutrition 0.000 description 1
- 239000011712 vitamin K Substances 0.000 description 1
- 229940046008 vitamin d Drugs 0.000 description 1
- 239000007762 w/o emulsion Substances 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 239000003871 white petrolatum Substances 0.000 description 1
- 229940118846 witch hazel Drugs 0.000 description 1
- 239000000230 xanthan gum Substances 0.000 description 1
- 229920001285 xanthan gum Polymers 0.000 description 1
- 235000010493 xanthan gum Nutrition 0.000 description 1
- 229940082509 xanthan gum Drugs 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
- 229960001296 zinc oxide Drugs 0.000 description 1
- CPYIZQLXMGRKSW-UHFFFAOYSA-N zinc;iron(3+);oxygen(2-) Chemical compound [O-2].[O-2].[O-2].[O-2].[Fe+3].[Fe+3].[Zn+2] CPYIZQLXMGRKSW-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/10—Anti-acne agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms, e.g. protozoa; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/20—Bacteria; Culture media therefor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the skin is the largest organ in the human body and functions as the first line of defense by providing a protective barrier between the environment and inner body.
- the skin harbors several hundreds of resident microorganisms, which function in communities and protect the body from invasion of pathogens. Several studies have shown that shifts in the skin microbiota are associated with various skin diseases.
- compositions useful in the treatment of infections caused by Gram-positive bacteria are provided herein.
- methods of treating or preventing a disease or condition e.g., a skin disease or a disease associated with bacteria disclosed herein
- a composition comprising agent X e.g., a skin disease or a disease associated with bacteria disclosed herein
- a composition comprising agent X e.g., a skin disease or a disease associated with bacteria disclosed herein
- a composition comprising a bacteria (or strain thereof) comprising Locus 4 e.g., a P. acnes or P.
- the methods comprise administering to the subject a composition comprising a Propionibacterium bacterium that expresses agent X to the subject.
- compositions or agent X e.g., agent X
- a composition comprising a strain of bacteria comprising Locus 4 e.g., a P. acnes or P. avidum strain comprising Locus 4
- a composition comprising a strain of bacteria that expresses a peptides of any one of SEQ ID NOs: 1-5 or 7-14 to the subject e.g., a P. acnes or P. avidum strain comprising Locus 4
- a composition comprising a strain of bacteria that expresses a peptides of any one of SEQ ID NOs: 1-5 or 7-14 to the subject.
- compositions disclosed herein may comprise live, replication competent bacteria.
- compositions disclosed herein may be heat treated, tyndallized and/or supernatant-derived.
- compositions comprising agent X to the subject or administering a composition comprising a Propionibacterium bacterium that expresses agent X to the subject.
- Agent X may be encoded by Locus 4.
- Agent X may comprise at least one (e.g., at least two, at least three, at least four, at least five, at least six, or at least seven) peptide with an amino acid sequence with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with the nucleic acid sequence of Locus 4.
- at least one e.g., at least two, at least three, at least four, at least five, at least six, or at least seven
- Agent X may comprise at least one (e.g., at least two, at least three, at least four, at least five, at least six, or at least seven) peptide with an amino acid sequence with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least
- the strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with any one of SEQ ID NOs: 1-5 or 7-14.
- the strain of bacteria may be any strain which comprises Locus 4.
- the strain of bacteria may be any strain that expresses at least one amino acid sequence set forth in SEQ ID NOs: 1-5 or 7-14.
- the strain of bacteria may be any strain that comprises at least one nucleic acid sequence set forth in SEQ ID NOs: 6, 15 or any other sequence disclosed herein.
- Exemplary Propionibacterium bacterium strains for use in the methods and compositions provided herein include, but are not limited to, HL037PA1, HL078PA1, HL053PA2, HL082PA1, HL086PA1, HL092PA1, HL110PA1, HL110PA2, HL030PA2, HL030PA1, HL063PA2, PV-66, Type IA2 P.acnl7, HL097PA1, PRP-38, 5 U 42AFAA, HL082PA2 (e.g., P. acnes strains).
- Exemplary Propionibacterium bacterium strains for use in the methods and compositions provided herein also include, but are not limited to HL083PV1 or HGH0353 (e.g., P. avidum strains).
- the strain may be any strain in Figures 1-7 disclosed herein.
- compositions provided herein may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of the bacterial strains provided herein.
- the compositions provided herein may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of any bacterial strain that comprises Locus 4, or at least one bacterial strain that encodes for at least one peptide with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with the nucleic acid sequence of Locus 4.
- the strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with any amino acid sequence set forth in SEQ ID NOs; 1-5 or 7-14, or any bacterial strain that produces agent X.
- compositions provided herein may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of any bacterial strain that comprises Locus 4, or at least one bacterial strain that comprises a nucleic acid sequence with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with the nucleic acid sequence of Locus 4.
- the strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with any nucleic acid sequence set forth in SEQ ID NOs; 6 or 15, or any other sequence disclosed herein.
- the strain of bacteria may be any strain that produces or expresses a peptide with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with the nucleic acid sequence of Locus 4.
- the strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with at least one amino acid sequence set forth in SEQ ID NOs: 1-5 or 7-14.
- any strain of bacteria that that produces or encodes a peptide encoded in SEQ ID Nos: 1-5 or 7-14 includes any bacterial strain that produces or encodes a peptide with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with the nucleic acid sequence of Locus 4.
- the strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with at least one amino acid sequence set forth in SEQ ID NOs: 1-5 or 7-14.
- the strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with at least one nucleic acid sequence set forth in herein (e.g,. SEQ ID NOs: 6 or 15).
- the Propionibacterium (recently renamed to Cutibacterium) bacterium may be P. acnes.
- the Propionibacterium bacterium may be P. avidum.
- the disease is a caused by Gram-positive bacteria.
- the Gram-positive bacteria may be
- the Gram positive bacteria may be Enterococcus, such as Vancomycin-resistant Enterococcus (VRE).
- the Gram-positive bacteria may be Streptococcus , such as Group A Streptococcus (GAS).
- the Gram-positive bacteria may be C. difficle.
- the Gram-positive bacteria may be
- Streptococcus such as Group A Streptococcus (GAS).
- GAS Group A Streptococcus
- the Gram-positive bacteria may be P. acnes, P. avidum, P. granulosum, or P. humerusii.
- the disease may be a skin disease.
- the disease may be a skin disease or any other disease associated with inflammation (e.g., atopic dermatitis or acne).
- provided herein are methods of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof by administering a composition comprising a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), a composition comprising a strain of bacteria that expresses any one of SEQ ID NOs: 1-5 or 7-14, a composition comprising a strain of bacteria that comprises an nucleic acid set forth in SEQ ID NO: 6, 15 or any nucleic acid disclosed herein, or a composition comprising agent X to the subject.
- Propionibacterium bacterium that expresses agent X to the subject.
- provided herein are methods of reducing the levels of a Gram positive bacteria in a subject or on a subject’s skin in need thereof by administering a composition comprising agent X to the subject.
- reducing the levels of a Gram-positive bacteria in or on a subject in need thereof by administering a composition comprising a Propionibacterium bacterium that produces agent X to the subject, a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P.
- the Propionibacterium bacterium may be P. acnes.
- the Propionibacterium bacterium may be P. avidum.
- the Gram positive bacteria may be Staphylococcus, such as Methicillin-resistant Staphylococcus aureus (MRSA).
- MRSA Methicillin-resistant Staphylococcus aureus
- VRE Vancomycin- resistant Enterococcus
- the Gram positive bacteria is Streptococcus , such as Group A Streptococcus (GAS).
- GAS Group A Streptococcus
- the subject has a skin disease associated with inflammation (e.g., atopic dermatitis or acne).
- the Gram-positive bacteria is Clostridium difficile.
- Agent X may be a microbial peptide encoded by Locus 4.
- Agent X may comprise a least one peptide with an amino acid sequence of any one of SEQ ID NOs: 1-5 or 7-14 (e.g., agent X may comprise at least one peptide with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology to any one of SEQ ID NOs: 1-5 or 7-14).
- Agent X may comprise a peptide encoded by a nucleic acid sequence of any one of SEQ ID NOs: 6, 15 or any other sequence disclosed herein (e.g., agent X may comprise at least one nucleic acid with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology to any one of SEQ ID NOs: 6, 15, or any other sequence disclosed herein).
- Agent X may be a lantibiotic.
- Agent X may be expressed by Propionibacterium bacterium. The
- Propionibacterium bacterium may be P. acnes (e.g., RT8, RT3, RT1, and RT5 P. acnes strains or P. acnes belongs to the IB-1, IB2, and IC clades).
- the Propionibacterium bacterium may be P. avidum.
- the composition further comprises an antibiotic.
- the composition is formulated for topical delivery.
- the composition is formulated for oral deliver ⁇ ' .
- the subject is human.
- each composition comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of the bacterial strains provided herein.
- Each composition to be administered may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of any bacterial strain that comprises Locus 4, encodes for at least one peptide with at least 50% homology to any amino acid sequence set forth in SEQ ID Nos: 1-5 or 7- 14, comprises homology with any nucleic acid sequence disclosed herein, or any bacterial strain that produces agent X.
- compositions may be administered concurrently or sequentially.
- the compositions may be administered conjointly.
- Locus 4 may comprise at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with SEQ ID NO: 6, 15 or any other nucleic acid sequence disclosed herein.
- agents and/or compositions of the invention may be used alone or conjointly administered with another type of therapeutic agent and/or a second composition disclosed herein.
- the phrase“conjoint administration” refers to any form of administration of two or more different therapeutic agents such that the second agent is administered while the previously administered therapeutic agent is still effective in the body ( e.g ., the two agents are simultaneously effective in the subject, which may include synergistic effects of the two agents).
- the different therapeutic agents can be administered either in the same formulation or in separate formulations, either concomitantly or sequentially.
- the different therapeutic agents can be administered within about one hour, about 12 hours, about 24 hours, about 36 hours, about 48 hours, about 72 hours, or about a week of one another.
- a subject who receives such treatment can benefit from a combined effect of different therapeutic agents.
- the methods provided herein include further conjoint administration of a composition (e.g., a pharmaceutical or cosmetic composition) comprising iron and/or cobalt to the subject.
- a composition e.g., a pharmaceutical or cosmetic composition
- the subject that receives conjoint administration has a skin disease (e.g., inflammatory skin disease, such as acne, rosacea, psoriasis, or Porphyria Cutanea Tarda (PCT)).
- a skin disease e.g., inflammatory skin disease, such as acne, rosacea, psoriasis, or Porphyria Cutanea Tarda (PCT)
- compositions related to treating or preventing a skin disease e.g., inflammatory skin disease, such as acne, psoriasis, rosacea, or Porphyria Cutanea Tarda (PCT)
- a skin disease e.g., inflammatory skin disease, such as acne, psoriasis, rosacea, or Porphyria Cutanea Tarda (PCT)
- PCT Porphyria Cutanea Tarda
- the compositions disclosed herein may be administered conjointly with a composition comprising iron and/or cobalt.
- the subject is in need of reducing the level porphyrins (e.g., bacterially derived porphyrins) on the skin of a subject by administering (e.g., a subject with symptoms of skin aging, or a subject with a skin condition, such as a skin disease associated with inflammation, acne, psoriasis, rosacea, PCT, or any other skin disease disclosed herein) a composition disclosed herein to the subject.
- the porphyrins may be produced by P. acnes (e.g., acne-associated strains of P. acnes).
- the porphyrins may be produced by P. granulosum, P. avidum , orP.
- humerusii e.g., disease-associated strains of P. granulosum, P. avidum, or P. humerusii ).
- the composition may be administered conjointly with a compositions comprising iron and/or cobalt.
- Figure 1 shows the Locus 4 region of P. acnes encodes Pilosebin L4, a type III lantibiotic. Genes found in locus 4 are colored by their corresponding KEGG Orthology assignments. HL030PA2 strain of P. acnes is used as a representative, with gene numbers corresponding to locus tag ID (HMPREF9602 0XXXX). The type III lantibiotic gene cluster detected by BAGEL3 is underlined.
- Figure 2 shows a phylogenetic tree highlighting taxa within the Actinomycetales order that encode for the lantibiotic from locus 4. .
- the lantibiotic gene cluster is restricted to P. acnes and P. avidum lineages.
- Figure 3 shows that Pilosebin L4 producers can inhibit a broad range of Gram - positive bacteria, but not Gram -negative bacteria.
- Inhibitory activity of PL4 produced from 10 P. acnes strains (RT1, RT8, RT3, and RT5 strains) and 1 P. avidum strain (shown in columns) against 17 P. acne s strains , 3 other Propionibacterium species, and multiple Gram-positive species (shown in rows) were measured.
- the sizes of the inhibition zones (mm) are colored as a gradient with black boxes indicating highest inhibition, and white boxes indicating no inhibition.
- P. acnes strain HL037PA1 which does not encode PilosebinL4, is shown as a negative control.
- Figure 4 shows P. acnes strains containing L4 locus inhibit the growth of
- PilosebinL4-negative P. acnes strains (HL030PA1 is shown here as an example) and other Gram + bacteria.
- Two Staphyloccocus aureus strains, S. aureus 4330 (MRS A) and S. aureus 29213 (MSS A) are shown here as examples.
- Figure 5 shows P. acnes strains containing L4 locus inhibit the growth of
- PilosebinL4-negative P. acnes strains and other Gram + bacteria including Staphyloccocus aureus , Clostridium difficile, and Bacillus subtilis.
- FIG. 6 shows that Pilosebin L4 is regulated by cell density.
- P. acnes. HL030PA2 cultures of decreasing cell densities were used to measure RNA expression levels of the major lantibiotic modification enzyme (LanKC) and the histidine kinase regulatory gene (HISK) in the lantibiotic gene cluster. Expression of both genes were normalized to the single copy housekeeping gene pak and shown as relative expression against undiluted cultures. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.005, ****p ⁇ 0.0005.
- LanKC major lantibiotic modification enzyme
- HISK histidine kinase regulatory gene
- Figure 7 shows bacterial species expressing Pilosebin L4 can outcompete
- PilosebinL4-negative cells in a microbial community Mock communities of PilosebinL4 expressing P. acnes and P. avidum (blue columns) and L4-negative P. acnes strains (grey columns) were mixed in various ratios and combinations (“input” communities). Strain composition after 48 hours of growth was measured (“output” communities) using qPCR and strain-specific primers. *p ⁇ 0.05, ***p ⁇ 0.0005, ****p ⁇ 0.0001.
- Figure 8 shows the changes in expression levels of Locus 4 genes between pure culture and co-culture based on transcriptomic analysis. Upregulation of several genes in a co-culture bacterial community compared to pure culture was observed, suggesting these genes play a role in Pilosebin L4 regulation. Right column co-culture, Left column pure culture.
- FIG. 9 shows Actinomycetales species harboring partial locus 4 genes. Remnants of locus 4 were detected in 7 species, based on BLASTn searches against full, partial, and draft bacterial genomes on IMG. The full locus 4 with the lantibiotic operon is represented by P. acnes HL030PA2. Genes are colored according to their KO assignments. Gene numbers corresponds to locus tag IDs: P. acnes HL030PA2, HMPREF9602 0XXXX; P. acidifaciens DSM 21887, K336DRAFT_0XXXX; Streptomyces .sp. ATexAB-D23, B082DRAFT 0XXXX; Streptomyces sp. 303MFCol5.2, H294DRAFT_0XXXX; K. cheerisanensis KCTC 2395, KCH_XXXX; K. setae KM-6054, KSE_XXXXX;
- FIG 10 shows Locus 4 is integrated in the same genetic loci in P. acnes and P. avidum.
- the genetic loci of locus 4 is displayed with genes flanked on both ends. Locus 4 is not drawn to scale relative to other genes. Genes are colored by their KO assignments.
- bacteriocin a lantibiotic that is uniquely expressed in certain strains of P. acnes and a related skin bacterium, Propionibacterium avidum. This lantibiotic is encoded in a unique genomic region named Locus 4 (Tomida et al ., 2013). Lantibiotics are a type of bacteriocin that can kill other cells in the bacterial community and thus change the population and dynamics of the microbiome.
- the lantibiotic identified in this invention which is named Pilosebin L4 or agent X, can inhibit the growth of a broad range of Gram-positive bacteria, including common skin bacterial species as well as important clinical pathogens such as Methicillin-resistant Staphylococcus aureus (MRSA), Vancomycin-resistant Enterococcus (VRE), Group A Streptococcus (GAS), and
- MRSA Methicillin-resistant Staphylococcus aureus
- VRE Vancomycin-resistant Enterococcus
- GAS Group A Streptococcus
- Clostridium difficile The Gram-positive bacteria may be P. acnes, P. avidum, P.
- P. humerusii disease associated strains of P. acnes, P. avidum, P.
- compositions useful in the treatment of infections caused by Gram-positive bacteria are provided herein.
- methods of treating or preventing a disease e.g., a skin disease, a disease of the GI tract, or any other disease
- a disease e.g., a skin disease, a disease of the GI tract, or any other disease
- methods of treating or preventing a disease e.g., a skin disease, a disease of the GI tract, or any other disease
- a disease e.g., a skin disease, a disease of the GI tract, or any other disease
- provided herein are methods of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof by administering a
- composition comprising agent X to the subject.
- methods of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof by administering a composition comprising a Propionibacterium bacterium that produces agent X, a composition comprising a strain of bacteria that expresses an amino acid of any one of SEQ ID NOs: 1-5 or 7-14, a composition comprising a strain of bacteria that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein, or a Propionibacterium bacterium strain that comprises Locus 4 to the subject.
- kits for reducing the levels of a Gram positive bacteria in the subject or on the skin of a subject in need thereof by administering a composition comprising agent X, a composition comprising a strain of bacteria that expresses at least one amino acid set forth SEQ ID NOs: 1-5 or 7-14, a composition comprising a strain of bacteria that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein and/or a Propionibacterium bacterium strain that comprises Locus 4 to the subject.
- the Gram-positive bacteria may be in or on any site of the body, including, but not limited to, the skin, gastrointestinal tract, mouth, ear, blood, lung, surgical sites, urinary tract, or any other organ of the body.
- “infection” as used herein can refer to an infection on any part of the body, including, but not limited to, the skin, gastrointestinal tract, mouth, ear, blood, lung, surgical sites, urinary tract, or any other organ of the body.
- a composition comprising a Propionibacterium bacterium that expresses agent X and/or a Propionibacterium bacterium strain that comprises Locus 4 to the subject.
- prevention of acne includes, for example, reducing the number of detectable acne lesions in a population of patients receiving a prophylactic treatment relative to an untreated control population, and/or delaying the appearance of detectable lesions in a treated population versus an untreated control population, e.g., by a statistically and/or clinically significant amount.
- prophylactic or“therapeutic” treatment is art-recognized and includes administration to the host of one or more of the subject compositions. If it is administered prior to clinical manifestation of the unwanted condition (e.g., disease or other unwanted state of the host animal) then the treatment is prophylactic (i.e., it protects the host against developing the unwanted condition), whereas if it is administered after manifestation of the unwanted condition, the treatment is therapeutic (i.e., it is intended to diminish, ameliorate, or stabilize the existing unwanted condition or side effects thereof).
- the unwanted condition e.g., disease or other unwanted state of the host animal
- ribotype refers to strains of P. acnes.
- the ribotyped strains were characterized as in Fitz-Gibbon et al. (J. Investigative Dermatology 133:2152-60 (2013)).
- subject refers to a mammal, including, but not limited to, a human or non-human mammal, such as a bovine, equine, canine, ovine, or feline.
- A“ therapeutically effective amount’ of a compound with respect to the subject method of treatment refers to an amount of the compound(s) in a preparation which, when administered as part of a desired dosage regimen (to a mammal, preferably a human) alleviates a symptom, ameliorates a condition, or slows the onset of disease conditions according to clinically acceptable standards for the disorder or condition to be treated or the cosmetic purpose, e.g., at a reasonable benefit/risk ratio applicable to any medical treatment.
- treating includes reversing, reducing, or arresting the symptoms, clinical signs, and underlying pathology of a condition in a manner to improve or stabilize a subject's condition.
- compositions useful in the treatment of infections caused by Gram-positive bacteria are methods and compositions useful in the treatment of infections caused by Gram-positive bacteria.
- methods of treating or preventing a disease e.g., a skin disease or any disease disclosed herein
- a disease e.g., a skin disease or any disease disclosed herein
- methods of treating or preventing a disease in a subject in need thereof by administering a composition comprising agent X to the subject or administering a composition comprising a Propionibacterium bacterium that produces agent X, a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P.
- the infection caused by Gram-positive bacteria may be in or on any site of the body, including, but not limited to, the skin, gastrointestinal tract, mouth, ear, blood, lung, surgical sites, urinary tract, or any other organ of the body.
- provided herein are methods of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof by administering a
- compositions comprising agent X, a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), a composition comprising a strain of bacteria that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein, or a composition comprising a strain of bacteria that expresses any one of SEQ ID NOs: 1-5 or 7-14 to the subject.
- methods of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof by administering a composition comprising a Propionibacterium bacterium that produces agent X, a strain of bacteria comprising Locus 4 (e.g., a P.
- acnes or P. avidum strain comprising Locus 4
- a composition comprising a strain of bacteria that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein, or a composition comprising a strain of bacteria that expresses any one of SEQ ID NOs: 1-5 or 7-14 to the subject.
- provided herein are methods of reducing the levels of a Gram positive bacteria in (e.g., in the GI tract) or on the skin of a subject in need thereof by administering a composition comprising agent X and/or a Propionibacterium bacterium strain that comprises Locus 4 to the subject.
- the skin disease is a caused by Gram-positive bacteria.
- the Gram-positive bacteria may be any Gram-positive bacteria that is pathological.
- the Gram positive bacteria may be Staphylococcus, such as Methicillin-resistant Staphylococcus aureus (MRSA).
- MRSA Methicillin-resistant Staphylococcus aureus
- the Gram-positive bacteria may be Enterococcus, such as Vancomycin-resistant Enterococcus (VRE).
- VRE Vancomycin-resistant Enterococcus
- the Gram-positive bacteria is Streptococcus, such as Group A
- the Gram-positive bacteria may be P. acnes, P. avidum, P.
- the disease is a skin disease. In some embodiments, the disease of the gastrointestinal tract. In some embodiments, the disease of the gastrointestinal tract. In some embodiments, the disease of the genitalia. In some embodiments, the disease is a skin disease associated with inflammation (e.g., atopic dermatitis or acne, such as acne caused by acne-causing strains of P. acnes).
- inflammation e.g., atopic dermatitis or acne, such as acne caused by acne-causing strains of P. acnes.
- the Propionibacterium bacterium may be P. acnes (e.g., RT8, RT1, RT5, or RT3 P. acnes or P. acnes that belongs to the IB-1, IB-2, or IC clades).
- the Propionibacterium bacterium may be P. avidum.
- the Gram positive bacteria may be Staphylococcus, such as Methicillin-resistant Staphylococcus aureus (MRSA).
- MRSA Methicillin-resistant Staphylococcus aureus
- the Gram positive bacteria may be Enterococcus , such as Vancomycin-resistant Enterococcus (VRE).
- the Gram positive bacteria may be Streptococcus , such as Group A Streptococcus (GAS).
- the Gram-positive bacteria may be P. acnes, P. avidum, P. granulosum, or P. humerusii.
- MRSA Methicillin-resistant Staphylococcus aureus
- VRE Van
- the subject has a skin disease associated with inflammation (e.g., atopic dermatitis or acne).
- the Gram-positive bacteria is Clostridium difficile.
- the subject is afflicted with or suffering from Methicillin- resistant Staphylococcus aureus (MRSA), Vancomycin-resistant Enterococcus (VRE), Group A Streptococcus (GAS), or Clostridium difficile.
- MRSA Methicillin- resistant Staphylococcus aureus
- VRE Vancomycin-resistant Enterococcus
- GAS Group A Streptococcus
- Agent X may be a lantibiotic, e.g., a class III lantibiotic. Agent X may be expressed by Propionibacterium bacterium. Agent X may comprise a peptide (e.g., at least one, at least two, at least three, at least four, at least five, at least six, or at least seven) with an amino acid sequence with at least 50%, at least 80%, at least 90%, at least 95%, at least 99%, or 100% homology with any one of SEQ ID NOs: 1-5 or 7-14.
- a peptide e.g., at least one, at least two, at least three, at least four, at least five, at least six, or at least seven
- Propionibacterium bacterium may be P. acnes (e.g., RT8, RT1, RT5, RT3 P. acnes strains or P. acnes that belongs to the IB-1, IB-2, or IC clades).
- the Propionibacterium bacterium may be any P. acnes highlighted in Figures 1-7.
- the Propionibacterium bacterium may be P. acnes HL030PA2 or P. acnes HL086PA1.
- the Propionibacterium bacterium may be any Propionibacterium that has retained Locus 4.
- the Propionibacterium bacterium may be P. avidum (e.g ., P. avidum strains HGH0353 and HL083PVl strains).
- the Propionibacterium bacterium may be any P. acnes or P. avidum strains that produce agent X.
- Propionibacterium acnes strain HL030PA2 proteins encoded by lantibiotic region of locus 4
- Propionibacterium acnes HL030PA2 DNA sequence of HMPREF9602 01329 to
- Propionibacterium acnes HL030PA2 DNA sequence of HMPREF9602 01329 to HMPREF9602 01325
- the methods provided herein include further conjoint administration of a composition (e.g., a pharmaceutical or cosmetic composition) comprising iron and/or cobalt to the subject.
- a composition e.g., a pharmaceutical or cosmetic composition
- the subject that receives conjoint administration has a skin disease (e.g., inflammatory skin disease, such as acne, rosacea, psoriasis, or Porphyria Cutanea Tarda (PCT)).
- a skin disease e.g., inflammatory skin disease, such as acne, rosacea, psoriasis, or Porphyria Cutanea Tarda (PCT)
- the subject has symptoms of skin aging.
- provided herein are methods of promoting vitamin B12 biosynthesis in acne-associated strains of P. acnes on the skin of a subject by further administering a composition comprising cobalt and/or iron.
- compositions disclosed herein may further comprises one or more strains of P. acnes.
- the P. acnes strain may be RT1, RT2, RTS, or RT6 strain of P. acnes.
- the compositions may further comprise at least one phage against a strain of P. acnes (e.g., a phage that target a strain of P. acnes (e.g., RT4, RTS, RT7, RTS, RT9 or RTIQ).
- the compositions may further comprise P. granulosum, P. avidum, P. humerusii.
- Compositions disclosed herein may comprise an antibiotic (e.g., an antibiotic that does not target P.
- compositions disclosed herein may further comprise one or more strains of P. acnes (i.e., a strain associated with healthy skin, such as a RT1, RT2, RT3, or RT6 strain of P. acnes).
- the methods provided herein many further comprising administering one or more strains of P. acnes (i.e., a strain associated with healthy skin, such as a RT1, RT2, RT3, or RT6 strain of P. acnes).
- the compositions and method may further comprise at least one phage against a strain of P. acnes .
- the phage may target a strain of P. acnes that is associated with acne or an inflammatory skin disease, such as RT4, RTS, RT7, RT8, RT9 or RT10.
- the compostion may comprise P. granulosum, P. avidum, P. humerusii.
- compositions disclosed herein may comprise an antibiotic (e.g., an antibiotic that does not target P. granulosum, P. avidum, P. humerusii, or an RT1, RT2, RT3, or RT6 strain of P. acnes).
- Compositions may contain two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more strains of P. acnes (e.g., an RT1, RT2, RT3, or RT6 strain of P. acnes), P. granulosum, P. avidum, and/or P. humerusii.
- the composition further comprises a phage against a strain of P. acnes (e.g., a RT4, RT5, RT7, RT8, RT9 or RT10 strain of P. acnes).
- the composition comprises two or more (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) phages against a strain of P. acnes.
- the type of phage that may be administered in a composition disclosed herein depends on the type of acne or skin disease, the medical history of an individual, or the symptoms of a subject with a skin disease.
- Non-limiting examples of phages include PHL111M01, PHL082M00, PHL060L00, PHL067M10, PHL071N05, PHL112N00, PHL037M02, PHL085N00, PHL115M02, PHL085M01, PHL114L00, PHL010M04, PHL066M04, PHL071N05, PHL113M01, PHL112N00, and PHL037M02.
- Information about P. acnes phages can be found in U.S. Patent Publication US20150086581A1, hereby incorporated in its entirety.
- the composition further comprises an antibiotic or the method further comprising administering and antibiotic to the subject (i.e., an antibiotic that does not target an agent X expressing bacterium, a bacterium that comprises Locus 4, or a bacterium described herein).
- the subject is human.
- the methods provided herein include further conjoint administration of a composition (e.g., a pharmaceutical or cosmetic composition) comprising iron and/or cobalt to the subject.
- the subject that is conjointly administered the compositions has a skin disease disclosed herein (e.g., inflammatory skin disease, such as acne, rosacea, psoriasis, or Porphyria Cutanea Tarda (PCT)).
- a skin disease disclosed herein e.g., inflammatory skin disease, such as acne, rosacea, psoriasis, or Porphyria Cutanea Tarda (PCT)
- the skin disease may be acne, rosacea, psoriasis or PCT.
- the composition may be administered conjointly with a compositions comprising iron and/or cobalt.
- the subject is in need of reducing the level porphyrins (e.g., bacterially derived porphyrins) on the skin of a subject by administering (e.g., a subject with symptoms of skin aging, or a subject with any skin condition disclosed herein, such as a skin disease associated with inflammation, acne, rosacea, psoriasis, or PCT) a
- the porphyrins may be produced by P. acnes (e.g., acne-associated strains of P. acnes).
- the porphyrins may be produced by P.
- composition may be administered conjointly with a compositions comprising iron and/or cobalt.
- compositions disclosed herein may be heat treated, tyndallized and/or comprise supernatant-derived bacteria.
- compositions disclosed herein may be administered to a subject by any means known in the art, for example, the composition may be formulated for topical delivery.
- the formulation may be a liquid, gel, or cream.
- the composition is formulated for oral delivery.
- the composition may be in the form of a pill, tablet, or capsule.
- the subject may be a mammal (e.g., a human).
- the composition is self-administered.
- the above methods directly act to reduce the amount of pathogenic or harmful bacteria in a subject.
- this includes any such therapy that achieves the same goal of reducing the number of pathogenic or harmful organisms, when used in combination with the composition described herein, would lead to replacement of the pathogenic microflora involved in the diseased state with natural microflora enriched in a body site not afflicted with a disease, or less pathogenic species occupying the same ecological niche as the type causing a disease state.
- a subject may undergo treatment with antibiotics or a composition comprising compounds to target and decrease the prevalence of pathogenic organisms, and subsequently be treated with a composition described herein.
- Suitable antimicrobial compounds include capreomycins, including capreomycin IA, capreomycin IB, capreomycin IIA and capreomycin IIB; carbomycins, including
- carbomycin A carumonam; cefaclor, cefadroxil, cefamandole, cefatrizine, cefazedone, cefazolin, cefbuperazone, cefcapene pivoxil, cefclidin, cefdinir, cefditoren, cefime, ceftamet, cefmenoxime, cefmetzole, cefminox, cefodizime, cefonicid, cefoperazone, ceforanide, cefotaxime, cefotetan, cefotiam, cefoxitin, cefpimizole, cefpiramide, cefpirome, cefprozil, cefroxadine, cefsulodin, ceftazidime, cefteram, ceftezole, ceftibuten, ceftiofur, ceftizoxime, ceftriaxone, cefuroxime, cefuzonam,
- cephalosporin C cephalothin, cephapirin, cephamycins, such as cephamycin C, cephradine, chlortetracycline; chlarithromycin, clindamycin, clometocillin, clomocycline, cloxacillin, cyclacillin, danofloxacin, demeclocyclin, destomycin A, dicloxacillin, dirithromycin, doxycyclin, epicillin, erythromycin A, ethanbutol, fenbenicillin, flomoxef, florfenicol, floxacillin, flumequine, fortimicin A, fortimicin B, forfomycin, foraltadone, fusidic acid, gentamycin, glyconiazide, guamecycline, hetacillin, idarubicin, imipenem, isepamicin, josamycin, kanamycin, leumycins
- penamecillin penicillins such as penicillin G, penicillin N and penicillin O, penillic acid, pentylpenicillin, peplomycin, phenethicillin, pipacyclin, piperacilin, pirlimycin,
- pivampicillin pivcefalexin, porfiromycin, propiallin, quinacillin, ribostamycin, rifabutin, rifamide, rifampin, rifamycin SV, rifapentine, rifaximin, ritipenem, rekitamycin,
- spectinomycin streptozocin, sulbenicillin, sultamicillin, talampicillin, teicoplanin, temocillin, tetracyclin, thostrepton, tiamulin, ticarcillin, tigemonam, tilmicosin, tobramycin, tropospectromycin, trovafloxacin, tylosin, and vancomycin, and analogs, derivatives, pharmaceutically acceptable salts, esters, prodrugs, and protected forms thereof.
- Suitable anti-fungal compounds include ketoconazole, miconazole, fluconazole, clotrimazole, undecylenic acid, sertaconazole, terbinafme, butenafme, clioquinol, haloprogin, nystatin, naftifme, tolnaftate, ciclopirox, amphotericin B, or tea tree oil and analogs, derivatives, pharmaceutically acceptable salts, esters, prodrugs, and protected forms thereof.
- Suitable antiviral agents include acyclovir, azidouridine, anismoycin, amantadine, bromovinyldeoxusidine, chlorovinyldeoxusidine, cytarabine, delavirdine, didanosine, deoxynojirimycin, dideoxycytidine, dideoxyinosine, dideoxynucleoside, desciclovir, deoxyacyclovir, efavirenz, enviroxime, fiacitabine, foscamet, fialuridine, fluorothymidine, floxuridine, ganciclovir, hypericin, idoxuridine, interferon, interleukin, isethionate, nevirapine, pentamidine, ribavirin, rimantadine, stavudine, sargramostin, suramin, trichosanthin, tribromothymidine, trichlorothymidine, tri
- antiviral agents include 2',3'-dideoxyadenosine (ddA), 2', 3'- dideoxyguanosine (ddG), 2', 3 '-dideoxycytidine (ddC), 2',3'-dideoxythymidine (ddT), 2'3'- dideoxy-dideoxythymidine (d4T), 2'-deoxy-3'-thia-cytosine (3TC or lamivudime), 2', 3'- dideoxy-2'-fluoroadenosine, 2',3'-dideoxy-2'-fluoroinosine, 2',3'-dideoxy-2'-fluorothymidine, 2',3'-dideoxy-2'-fluorocytosine, 2'3'-dideoxy-2',3'-didehydro-2'-fluorothymidine (Fd4T), 2'3'-dideoxy-2'-beta-fluoroad
- the antiviral agent is selected from trisodium phosphomonoformate, ganciclovir, trifluorothymidine, acyclovir, 3 '-azido-3 '-thymidine (AZT), dideoxyinosine (ddl), and idoxuridine and analogs,
- the invention relates to a composition (e.g., a pharmaceutical composition comprising agent X, a bacterium that produces agent X, a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), or a composition comprising a strain of bacteria that expresses any one of SEQ ID NOs: 1-5 or 7-14 disclosed herein.
- a composition e.g., a pharmaceutical composition comprising agent X, a bacterium that produces agent X, a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), or a composition comprising a strain of bacteria that expresses any one of SEQ ID NOs: 1-5 or 7-14 disclosed herein.
- the compositions described herein i.e., compositions comprising a strain of bacteria comprising Locus 4 or a strain of bacteria encoding for any one of SEQ ID NO: 1-5
- the strain of bacteria may be any strain which comprises Locus 4 (e.g., any strain with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology to Locus 4).
- the strain of bacteria may be any strain that expresses at least one amino acid sequence set forth in SEQ ID NOs: 1-5 or 7-14.
- the strain of bacteria may be any strain that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein. Exemplary
- Propionibacterium bacterium strains for use in the methods and compositions provided herein include, but are not limited to, HL037PA1, HL078PA1, HL053PA2, HL082PA1, HL086PA1, HL092PA1, HL110PA1, HL110PA2, HL030PA2, HL030PA1, HL063PA2, PV-66, Type IA2 P.acnl7, HL097PA1, PRP-38, 5 U 42AFAA, HL082PA2 (e.g., P. acnes strains).
- Exemplary Propionibacterium bacterium strains for use in the methods and compositions provided herein also include, but are not limited to HL083PV1 or HGH0353 (e.g., P. avidum strains).
- the compositions provided herein may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of the bacterial strains provided herein.
- compositions provided herein may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of any bacterial strain that comprises Locus 4, any bacterial strain that encodes for at least one peptide with at least 50% homology to any amino acid sequence set forth in SEQ ID NOs; 1-5 or 7-14, or any bacterial strain that produces agent X.
- a strain of bacteria disclosed herein may be any strain which comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with Locus 4.
- the strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with at least one amino acid sequence set forth in SEQ ID NOs: 1-5 or 7-14.
- the strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein.
- the methods provided herein include methods of administering separate items
- compositions each compositions comprising at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of the bacterial strains provided herein.
- Each composition to be administered may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of any bacterial strain that comprises Locus 4, any bacterial strain that encodes for at least one peptide with at least 50% homology to any amino acid sequence set forth in SEQ ID NOs: 1-5 or 7-14, any bacterial strain that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein, or any bacterial strain that produces agent X.
- the compositions may be administered concurrently or sequentially.
- the compositions may be administered conjointly.
- the pharmaceutical composition may be formulated for topical administration.
- the pharmaceutical composition may be a probiotic.
- the pharmaceutical compositions disclosed herein may be delivered by any suitable route of administration, including orally, buccally, sublingually, parenterally, and topically, as by powders, ointments, drops, liquids, gels, or creams.
- the pharmaceutical compositions are delivered generally (e.g., via oral or parenteral administration).
- the pharmaceutical compositions are delivered locally through injection, micro needles, or patches.
- Actual dosage levels of the active ingredients in the pharmaceutical compositions may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of factors including the activity of the particular agent employed, the route of administration, the time of
- a physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required.
- the physician or veterinarian could prescribe and/or administer doses of the compounds employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
- Suitable topical vehicles and vehicle components for use with the formulations of the invention are well known in the cosmetic and pharmaceutical arts, and include such vehicles (or vehicle components) as water; organic solvents such as alcohols (particularly lower alcohols readily capable of evaporating from the skin such as ethanol), glycols (such as propylene glycol, butylene glycol, and glycerol (glycerin)), aliphatic alcohols (such as lanolin); mixtures of water and organic solvents (such as water and alcohol), and mixtures of organic solvents such as alcohol and glycerol (optionally also with water); lipid-based materials such as fatty acids, acylglycerols (including oils, such as mineral oil, and fats of natural or synthetic origin), phosphoglycerides, sphingolipids and waxes; protein-based materials such as collagen and gelatin; silicone-based materials (both non-volatile and volatile) such as cyclomethicone, dimethiconol, dimethicone, and dimethi
- compositions of the present invention are oil-in-water emulsions.
- Liquids suitable for use in formulating compositions of the present invention include water, and water-miscible solvents such as glycols (e.g., ethylene glycol, butylene glycol, isoprene glycol, propylene glycol), glycerol, liquid polyols, dimethyl sulfoxide, and isopropyl alcohol.
- glycols e.g., ethylene glycol, butylene glycol, isoprene glycol, propylene glycol
- glycerol glycerol
- liquid polyols e.g., dimethyl sulfoxide, and isopropyl alcohol.
- aqueous vehicles may be present.
- formulations do not have methanol, ethanol, propanols, or butanol. ⁇ urfactants and Emulsifiers
- lipid-like (oily or fatty) or lipophilic ingredients do not uniformly disperse in aqueous solvents unless they are first combined with emulsifiers, which form microscopic aqueous soluble structures (droplets) that contain a lipophilic interior and a hydrophilic exterior, resulting in an oil-in-water emulsion.
- emulsifiers which form microscopic aqueous soluble structures (droplets) that contain a lipophilic interior and a hydrophilic exterior, resulting in an oil-in-water emulsion.
- a molecule In order to be soluble in aqueous media, a molecule must be polar or charged so as to favorably interact with water molecules, which are also polar.
- an emulsifier is typically used which forms stable structures that contain the hydrophilic components in the interior of the structure while the exterior is lipophilic so that it can dissolve in the lipophilic solvent to form a water-in-oil emulsion. It is well known that such emulsions can be destabilized by the addition of salts or other charged ingredients which can interact with the polar or charged portions of the emulsifier within an emulsion droplet. Emulsion destabilization results in the aqueous and lipophilic ingredients separating into two layers, potentially destroying the commercial value of a topical product.
- Surfactants suitable for use in the present invention may be ionic or non-ionic.
- Polysorbate 40 Polysorbate 60, Polysorbate 80), steareth-10 (Brij 76), sodium dodecyl sulfate (sodium lauryl sulfate), lauryl dimethyl amine oxide, cetyltrimethylammonium bromide (CTAB), polyethoxylated alcohols, polyoxyethylene sorbitan, octoxynol, N,N- dimethyldodecylamine-N-oxide, hexadecyltrimethylammonium bromide (HTAB), polyoxyl 10 lauryl ether, bile salts (such as sodium deoxycholate or sodium cholate), polyoxyl castor oil, nonylphenol ethoxylate, cyclodextrins, lecithin, dimethicone copolyol, lauramide DEA, cocamide DEA, cocamide MEA, oleyl betaine, cocamidopropyl betaine, cocamidopropyl phosphati
- Poloxamers including, but not limited to, Poloxamer 188 (HO(C 2 H 4 O)a(CH(CH 3 )CH20) b (C 2 H 4 O) a H, average molecular weight 8400) and Poloxamer 407 (HO(C 2 H 4 O) a (CH(CH 3 )CH 2 0) b (C 2 H 4 0) a H, wherein a is about 101 and b is about 56)).
- Appropriate combinations or mixtures of such surfactants may also be used according to the present invention.Many of these surfactants may also serve as emulsifiers in formulations of the present invention.
- emulsifiers for use in the formulations of the present invention include, but are not limited to, behentrimonium methosulfate-cetearyl alcohol, non-ionic emulsifiers like emulsifying wax, polyoxyethylene oleyl ether, PEG-40 stearate, cetostearyl alcohol (cetearyl alcohol), ceteareth-12, ceteareth-20, ceteareth-30, ceteareth alcohol, Ceteth-20 (Ceteth-20 is the polyethylene glycol ether of cetyl alcohol where n has an average value of 20), oleic acid, oleyl alcohol, glyceryl stearate, PEG-75 stearate, PEG-100 stearate, and PEG- 100 stearate, ceramide 2, ceramide 3, stearic acid, cholesterol, steareth-2, and steareth-20, or combinations/mixtures thereof, as well as cationic emulsifiers like stearamido
- white petrolatum is an excellent moisturizer and skin protectant, it is rarely used alone, especially on the face, because it is greasy, sticky, does not rub easily into the skin and may soil clothing. Consumers highly value products which are
- Suitable moisturizers for use in the formulations of the present invention include, but are not limited to, lactic acid and other hydroxy acids and their salts, glycerol, propylene glycol, butylene glycol, sodium PCA, sodium hyaluronate, Carbowax 200, Carbowax 400, and Carbowax 800.
- Suitable emollients or humectants for use in the formulations of the present invention include, but are not limited to, panthenol, acemannan, derivatives of Aloe vera , N-palmitoylethanolamine, N-acetylethanolamine, cetyl palmitate, glycerol (glycerin), PPG- 15 stearyl ether, lanolin alcohol, lanolin, lanolin derivatives, cholesterol, petrolatum, isostearyl neopentanoate, octyl stearate, mineral oil, isocetyl stearate, myristyl myristate, octyl dodecanol, 2-ethylhexyl palmitate (octyl palmitate), dimethicone, phenyl trimethicone, cyclomethicone, C12-C15 alkyl benzoates, dimethiconol, propylene glycol, Theobrom
- composition may further include components adapted to improve the stability or effectiveness of the applied formulation.
- Suitable preservatives for use in the present invention include, but are not limited to: ureas, such as imidazolidinyl urea and diazolidinyl urea; phenoxy ethanol; sodium methyl paraben, methylparaben, ethylparaben, and propylparaben; potassium sorbate; sodium benzoate; sorbic acid; benzoic acid; formaldehyde; citric acid; sodium citrate; chlorine dioxide; bakuchiol, N-acetyl-L-cysteine, honokiol, magnolol, derivatives of Magnolia officinalis bark, chrysin, quaternary ammonium compounds, such as benzalkonium chloride, benzethonium chloride, cetrimide, dequalinium chloride, and cetylpyridinium chloride; mercurial agents, such as phenylmercuric nitrate, phenylmercuric acetate, and
- Suitable antioxidants include, but are not limited to, ascorbic acid and its esters, sodium bisulfite, butylated hydroxytoluene, butylated hydroxyanisole, tocopherols, D- ribose, N-acetyl-L-cysteine, apocynin, bixin, derivatives of Bixa orellana seeds,
- nicotinamide acetyl zingerone, bakuchiol, tiliroside, extracts of Fragraria ananassa seed, fucoxanthin, creatine and its salts and esters, quercetin, luteolin, honokiol, magnolol, derivatives of Magnolia officinalis bark, tocopheryl acetate, sodium ascorbate/ascorbic acid, ascorbyl palmitate, propyl gallate, and chelating agents like EDTA (e.g., disodium EDTA), citric acid, and sodium citrate.
- EDTA e.g., disodium EDTA
- the antioxidant or preservative comprises (3-(4- chlorophenoxy)-2-hydroxypropyl)carbamate.
- antioxidants or preservatives of the present invention may also function as a moisturizer or emollient, for example.
- composition can also contain any other agent that has a desired effect when applied topically to a subject.
- suitable classes of active agents include, but are not limited to antibiotic agents (i.e., antibiotic agents that dot not target agent X producing organisms), antimicrobial agents, anti-acne agents, antibacterial agents, antifungal agents, antiviral agents, steroidal anti-inflammatory agents, non-steroidal anti-inflammatory agents, anesthetic agents, antipruriginous agents, antiprotozoal agents, anti-oxidants, antihistamines, vitamins, and hormones. Mixtures of any of these active agents may also be employed. Additionally, dermatologically-acceptable salts and esters of any of these agents may be employed.
- Suitable viscosity adjusting agents for use in the formulations of the present invention include, but are not limited to, protective colloids or non-ionic gums such as hydroxyethylcellulose, xanthan gum, and sclerotium gum, as well as magnesium aluminum silicate, silica, microcrystalline wax, beeswax, paraffin, and cetyl palmitate.
- protective colloids or non-ionic gums such as hydroxyethylcellulose, xanthan gum, and sclerotium gum
- magnesium aluminum silicate, silica, microcrystalline wax, beeswax, paraffin, and cetyl palmitate may be utilized according to the present invention.
- Additional constituents suitable for incorporation into the emulsions of the present invention include, but are not limited to: skin protectants, adsorbents, demulcents, emollients, moisturizers, sustained release materials, solubilizing agents, skin-penetration agents, skin soothing agents, deodorant agents, antiperspirants, sun screening agents, sunless tanning agents, vitamins, hair conditioning agents, anti-irritants, anti-aging agents, abrasives, absorbents, anti-caking agents, anti-static agents, astringents (e.g., witch hazel, alcohol, and herbal extracts such as chamomile extract), binders/excipients, buffering agents, chelating agents, film forming agents, conditioning agents, opacifying agents, lipids, immunomodulators, and pH adjusters (e.g., citric acid, sodium hydroxide, and sodium phosphate).
- skin protectants e.g., adsorbents, demulcents, emolli
- lipids normally found in healthy skin may be incorporated into the emulsions of the present invention.
- the lipid is selected from the group consisting of ceramides, cholesterol, and free fatty acids.
- examples of lipids include, but are not limited to, ceramide 1, ceramide 2, ceramide 3, ceramide 4, ceramide 5, ceramide 6, hydroxypropyl bispalmitamide MEA, and hydroxypropyl bislauramide MEA, and combinations thereof.
- Examples of peptides that interact with protein structures of the dermal-epidermal junction include palmitoyl dipeptide-5 diaminobutyloyl hydroxythreonine and palmitoyl dipeptide-6 diaminohydroxybutyrate.
- Examples of skin soothing agents include, but are not limited to algae extract, mugwort extract, stearyl glycyrrhetinate, bisabolol, allantoin, aloe, avocado oil, green tea extract, hops extract, chamomile extract, colloidal oatmeal, calamine, cucumber extract, and combinations thereof.
- compositions comprise bergamot or bergamot oil.
- Bergamot oil is a natural skin toner and detoxifier. In certain embodiments, it may prevent premature aging of skin and may have excellent effects on oily skin conditions and acne.
- the composition comprises a vitamin.
- vitamins include, but are not limited to, vitamins A, D, E, K, and combinations thereof.
- Vitamin analogues are also contemplated; for example, the vitamin D analogues calcipotriene or calcipotriol.
- the vitamin may be present as tetrahexyldecyl ascorbate. This compound exhibits anti-oxidant activity, inhibiting lipid peroxidation. In certain embodiments, use can mitigate the damaging effects of UV exposure. Studies have shown it to stimulate collagen production as well as clarifying and brightening the skin by inhibiting melanogenesis (the production of pigment) thereby promoting a more even skin tone.
- the composition comprises a sunscreen.
- sunscreens include, but are not limited to, p-aminobenzoic acid, avobenzone, cinoxate, dioxybenzone, homosalate, menthyl anthranilate, octocrylene, octyl methoxycinnamate, octyl salicylate, oxybenzone, padimate O, phenylbenzimidazole sulfonic acid,
- sulisobenzone titanium dioxide, trolamine salicylate, zinc oxide, 4-methylbenzylidene camphor, methylene bis-benzotriazolyl tetramethylbutylphenol, bis-ethylhexyloxyphenol methoxyphenyl triazine, terephthalylidene dicamphor sulfonic acid, drometrizole
- trisiloxane disodium phenyl dibenzimidazole tetrasulfonate, diethylamino hydroxybenzoyl hexyl benzoate, octyl triazone, diethylhexyl butamido triazone, polysilicone-15, and combinations thereof.
- Suitable fragrances and colors may be used in the formulations of the present invention.
- Examples of fragrances and colors suitable for use in topical products are known in the art.
- the human skin is host to a diverse community of bacterial species. Hosting a relatively pro-inflammatory bacterial population is thought to contribute to inflammatory skin diseases, while a non-inflammatory population is believed to maintain healthy skin.
- Lantibiotics are a type of bacteriocin that can cause great changes in the microbial community due to their ability to kill neighboring cells.
- a novel lantibiotic in Propionibacterium is identified, the dominant resident bacteria in sebaceous sites.
- the lantibiotic which was named Pilosebin L4, can inhibit the growth of a broad range of Gram-positive bacteria, including those found on the skin as well as important clinical pathogens such as MRSA and VRE. Using mock bacterial communities, it was named
- Propionibacterium strains that expressed Pilosebin L4 were able to out- compete those that do not express the lantibiotic and become the dominant members of the community. Colonization of a Propionibacterium strain expressing Pilosebin L4 can thus highly influence the microbiome composition and the host’s susceptibility to skin diseases. Propionibacterium strains with pilosebin L4 can be further exploited as a probiotic to modulate the virulence property of the microbiome and to maintain skin health.
- the human skin is host to a multitude of commensal bacterial communities.
- Propionibacterium species primarily P. acnes, are the dominant genera at sebaceous sites (Fitz-Gibbon et al 2013, Grice et al 2009). Hosting a commensal bacterial flora is an important factor of skin health, and disruptions or shifts in skin microbial community are associated with a variety of inflammatory skin diseases, including acne vulgaris (acne)(Fitz- Gibbon 2013 and Barnard 2016). Acne is a chronic inflammatory disease of the
- pilosebaceous unit characterized by papules and pustules arising on the affected skin.
- the cause of acne is multifactorial, characterized by hyperkeratiniation, increased sebum production, and pro-inflammatory bacteria in the affected region (Tanghetti 2013).
- Bacteriocins are ribosomally synthesized antimicrobial peptides produced by a wide-range of bacteria.
- Lantibiotics lanthionine containing antibiotics
- Lantibiotics are a type of bacteriocin produced by Gram-positive bacteria. They are characterized by their small sizes ( ⁇ 5 kDa), extensive post-translational modifications, and the presence of the amino acids lanthionine (Lan) and/or b-methyl-lanthionine (meLan) (Rea et al 2011b).
- the genes involved in lantibiotic biosynthesis are generally found on an operon, and encode for a precursor peptide and modification enzymes.
- Lantibiotic operons may also come with genes encoding for an exporter, protease, immunity proteins, and/or two-component regulatory system consisting of a histidine kinase receptor and a transcriptional response regulator (Chatterjee, 2005) (Dischinger et al 2014).
- Lantibiotic biosynthesis involves the translation of the prepeptide, followed by dehydration of serine and threonine residues to didehydroalanines (Dha) and didehydrobutyrines (Dhb), respectively. Subsequent intramolecular Michael addition of cysteine -SH groups to Dha/Dhb form the characteristic thioether crosslinks of Lan and MeLan (Goto et al 2010).
- Lantibiotics are classified based on their biosynthetic genes: Class I are linear peptides with two modification enzymes LanB and LanC, a lantibiotic ABC transporter LanT, and a proteinase LanP that cleaves the leader peptides; Class II are generally more globular than Class I, and are modified by a single enzyme LanM, and processed and secreted by LanT; Class III are modified by LanKC (sometimes referred to as LabKC), while Class IV are modified by LanL (Alkhatib et al 2012, Dischinger et al 2014, Rea et al 2011b).
- Lantibiotics act by binding to lipid I or lipid II of the peptidoglycan cell wall to inhibit cell wall biosynthesis, or by forming pores in the cell membrane to kill the target bacteria (Brotz and Sahl 2000, Draper et al 2015). Only lantibiotics of Class I and Class II have shown antimicrobial activity (Goto et al 2010). Despite their lack of antimicrobial activity, many Class III lantibiotics have been well characterized (Krawczyk et al 2012, Krawczyk et al 2013, Voller et al 2012). To date, all Class III lantibiotics have been isolated from bacteria of the order Actinomycetales.
- bacteriocins such as lantibiotics by certain species/strains in a microbial community can have profound effects on community composition due to their ability to inhibit neighboring cells (Hawlena et al 2012, Perez-Gutierrez et al 2013).
- the production of bacteriocins by certain members of the microbiota has also been suggested to affect health and disease (Belda-Ferre et al 2012).
- There is only one reported case of bacteriocin characterization in P. acnes identified from an oral isolate over 30 years ago (Fujimura and Nakamura 1978).
- Pilosebin L4 can kill a broad-range of Gram-positive bacteria, thus allowing the producer strains to dramatically change the microbial community composition. The implications for the presence of Pilosebin L4 in select propionibacteria and therapeutic applications are discussed.
- Culture medium A is a synthetic medium composed of (per litre): 12 g tryptone,
- yeast extract 12 g yeast extract, 4 g glucose, 4 g KH2P04, and 1 g MgS04-7H20.
- Propionibacterium granulosum, Propionibacterium humerusii, Staphylococcus epidermidis, P. avidum, and all P. acnes strains except for KPA171202 were previously isolated from human skin samples (Fitz-Gibbon et al 2013).
- Bacillus subtilis JH642 was kindly provided by Dr. Beth Lazazzera at UCLA. All other strains were purchased from sources listed in Table 1.
- the online tool BAGEL3 (van Heel et al 2013) was used to scan for bacteriocins in all publicly available genomes of P. acnes. FASTA files containing nucleotide sequences of all genomic scaffolds were used for analysis.
- KEGG Orthology (KO) identities The KEGG Automatic Annotation Server (KAAS) was used to determine the KO assignments of genes.
- the bi-directional best hit method was used on amino acid sequences, with the default prokaryotic genes data set.
- amino acid sequences of the following 31 genes were selected and used, based on the Genomic Encyclopedia of Bacteria and Archaea (Wu et al 2009): dnaG, frr, infC, lepA, nusA, pgk, pnpA, rplA, rplB, rplC, rplD, rplE, rplF, rplK, rplL, rplM, rplP, rplS, rplT, rpmA, rpoA, rpoB, rpoD, rpsB, rpsC, rpsE, rpsl, rpsJ, rpsS, smpB, and tsf; all sequences were obtained from IMG (Markowitz et al 2012), except for/ 1 avidum HL083
- Antimicrobial activity of the lantibiotic was detected using a soft agar overlay assay.
- Strains producing Pilosebin L4 were sub-cultured to OD595 of 1.0, spotted onto A-media plates, and incubated anaerobically at 37°C for 48 h. Plates were then overlaid with soft agar media (0.7% agar + appropriate media as indicated in Table 1) containing target strains at OD595 of 1.0, and incubated anaerobically at 37°C for 48 h for Propionibacterium species, or aerobically at 37°C overnight for all other species. After incubation, overlays were examined for growth inhibition zones. Where observed, inhibition zones were measured from the inside edge (edge of the spotted producer strain) to the outer edge of the inhibition zone.
- Fresh plate cultures of P. acnes HL030PA2 were harvested and sub-cultured in fresh BHI media to an OD595 of 1.0, and serially diluted in 1/5 dilutions up to 1/625. The dilutions were spread evenly on A-media plates, and incubated anaerobically at 37°C for 48 h. Each plate, therefore, contained P. acnes HL030PA2 grown at various cell densities.
- Total RNA was extracted from each of the plates using RNAprotect Bacteria Reagent + RNeasy Mini Kit (Qiagen), following the protocol for“Disruption of Bacteria Grown on Solid Media” followed by the standard protocol for RNA purification. Potential DNA contaminants were removed using TURBO DNA-free DNase Treatment kit (Ambion).
- RNA was then converted to cDNA using Superscript® III First-Strand Synthesis Kit (Invitrogen).
- qPCR was performed on the LightCycler® 480 System (Roche), with the LightCycler® 480 High Resolution Melting Dye (Roche) following the manufacturer’s protocol.
- GGAAGTCGATGTGGAGTCGG-3’ a single copy house-keeping gene used as a normalizer, Pak-qF (5’-GCAACCCGACATCCTCATTA-3’) and Pak-qR (5’ - AGTCGAAGAAGTCGCTC AGG-3’ ) .
- the qPCR conditions used are: 1 cycle of 95°C for 10 min, 50 cycles of 95°C for 10 min, 57°C for 30 sec, and 72°C for 30 sec, and 1 cycle each of 95°C, 40°C, 55°C, and 99°C for melting curve analyses. Three biological replicates were analyzed, with 3 technical replicates each.
- Fresh plate cultures of P. acnes HL030PA2, HL056PA1, HL086PA1, HL110PA3, and P. avidum HL083PV1 were harvested and sub-cultured in fresh BHI media to an OD595 of 1.0.
- the cultures were mixed in various ratios and spread evenly onto A-media plates.
- the plates were incubated anaerobically at 37 °C for 48 h.
- the mock communities were harvested, and genomic DNA was extracted using the Wizard® Genomic DNA Purification Kit (Promega) following the manufacturer’s protocol for Gram Positive Bacteria.
- the community DNA was diluted to 20 ng/mL, and absolute quantity of each strain was analyzed using qPCR on the LightCycler® 480 System (Roche), with the LightCycler® 480 High Resolution Melting Dye (Roche) following the manufacturer’s protocol.
- the following primer sets were used: for identification of HL056PA1, Ll-qF (5’- GAAGAATCCCGCTCCATTTCC-3’) and Ll-qR (5’-CCTTTCTTGTAGCCGAGC AG S’); for identification of HL030PA2, HL086PA1, and I ⁇ avidum , HisK-qF (5’- CCAGTTGCGTTCCATCATCCA-3’) and HisK-qR (5’- GGAAGTCGATGTGGAGTCGG-3’); for identification of HL 11 OP A3, cas3-qF (5’- GGC AAGAC AAACGAGGTAGGAG-3’ ) and cas3-qR (5’-
- Pak-qF 5’-GCAACCCGACATCCTCATTA-3’
- Pak-qR 5’- AGTCGAAGAAGTCGCTCAGG-3’
- the qPCR conditions used are: 1 cycle of 95°C for 10 min, 50 cycles of 95°C for 10 min, 57°C for 30 sec, and 72°C for 30 sec, and 1 cycle each of 95°C, 40°C, 55°C, and 99°C for melting curve analyses. Three biological replicates were analyzed, with three technical replicates each.
- a subset ofP. acnes strains encode a type III lantibiotic
- Non-core regions of all sequenced P. acnes strains were identified, which lead to the identified a genomic locus in RT8 strains of clade IB-1 and RT5 strains of clade IC
- Locus 4 a class III lantibiotic gene cluster at the beginning of the Locus 4 in above mentioned clades IB-1 and IC strains were identified.
- the lantibiotic gene cluster contains 4 genes: the prepeptide, the modification gene LanKC, and a two-component system consisting of a histidine kinase and a response regulator ( Figure 1).
- a membrane transporter directly follows the lantibiotic gene cluster in locus 4, with homology to known drug efflux systems.
- an ABC transporter containing a domain subfamily involved in lantibiotic immunity is also encoded at the end of locus 4 (genes 1348 and 1349, Figure 1).
- Locus 4 with and without the lantibiotic operon is found in other Actinomycetales species.
- a BLAST search of the locus 4 DNA sequence was performed on all deposited bacterial sequences (including partial and draft sequences) on IMG (Markowitz et al 2012).
- the full locus 4 with the lantibiotic operon was detected in some P. avidum strains, including HGH0353 and HL083PV1 ( Figure 2A).
- Propionibacterium species harboring the lantibiotic can inhibit a broad-range of Gram positive species
- an inhibition overlay assay was performed using 10 P. acnes strains (1 RT1 strain of clade IA-2, 6 RT8 strains of clade IB-1, 2 RT3 strains of clade IB-2, and 1 RT5 strain of clade IC) and 1 P. avidum strain that produce Pilosebin L4.
- the P. acnes strain HL037PA1 (RT3 from clade IB-2) was used as a negative control due to its phylogenetic closeness to the IB-1 and IB-2 strains that produce Pilosebin L4 ( Figure 2B). The ability of Pilosebin L4 to carry out strains to inhibit bacteria normally found on the skin and in the pilosebaceous unit.
- Pilosebin L4-negative P. acnes strains of all major lineages a Pilosebin L4-negative P. avidum strain, P. granulosum , P. humerusii, S. epidermidis , and S. aureus were used as the target species and strains. All of the above bacteria were found in skin follicles (Fitz-Gibbon et al 2013). Pilosebin L4 producers were all able to inhibit the growth of the target species from the skin ( Figure 3). The RT3 strains from the IB-2 clade showed a slightly better inhibitory ability than RT8 strains from the IB-1 clade and P. avidum. Among the propionibacteria target strains, type I P. acnes strains were inhibited the most, while types II and III, and other
- Propionibacterium species (P. granulosum, P. humerusii, P. avidum) were inhibited less than P. acnes type I.
- the negative control strain P. acnes HL037PA1 was unable to inhibit any of the target strains.
- Pilosebin L4 producers were also unable to inhibit other Pilosebin L4 producers, indicating the presence of a functional lantibiotic immunity mechanism within locus 4 ( Figure 3).
- the lantibiotic protects against a broad-range of Gram-positive species, including those of clinical importance, such as methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant enterococci (VRE, Enterococcus faecalis), group A streptococcus (GAS, Streptococcus pyogenes), and Clostridium difficile.
- MRSA methicillin-resistant Staphylococcus aureus
- VRE vancomycin-resistant enterococci
- GAS group A streptococcus
- Clostridium difficile Clostridium difficile.
- Pilosebin L4 producers were able to inhibit the growth of all the species tested ( Figures 3-5). ISon-Propionibacterium species generally showed the greatest sensitivity to Pilosebin L4.
- Pilosebin L4 is regulated by cell density
- the LanKC modification gene expression was proportionate to cell density, where high cell density up-regulated transcription, and low cell density down-regulated transcription (Figure 6).
- Pilosebin L4 producers can dominate a bacterial community by out-competing other strains While the inhibition assays ( Figure 3) showed that the bacterial strains harboring Pilosebin L4 are able to inhibit Gram-positive species, the assay was performed in such way that the lantibiotic producers grow and release the lantibiotics prior to the placement of the target strains.
- the assay was performed in such way that the lantibiotic producers grow and release the lantibiotics prior to the placement of the target strains.
- mock bacterial communities were tested where both Pilosebin L4 producers and target strains were grown simultaneously, with no initial growth advantage of the producers.
- To assemble the mock communities various combinations of two or three of the following strains in different ratios were grown: three Pilosebin L4 producing strains: P. acnes HL030PA2, P. acnes HL086PA1, and P. avidum HL083PV1, and two Pilosebin L4-negative strains: P. acnes HL056PA1 and P. acnes
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Animal Behavior & Ethology (AREA)
- Wood Science & Technology (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Zoology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Tropical Medicine & Parasitology (AREA)
- Virology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Dermatology (AREA)
- General Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
Provided herein are methods and compositions for promoting skin health.
Description
COMPOSITIONS AND METHODS FOR TREATING SKIN INFECTIONS AND
OTHER DISEASES
RELATED APPLICATIONS
This application claims priority to PCT Application PCT/US20/42542, filed July 17, 2020, and U.S. Provisional Application No. 62/877045, filed July 22, 2019, which is incorporated herein by reference in its entirety.
GOVERNMENT SUPPORT
This invention was made with government support under Grant Number
GM099530, awarded by the National Institutes of Health. The government has certain rights in the invention.
BACKGROUND
The skin is the largest organ in the human body and functions as the first line of defense by providing a protective barrier between the environment and inner body. The skin harbors several hundreds of resident microorganisms, which function in communities and protect the body from invasion of pathogens. Several studies have shown that shifts in the skin microbiota are associated with various skin diseases.
SUMMARY
Provided herein are methods and compositions useful in the treatment of infections caused by Gram-positive bacteria. In some aspects, provided herein are methods of treating or preventing a disease or condition (e.g., a skin disease or a disease associated with bacteria disclosed herein) in a subject in need thereof by administering a composition comprising agent X, a composition comprising a bacteria (or strain thereof) comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), a composition comprising a bacteria (or strain thereof) that expresses a peptide of any one of SEQ ID NOs: 1-5, 7-14, or any other amino acid disclosed herein, or a composition comprising a bacteria (or strain thereof) that comprises the nucleic acid sequence 6, 15 or any other nucleic acid sequence disclosed herein. In some embodiments, the methods comprise administering to the subject a composition comprising a Propionibacterium bacterium that expresses agent X to the subject. Also provided herein are methods of maintaining healthy
skin in a subject in need thereof by administering a composition or agent (e.g., agent X) disclosed herein, a composition comprising a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), or a composition comprising a strain of bacteria that expresses a peptides of any one of SEQ ID NOs: 1-5 or 7-14 to the subject.
The compositions disclosed herein may comprise live, replication competent bacteria. The compositions disclosed herein may be heat treated, tyndallized and/or supernatant-derived.
In some aspects, provided herein are methods of maintaining healthy skin in a subject in need thereof by administering a composition comprising agent X to the subject or administering a composition comprising a Propionibacterium bacterium that expresses agent X to the subject. Agent X may be encoded by Locus 4. Agent X may comprise at least one (e.g., at least two, at least three, at least four, at least five, at least six, or at least seven) peptide with an amino acid sequence with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with the nucleic acid sequence of Locus 4. The strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with any one of SEQ ID NOs: 1-5 or 7-14.
The strain of bacteria may be any strain which comprises Locus 4. The strain of bacteria may be any strain that expresses at least one amino acid sequence set forth in SEQ ID NOs: 1-5 or 7-14. The strain of bacteria may be any strain that comprises at least one nucleic acid sequence set forth in SEQ ID NOs: 6, 15 or any other sequence disclosed herein. Exemplary Propionibacterium bacterium strains for use in the methods and compositions provided herein include, but are not limited to, HL037PA1, HL078PA1, HL053PA2, HL082PA1, HL086PA1, HL092PA1, HL110PA1, HL110PA2, HL030PA2, HL030PA1, HL063PA2, PV-66, Type IA2 P.acnl7, HL097PA1, PRP-38, 5 U 42AFAA, HL082PA2 (e.g., P. acnes strains). Exemplary Propionibacterium bacterium strains for use in the methods and compositions provided herein also include, but are not limited to HL083PV1 or HGH0353 (e.g., P. avidum strains). The strain may be any strain in Figures 1-7 disclosed herein.
The compositions provided herein may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of the bacterial strains provided herein. The compositions provided herein may
include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of any bacterial strain that comprises Locus 4, or at least one bacterial strain that encodes for at least one peptide with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with the nucleic acid sequence of Locus 4. The strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with any amino acid sequence set forth in SEQ ID NOs; 1-5 or 7-14, or any bacterial strain that produces agent X.
The compositions provided herein may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of any bacterial strain that comprises Locus 4, or at least one bacterial strain that comprises a nucleic acid sequence with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with the nucleic acid sequence of Locus 4. The strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with any nucleic acid sequence set forth in SEQ ID NOs; 6 or 15, or any other sequence disclosed herein.
The strain of bacteria may be any strain that produces or expresses a peptide with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with the nucleic acid sequence of Locus 4. The strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with at least one amino acid sequence set forth in SEQ ID NOs: 1-5 or 7-14. As used herein, any strain of bacteria that that produces or encodes a peptide encoded in SEQ ID Nos: 1-5 or 7-14 includes any bacterial strain that produces or encodes a peptide with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with
the nucleic acid sequence of Locus 4. The strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with at least one amino acid sequence set forth in SEQ ID NOs: 1-5 or 7-14. The strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with at least one nucleic acid sequence set forth in herein (e.g,. SEQ ID NOs: 6 or 15).
The Propionibacterium (recently renamed to Cutibacterium) bacterium may be P. acnes. The Propionibacterium bacterium may be P. avidum. In some embodiments, the disease is a caused by Gram-positive bacteria. The Gram-positive bacteria may be
Staphylococcus, such as Methicillin-resistant Staphylococcus aureus (MRSA). The Gram positive bacteria may be Enterococcus, such as Vancomycin-resistant Enterococcus (VRE). The Gram-positive bacteria may be Streptococcus , such as Group A Streptococcus (GAS). The Gram-positive bacteria may be C. difficle. The Gram-positive bacteria may be
Streptococcus , such as Group A Streptococcus (GAS). The Gram-positive bacteria may be P. acnes, P. avidum, P. granulosum, or P. humerusii. In some embodiments, the disease may be a skin disease. In some embodiments, the disease may be a skin disease or any other disease associated with inflammation (e.g., atopic dermatitis or acne).
In some aspects, provided herein are methods of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof by administering a composition comprising a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), a composition comprising a strain of bacteria that expresses any one of SEQ ID NOs: 1-5 or 7-14, a composition comprising a strain of bacteria that comprises an nucleic acid set forth in SEQ ID NO: 6, 15 or any nucleic acid disclosed herein, or a composition comprising agent X to the subject. In some aspects, provided herein are methods of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof by administering a composition comprising a
Propionibacterium bacterium that expresses agent X to the subject.
In some aspects, provided herein are methods of reducing the levels of a Gram positive bacteria in a subject or on a subject’s skin in need thereof by administering a composition comprising agent X to the subject. In some aspects, provided herein are
reducing the levels of a Gram-positive bacteria in or on a subject in need thereof by administering a composition comprising a Propionibacterium bacterium that produces agent X to the subject, a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), a composition comprising a strain of bacteria that expresses any one of SEQ ID NOs: 1-5 or 7-14, a composition comprising a strain of bacteria that comprises an nucleic acid set forth in SEQ ID NO: 6, 15 or any nucleic acid disclosed herein, or a composition comprising agent X to the subject. The Propionibacterium bacterium may be P. acnes. The Propionibacterium bacterium may be P. avidum. The Gram positive bacteria may be Staphylococcus, such as Methicillin-resistant Staphylococcus aureus (MRSA). The Gram positive bacteria may be Enterococcus, such as Vancomycin- resistant Enterococcus (VRE). The Gram positive bacteria is Streptococcus , such as Group A Streptococcus (GAS). In some embodiments, the subject has a skin disease associated with inflammation (e.g., atopic dermatitis or acne). In some embodiments, the Gram-positive bacteria is Clostridium difficile.
Agent X may be a microbial peptide encoded by Locus 4. Agent X may comprise a least one peptide with an amino acid sequence of any one of SEQ ID NOs: 1-5 or 7-14 (e.g., agent X may comprise at least one peptide with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology to any one of SEQ ID NOs: 1-5 or 7-14). Agent X may comprise a peptide encoded by a nucleic acid sequence of any one of SEQ ID NOs: 6, 15 or any other sequence disclosed herein (e.g., agent X may comprise at least one nucleic acid with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology to any one of SEQ ID NOs: 6, 15, or any other sequence disclosed herein). Agent X may be a lantibiotic. Agent X may be expressed by Propionibacterium bacterium. The
Propionibacterium bacterium may be P. acnes (e.g., RT8, RT3, RT1, and RT5 P. acnes strains or P. acnes belongs to the IB-1, IB2, and IC clades). The Propionibacterium bacterium may be P. avidum.
In some embodiments, the composition further comprises an antibiotic. In some embodiments, the composition is formulated for topical delivery. In other embodiments, the composition is formulated for oral deliver}' . In some embodiments, the subject is human.
The methods provided herein include methods of administering separate compositions, each
composition comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of the bacterial strains provided herein. Each composition to be administered may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of any bacterial strain that comprises Locus 4, encodes for at least one peptide with at least 50% homology to any amino acid sequence set forth in SEQ ID Nos: 1-5 or 7- 14, comprises homology with any nucleic acid sequence disclosed herein, or any bacterial strain that produces agent X. The compositions may be administered concurrently or sequentially. The compositions may be administered conjointly. Locus 4 may comprise at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with SEQ ID NO: 6, 15 or any other nucleic acid sequence disclosed herein.
In certain embodiments, agents and/or compositions of the invention may be used alone or conjointly administered with another type of therapeutic agent and/or a second composition disclosed herein. As used herein, the phrase“conjoint administration” refers to any form of administration of two or more different therapeutic agents such that the second agent is administered while the previously administered therapeutic agent is still effective in the body ( e.g ., the two agents are simultaneously effective in the subject, which may include synergistic effects of the two agents). For example, the different therapeutic agents can be administered either in the same formulation or in separate formulations, either concomitantly or sequentially. In certain embodiments, the different therapeutic agents can be administered within about one hour, about 12 hours, about 24 hours, about 36 hours, about 48 hours, about 72 hours, or about a week of one another. Thus, a subject who receives such treatment can benefit from a combined effect of different therapeutic agents.
In some embodiments, the methods provided herein include further conjoint administration of a composition (e.g., a pharmaceutical or cosmetic composition) comprising iron and/or cobalt to the subject. In some embodiments, the subject that receives conjoint administration has a skin disease (e.g., inflammatory skin disease, such as acne, rosacea, psoriasis, or Porphyria Cutanea Tarda (PCT)).
In some aspects, provided herein are methods and compositions related to treating or preventing a skin disease (e.g., inflammatory skin disease, such as acne, psoriasis, rosacea, or Porphyria Cutanea Tarda (PCT)), preventing and/or slowing skin aging (e.g.,
preventing the formation of wrinkles), and maintaining healthy skin by administering to the subject a composition disclosed herein. The compositions disclosed herein may be administered conjointly with a composition comprising iron and/or cobalt.
In some embodiments, the subject is in need of reducing the level porphyrins (e.g., bacterially derived porphyrins) on the skin of a subject by administering (e.g., a subject with symptoms of skin aging, or a subject with a skin condition, such as a skin disease associated with inflammation, acne, psoriasis, rosacea, PCT, or any other skin disease disclosed herein) a composition disclosed herein to the subject. The porphyrins may be produced by P. acnes (e.g., acne-associated strains of P. acnes). The porphyrins may be produced by P. granulosum, P. avidum , orP. humerusii (e.g., disease-associated strains of P. granulosum, P. avidum, or P. humerusii ). The composition may be administered conjointly with a compositions comprising iron and/or cobalt.
BRIEF DESCRIPTION OF THE FIGURES
Figure 1 shows the Locus 4 region of P. acnes encodes Pilosebin L4, a type III lantibiotic. Genes found in locus 4 are colored by their corresponding KEGG Orthology assignments. HL030PA2 strain of P. acnes is used as a representative, with gene numbers corresponding to locus tag ID (HMPREF9602 0XXXX). The type III lantibiotic gene cluster detected by BAGEL3 is underlined.
Figure 2 shows a phylogenetic tree highlighting taxa within the Actinomycetales order that encode for the lantibiotic from locus 4. . (A) Red taxa encode for full locus 4 with lantibiotic gene cluster, while blue taxa encode for partial locus 4 lacking the lantibiotic gene cluster. The lantibiotic gene cluster is restricted to P. acnes and P. avidum lineages.
All nodes have Bayesian posterior probabilities greater than 0.9. Branches with Maximum Likelihood bootstrap support over 70% are thickened. Bifidobacterium bifidum was used as the outgroup. (B) Cladogram of the phylogenetic reconstruction of part A. Green branches indicate lineages that have retained locus 4. P. acnes clades and ribotypes are indicated above branches.
Figure 3 shows that Pilosebin L4 producers can inhibit a broad range of Gram - positive bacteria, but not Gram -negative bacteria. Inhibitory activity of PL4 produced from 10 P. acnes strains (RT1, RT8, RT3, and RT5 strains) and 1 P. avidum strain (shown in columns) against 17 P. acne s strains , 3 other Propionibacterium species, and multiple Gram-positive species (shown in rows) were measured. The sizes of the inhibition zones (mm) are colored as a gradient with black boxes indicating highest inhibition, and white
boxes indicating no inhibition. P. acnes strain HL037PA1, which does not encode PilosebinL4, is shown as a negative control.
Figure 4 shows P. acnes strains containing L4 locus inhibit the growth of
PilosebinL4-negative P. acnes strains (HL030PA1 is shown here as an example) and other Gram + bacteria. Two Staphyloccocus aureus strains, S. aureus 4330 (MRS A) and S. aureus 29213 (MSS A) are shown here as examples.
Figure 5 shows P. acnes strains containing L4 locus inhibit the growth of
PilosebinL4-negative P. acnes strains and other Gram + bacteria, including Staphyloccocus aureus , Clostridium difficile, and Bacillus subtilis.
Figure 6 shows that Pilosebin L4 is regulated by cell density. P. acnes. HL030PA2 cultures of decreasing cell densities were used to measure RNA expression levels of the major lantibiotic modification enzyme (LanKC) and the histidine kinase regulatory gene (HISK) in the lantibiotic gene cluster. Expression of both genes were normalized to the single copy housekeeping gene pak and shown as relative expression against undiluted cultures. *p < 0.05, **p < 0.01, ***p < 0.005, ****p < 0.0005.
Figure 7 shows bacterial species expressing Pilosebin L4 can outcompete
PilosebinL4-negative cells in a microbial community. Mock communities of PilosebinL4 expressing P. acnes and P. avidum (blue columns) and L4-negative P. acnes strains (grey columns) were mixed in various ratios and combinations (“input” communities). Strain composition after 48 hours of growth was measured (“output” communities) using qPCR and strain-specific primers. *p < 0.05, ***p < 0.0005, ****p < 0.0001.
Figure 8 shows the changes in expression levels of Locus 4 genes between pure culture and co-culture based on transcriptomic analysis. Upregulation of several genes in a co-culture bacterial community compared to pure culture was observed, suggesting these genes play a role in Pilosebin L4 regulation. Right column co-culture, Left column pure culture.
Figure 9 shows Actinomycetales species harboring partial locus 4 genes. Remnants of locus 4 were detected in 7 species, based on BLASTn searches against full, partial, and draft bacterial genomes on IMG. The full locus 4 with the lantibiotic operon is represented by P. acnes HL030PA2. Genes are colored according to their KO assignments. Gene numbers corresponds to locus tag IDs: P. acnes HL030PA2, HMPREF9602 0XXXX; P. acidifaciens DSM 21887, K336DRAFT_0XXXX; Streptomyces .sp. ATexAB-D23, B082DRAFT 0XXXX; Streptomyces sp. 303MFCol5.2, H294DRAFT_0XXXX; K.
cheerisanensis KCTC 2395, KCH_XXXXX; K. setae KM-6054, KSE_XXXXX;
Kitasatospora sp. SolWspMP-SS2h, K353 DRAF T OXXXX; K. mediocidica KCTC 9733, BS80DRAFT 0XXXX.
Figure 10 shows Locus 4 is integrated in the same genetic loci in P. acnes and P. avidum. The genetic loci of locus 4 is displayed with genes flanked on both ends. Locus 4 is not drawn to scale relative to other genes. Genes are colored by their KO assignments.
DETAILED DESCRIPTION
Applicant has identified a lantibiotic (bacteriocin) that is uniquely expressed in certain strains of P. acnes and a related skin bacterium, Propionibacterium avidum. This lantibiotic is encoded in a unique genomic region named Locus 4 (Tomida et al ., 2013). Lantibiotics are a type of bacteriocin that can kill other cells in the bacterial community and thus change the population and dynamics of the microbiome. The lantibiotic identified in this invention, which is named Pilosebin L4 or agent X, can inhibit the growth of a broad range of Gram-positive bacteria, including common skin bacterial species as well as important clinical pathogens such as Methicillin-resistant Staphylococcus aureus (MRSA), Vancomycin-resistant Enterococcus (VRE), Group A Streptococcus (GAS), and
Clostridium difficile. The Gram-positive bacteria may be P. acnes, P. avidum, P.
granulosum, or P. humerusii (disease associated strains of P. acnes, P. avidum, P.
granulosum, or P. humerusii). Applicant has demonstrated that P. acnes and P. avidum strains that contain Locus 4 and express Pilosebin L4 outcompete other bacterial strains that do not express the lantibiotic and become the dominant members of the community.
Provided herein are methods and compositions useful in the treatment of infections caused by Gram-positive bacteria. In some aspects, provided herein are methods of treating or preventing a disease (e.g., a skin disease, a disease of the GI tract, or any other disease) in a subject in need thereof by administering a composition comprising agent X to the subject or administering a composition comprising a Propionibacterium bacterium that expresses agent X to the subject.
In some aspects, provided herein are methods of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof by administering a
composition comprising agent X to the subject. In some aspects, provided herein are methods of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof by administering a composition comprising a Propionibacterium bacterium
that produces agent X, a composition comprising a strain of bacteria that expresses an amino acid of any one of SEQ ID NOs: 1-5 or 7-14, a composition comprising a strain of bacteria that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein, or a Propionibacterium bacterium strain that comprises Locus 4 to the subject.
In some aspects, provided herein are methods of reducing the levels of a Gram positive bacteria in the subject or on the skin of a subject in need thereof by administering a composition comprising agent X, a composition comprising a strain of bacteria that expresses at least one amino acid set forth SEQ ID NOs: 1-5 or 7-14, a composition comprising a strain of bacteria that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein and/or a Propionibacterium bacterium strain that comprises Locus 4 to the subject. The Gram-positive bacteria may be in or on any site of the body, including, but not limited to, the skin, gastrointestinal tract, mouth, ear, blood, lung, surgical sites, urinary tract, or any other organ of the body.
Similarly,“infection” as used herein, can refer to an infection on any part of the body, including, but not limited to, the skin, gastrointestinal tract, mouth, ear, blood, lung, surgical sites, urinary tract, or any other organ of the body. In some aspects, provided herein are reducing the levels of a Gram-positive bacteria in or on the skin of a subject in need thereof by administering a composition comprising a Propionibacterium bacterium that expresses agent X and/or a Propionibacterium bacterium strain that comprises Locus 4 to the subject.
Definitions
As used herein the specification, "a" or "an" may mean one or more. As used herein in the claim(s), when used in conjunction with the word "comprising", the words "a" or "an" may mean one or more than one. As used herein“another” may mean at least a second or more.
The term“ preventing " is art-recognized, and when used in relation to a condition, such as a local recurrence, is well understood in the art, and includes administration of a composition which reduces the frequency of, or delays the onset of, symptoms of a medical condition in a subject relative to a subject which does not receive the composition. Thus, prevention of acne includes, for example, reducing the number of detectable acne lesions in a population of patients receiving a prophylactic treatment relative to an untreated control
population, and/or delaying the appearance of detectable lesions in a treated population versus an untreated control population, e.g., by a statistically and/or clinically significant amount.
The term“ prophylactic” or“therapeutic" treatment is art-recognized and includes administration to the host of one or more of the subject compositions. If it is administered prior to clinical manifestation of the unwanted condition (e.g., disease or other unwanted state of the host animal) then the treatment is prophylactic (i.e., it protects the host against developing the unwanted condition), whereas if it is administered after manifestation of the unwanted condition, the treatment is therapeutic (i.e., it is intended to diminish, ameliorate, or stabilize the existing unwanted condition or side effects thereof).
The term“ ribotype” refers to strains of P. acnes. The ribotyped strains were characterized as in Fitz-Gibbon et al. (J. Investigative Dermatology 133:2152-60 (2013)).
The term“subject” refers to a mammal, including, but not limited to, a human or non-human mammal, such as a bovine, equine, canine, ovine, or feline.
A“ therapeutically effective amount’ of a compound with respect to the subject method of treatment refers to an amount of the compound(s) in a preparation which, when administered as part of a desired dosage regimen (to a mammal, preferably a human) alleviates a symptom, ameliorates a condition, or slows the onset of disease conditions according to clinically acceptable standards for the disorder or condition to be treated or the cosmetic purpose, e.g., at a reasonable benefit/risk ratio applicable to any medical treatment.
As used herein, the term“ treating’ or“ treatment’ includes reversing, reducing, or arresting the symptoms, clinical signs, and underlying pathology of a condition in a manner to improve or stabilize a subject's condition.
Therapeutic Methods
Provided herein are methods and compositions useful in the treatment of infections caused by Gram-positive bacteria. In some aspects, provided herein are methods of treating or preventing a disease (e.g., a skin disease or any disease disclosed herein) in a subject in need thereof by administering a composition comprising agent X to the subject or administering a composition comprising a Propionibacterium bacterium that produces agent X, a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), a composition comprising a strain of bacteria that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein, or a composition comprising a strain of bacteria that expresses any one of SEQ ID NOs: 1-5
or 7-14 to the subject. The infection caused by Gram-positive bacteria may be in or on any site of the body, including, but not limited to, the skin, gastrointestinal tract, mouth, ear, blood, lung, surgical sites, urinary tract, or any other organ of the body.
In some aspects, provided herein are methods of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof by administering a
composition comprising agent X, a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), a composition comprising a strain of bacteria that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein, or a composition comprising a strain of bacteria that expresses any one of SEQ ID NOs: 1-5 or 7-14 to the subject. In some aspects, provided herein are methods of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof by administering a composition comprising a Propionibacterium bacterium that produces agent X, a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), a composition comprising a strain of bacteria that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein, or a composition comprising a strain of bacteria that expresses any one of SEQ ID NOs: 1-5 or 7-14 to the subject.
In some aspects, provided herein are methods of reducing the levels of a Gram positive bacteria in (e.g., in the GI tract) or on the skin of a subject in need thereof by administering a composition comprising agent X and/or a Propionibacterium bacterium strain that comprises Locus 4 to the subject. In some aspects, provided herein are reducing the levels of a Gram-positive bacteria in (e.g., in the GI tract) or on the skin of a subject in need thereof by administering a composition comprising a Propionibacterium bacterium that produces agent X and/or a Propionibacterium bacterium strain that comprises Locus 4 to the subject.
In some embodiments, the skin disease is a caused by Gram-positive bacteria. The Gram-positive bacteria may be any Gram-positive bacteria that is pathological. The Gram positive bacteria may be Staphylococcus, such as Methicillin-resistant Staphylococcus aureus (MRSA). The Gram-positive bacteria may be Enterococcus, such as Vancomycin-resistant Enterococcus (VRE). The Gram-positive bacteria is Streptococcus, such as Group A
Streptococcus (GAS). The Gram-positive bacteria may be P. acnes, P. avidum, P.
granulosum, or P. humerusii. In some embodiments, the disease is a skin disease. In some embodiments, the disease of the gastrointestinal tract. In some embodiments, the disease of
the gastrointestinal tract. In some embodiments, the disease of the genitalia. In some embodiments, the disease is a skin disease associated with inflammation (e.g., atopic dermatitis or acne, such as acne caused by acne-causing strains of P. acnes).
The Propionibacterium bacterium may be P. acnes (e.g., RT8, RT1, RT5, or RT3 P. acnes or P. acnes that belongs to the IB-1, IB-2, or IC clades). The Propionibacterium bacterium may be P. avidum. The Gram positive bacteria may be Staphylococcus, such as Methicillin-resistant Staphylococcus aureus (MRSA). The Gram positive bacteria may be Enterococcus , such as Vancomycin-resistant Enterococcus (VRE). The Gram positive bacteria may be Streptococcus , such as Group A Streptococcus (GAS). The Gram-positive bacteria may be P. acnes, P. avidum, P. granulosum, or P. humerusii. In some
embodiments, the subject has a skin disease associated with inflammation (e.g., atopic dermatitis or acne). In some embodiments, the Gram-positive bacteria is Clostridium difficile. In some embodiments, the subject is afflicted with or suffering from Methicillin- resistant Staphylococcus aureus (MRSA), Vancomycin-resistant Enterococcus (VRE), Group A Streptococcus (GAS), or Clostridium difficile.
Agent X may be a lantibiotic, e.g., a class III lantibiotic. Agent X may be expressed by Propionibacterium bacterium. Agent X may comprise a peptide (e.g., at least one, at least two, at least three, at least four, at least five, at least six, or at least seven) with an amino acid sequence with at least 50%, at least 80%, at least 90%, at least 95%, at least 99%, or 100% homology with any one of SEQ ID NOs: 1-5 or 7-14. The
Propionibacterium bacterium may be P. acnes (e.g., RT8, RT1, RT5, RT3 P. acnes strains or P. acnes that belongs to the IB-1, IB-2, or IC clades). The Propionibacterium bacterium may be any P. acnes highlighted in Figures 1-7. The Propionibacterium bacterium may be P. acnes HL030PA2 or P. acnes HL086PA1. The Propionibacterium bacterium may be any Propionibacterium that has retained Locus 4. The Propionibacterium bacterium may be P. avidum (e.g ., P. avidum strains HGH0353 and HL083PVl strains). The Propionibacterium bacterium may be any P. acnes or P. avidum strains that produce agent X.
Exemplary Propionibacterium acnes strain HL030PA2— proteins encoded by lantibiotic region of locus 4
HMPREF9602 01325 - response regulator receiver domain protein
MTTRILLAEDIKLVAEAFEALLSVEPEFEVVARVARGDDLVTSATRLFPDVILADID MPGMTGIE ATRMLRDKGYRGRIILLT ALPGSGHLHAAM AAGADGYLLKSIT AP SLI NAIRAVCNGQSAIDPNVAAVAMRKGPSPLNDRETEILRLVADGSSTAQIASRLYLS KGT VRNYL ST AMSKLD AD SRT AAVTRAREEGWL (SEQ ID NO: 1)
HMPREF9602 01326 - histidine kinase
MVRTRPVLDSPGRPLIASGVVLAVLLIIAVMTMVLQRDPTLTPGRRILGIVLSTVQA V GFMWLQTRM VRHGKGSRNMRATLGRV GF W AT W GL V A V GVVNL WLTN S WTLF GASVATPLLLLPGVWSVVATLVTLIVGFSDLVVTHTSPLTSATVVLVTIAVSVNLY AF TKL S T AL VELRS S QEEI ARLRVD AERHRI SRDLHDIIGRTL V AT SMRQQ A ALHL V DRDPQRAKEQLDAAHDAITEGQHQLRSIIQAEMSTSLPDEISDATFLCDRLHIDFRM DDRGRPHKPFDSAAAAALREGITNMLKHSAAGYCHVAISPDLLTVTNDGCPQSPRP STTPGTGIDHLRSQIEALGGSVTTSRPSRGTFRLRCSFPTRGASTTTPATEGGR(SEQ ID NO: 2)
HMPREF9602 01327 - hypothetical protein
MASTDILSPGVHRGETSHACQGVLAQHVFLDVWSLSVVNYRR(SEQ ID NO: 3)
HMPREF9602 01328 - hypothetical protein
MS VEAMQ SIEMDEEN S ASQT VC AC Y SFF S W SGCC VV SQ AVEAS (SEQ ID NO: 4)
HMPREF9602 01329 - hypothetical protein
MYQATWRDGTSVVVKEARHLSGLDAAGVDARVRLRHEYEALRRLDPYRAAPHPI DLIETEDGSFLIMEFLDGMTVHQEMSRFHPLIGRRPHRLSMTDFSRWCREVEDRLR N VTRVM AGCGI VHGDLHP ANLIH V GHE VL VTDFE S C SIDG V A V S S GI A AP WF Q SDD TIPDPATTDDLHTLLVDPTCGPALVLHPNLRALISQAAVEDMMGNPTGLPHAWNLE DVT SEL AKGIRAS ATP ARADRLFP SDP YLF GHPGSEF GLMHGAAGIMAAL AVT GY G VDANHVTWMKDRLATRPTLLPGLANGIEGIALGLSLCGQNDMAASLLHQSGILTIT TNGSTDLTLGTGMAGRACALQSLSQRLSSKSLAHAAYTLWEQLAVAVRNTDVAL PNGLF SGWEGIGLSLLASPLPDRHDLARHSLRLAL ATTTIVDGALF SGEGQIRWPYL GRGP A AC GPL A ARLDDD Q T AK A V AQ T CRCPL TE S S GLHN GRAGLLL VLRQL V GD QDD A VRRHLMRL S W SMDRREEGTLLLGDHGLRF S SDL AT GS AGALL AL SRDP WR NMTRMLGICDD T CHGPL VT V ( SEQ ID NO: 5)
Propionibacterium acnes HL030PA2— DNA sequence of HMPREF9602 01329 to
HMPREF9602 01325
CTACAGCCAGCCCTCCTCGCGTGCCCGCGTGACCGCCGCTGTGCGTGAGTCGGC
GTCGAGCTTCGACATCGCCGTCGACAGGTAGTTCCTGACGGTGCCCTTGCTGAG
GTACAGCCGCGAGGCGATCTGCGCGGTGGAGGAACCGTCGGCGACTAGGCGCA
GAATCTCGGTTTCCCGGTCGTTGAGGGGCGAGGGTCCCTTGCGCATGGCGACCG
CGGCGACGTTCGGGTCGATGGCCGACTGGCCGTTGCACACCGCCCGGATGGCG
TTGATGAGGGAGGGCGCGGTGATCGACTTGAGCAGGTACCCGTCGGCTCCGGC
AGCCATCGCGGCGTGCAGGTGCCCGCTTCCCGGCAGGGCGGTGAGCAGGATGA
TTCTGCCGCGGTATCCCTTGTCGCGAAGCATTCGGGTGGCCTCGATGCCGGTCA
TCCCGGGCATGTCGATGTCGGCCAGGATCACGTCGGGGAACAGGCGGGTGGCG
GATGTGACCAGGTCGTCGCCGCGTGCCACCCGTGCGACGACCTCGAACTCCGGT
TCCACCGAGAGCAGTGCCTCGAAGGCCTCTGCCACCAGTTTGATGTCCTCGGCG
AGGAGGATTCTCGTCGTCATCGTCCTCCTTCGGTCGCGGGTGTGGTCGTGGACG
CCCCCCGGGTCGGGAAGGAGCAGCGGAGCCGGAAGGTGCCCCGCGAGGGCCG
CGACGTCGTCACCGACCCACCGAGCGCCTCGATCTGGGACCGGAGATGGTCGA
TTCCGGTGCCCGGTGTGGTGGAGGGGCGAGGTGATTGCGGACAACCGTCGTTG
GT GACGGT C AGGAGGTCCGGGGAGAT GGCGACGT GGC AGT AGCCCGCCGCGCT
Additional Exemplary Propionibacterium acnes lantibiotic region of locus 4
Response regulator two-component system NarL family
Strains (100% sequence identity in all these strains) and Locus tag:
HL030PA2 HMPREF9602 01325
HL053PA2 HMPREF9565 00684
HL063PA2 HMPREF9612 00736
HL078PA1 HMPREF9569 00974
HL082PA1 HMPREF9618 00908
HL086PA1 HMPREF9591 00696
HL092PA1 HMPREF9584 00678
HL110PA1 HMPREF9575 01636
HL110PA2 HMPREF9576 00295
Sensor histidine kinase two-component system NarL family
Strains (100% sequence identity in all these strains) and Locus tag:
HL030PA2 HMPREF9602 01326
HL053PA2 HMPREF9565 00683
HL063PA2 HMPREF9612 00735
HL078PA1 HMPREF9569 00975
HL082PA1 HMPREF9618 00909
HL086PA1 HMPREF9591 00695
HL092PA1 HMPREF9584 00679
HL110PA1 HMPREF9575 01637
HL110PA2 HMPREF9576 00296
Amino acid (aa) sequence:
Hypothetical protein
Strains (100% sequence identity in all these strains) and Locus tag:
HL030PA2 HMPREF9602 01327
HL053PA2 HMPREF9565 00682
HL063PA2 HMPREF9612 00734
HL078PA1 HMPREF9569 00976
HL082PA1 HMPREF9618 00910
HL086PA1 HMPREF9591 00694
HL092PA1 HMPREF9584 00680
HL1 10PA1 HMPREF9575 01638
HL1 10PA2 HMPREF9576 00297
Amino acid (aa) sequence:
MASTDILSPGVHRGETSHACQGVLAQHVFLDVWSLSVVNYRR(SEQ ID NO: 9)
Hypothetical protein
Strains (100% sequence identity in all these strains) and Locus tag:
HL030PA2 HMPREF9602 01328
HL053PA2 HMPREF9565 00681
HL063PA2 HMPREF9612 00733
HL078PA1 HMPREF9569 00977
HL082PA1 HMPREF9618 0091 1
HL086PA1 HMPREF9591 00693
HL092PA1 HMPREF9584 00681
HL1 10PA1 HMPREF9575 01639
HL1 10PA2 HMPREF9576 00298
Amino acid (aa) sequence:
MSVEAMQSIEMDEENSASQTVCACYSFFSWSGCCVVSQAVEAS(SEQ ID NO: 10)
Hypothetical protein
1) Strains and Locus tag:
HL030PA2 HMPREF9602 01329
HL063PA2 HMPREF9612 00732
Amino acid (aa) sequence:
2) Strains and Locus tag: (99% identical to above sequence in HL030PA2 and HL063PA2, 3 aa difference)
HL053PA2 HMPREF9565 00680
HL078PA1 HMPREF9569 00978
HL082PA1 HMPREF9618 00912
HL086PA1 HMPREF9591 00692
Amino acid (aa) sequence:
3) Strains and Locus tag: (99% identical to above sequence in HL030PA2 and HL063PA2, 4 aa difference)
HL092PA1 HMPREF9584 00682
HL1 10PA1 HMPREF9575 01640
Amino acid (aa) sequence:
4) Strains and Locus tag: (99% identical to above sequence in HL030PA2 and HL063PA2, 4 aa difference)
HL1 10PA2 HMPREF9576 00299
Amino acid (aa) sequence:
All of the referenced sequences are fully incorporated by reference in the form that was current on July 22, 2020.
in some embodiments, the methods provided herein include further conjoint administration of a composition (e.g., a pharmaceutical or cosmetic composition) comprising iron and/or cobalt to the subject. In some embodiments, the subject that receives conjoint administration has a skin disease (e.g., inflammatory skin disease, such as acne, rosacea, psoriasis, or Porphyria Cutanea Tarda (PCT)). In some embodiments, the subject has symptoms of skin aging.
In some aspects, provided herein are methods of promoting vitamin B12 biosynthesis in acne-associated strains of P. acnes on the skin of a subject by further administering a composition comprising cobalt and/or iron.
The compositions disclosed herein may further comprises one or more strains of P. acnes. The P. acnes strain may be RT1, RT2, RTS, or RT6 strain of P. acnes. The compositions may further comprise at least one phage against a strain of P. acnes (e.g., a phage that target a strain of P. acnes (e.g., RT4, RTS, RT7, RTS, RT9 or RTIQ). The compositions may further comprise P. granulosum, P. avidum, P. humerusii. Compositions
disclosed herein may comprise an antibiotic (e.g., an antibiotic that does not target P.
granulosum, P. avidum , P. humerusii, or an RT1, RT2, RT3, or RT6 strain of P. acnes).
The compositions disclosed herein may further comprise one or more strains of P. acnes (i.e., a strain associated with healthy skin, such as a RT1, RT2, RT3, or RT6 strain of P. acnes). The methods provided herein many further comprising administering one or more strains of P. acnes (i.e., a strain associated with healthy skin, such as a RT1, RT2, RT3, or RT6 strain of P. acnes). The compositions and method may further comprise at least one phage against a strain of P. acnes . The phage may target a strain of P. acnes that is associated with acne or an inflammatory skin disease, such as RT4, RTS, RT7, RT8, RT9 or RT10. The compostion may comprise P. granulosum, P. avidum, P. humerusii.
Compositions disclosed herein may comprise an antibiotic (e.g., an antibiotic that does not target P. granulosum, P. avidum, P. humerusii, or an RT1, RT2, RT3, or RT6 strain of P. acnes). Compositions may contain two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more strains of P. acnes (e.g., an RT1, RT2, RT3, or RT6 strain of P. acnes), P. granulosum, P. avidum, and/or P. humerusii.
In some embodiments, the composition further comprises a phage against a strain of P. acnes (e.g., a RT4, RT5, RT7, RT8, RT9 or RT10 strain of P. acnes). In some embodiments, the composition comprises two or more (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) phages against a strain of P. acnes. The type of phage that may be administered in a composition disclosed herein depends on the type of acne or skin disease, the medical history of an individual, or the symptoms of a subject with a skin disease. Non-limiting examples of phages include PHL111M01, PHL082M00, PHL060L00, PHL067M10, PHL071N05, PHL112N00, PHL037M02, PHL085N00, PHL115M02, PHL085M01, PHL114L00, PHL010M04, PHL066M04, PHL071N05, PHL113M01, PHL112N00, and PHL037M02. Information about P. acnes phages can be found in U.S. Patent Publication US20150086581A1, hereby incorporated in its entirety.
In some embodiments, the composition further comprises an antibiotic or the method further comprising administering and antibiotic to the subject (i.e., an antibiotic that does not target an agent X expressing bacterium, a bacterium that comprises Locus 4, or a bacterium described herein). In some embodiments, the subject is human.
In some embodiments, the methods provided herein include further conjoint administration of a composition (e.g., a pharmaceutical or cosmetic composition) comprising iron and/or cobalt to the subject. In some embodiments, the subject that is conjointly administered the compositions has a skin disease disclosed herein (e.g., inflammatory skin disease, such as acne, rosacea, psoriasis, or Porphyria Cutanea Tarda (PCT)).
In some aspects, provided herein are methods and compositions related to treating or preventing a skin disease disclosed herein, preventing and/or slowing skin aging (e.g., preventing the formation of wrinkles), and maintaining healthy skin by administering to the subject a composition disclosed herein. The skin disease may be acne, rosacea, psoriasis or PCT. The composition may be administered conjointly with a compositions comprising iron and/or cobalt.
In some embodiments, the subject is in need of reducing the level porphyrins (e.g., bacterially derived porphyrins) on the skin of a subject by administering (e.g., a subject with symptoms of skin aging, or a subject with any skin condition disclosed herein, such as a skin disease associated with inflammation, acne, rosacea, psoriasis, or PCT) a
composition disclosed herein to the subject. The porphyrins may be produced by P. acnes (e.g., acne-associated strains of P. acnes). The porphyrins may be produced by P.
gramdosum , P. avidum, or P. humerusii (e.g , disease-associated strains of P. granulosum, P. avidum , or P. humerusii ). The composition may be administered conjointly with a compositions comprising iron and/or cobalt.
The compositions disclosed herein may be heat treated, tyndallized and/or comprise supernatant-derived bacteria.
The compositions disclosed herein may be administered to a subject by any means known in the art, for example, the composition may be formulated for topical delivery. The formulation may be a liquid, gel, or cream. In some embodiments, the composition is formulated for oral delivery. The composition may be in the form of a pill, tablet, or capsule. In some embodiments, the subject may be a mammal (e.g., a human). In some embodiments, the composition is self-administered.
In general, the above methods directly act to reduce the amount of pathogenic or harmful bacteria in a subject. In some embodiments, this includes any such therapy that achieves the same goal of reducing the number of pathogenic or harmful organisms, when used in combination with the composition described herein, would lead to replacement of
the pathogenic microflora involved in the diseased state with natural microflora enriched in a body site not afflicted with a disease, or less pathogenic species occupying the same ecological niche as the type causing a disease state. For example, a subject may undergo treatment with antibiotics or a composition comprising compounds to target and decrease the prevalence of pathogenic organisms, and subsequently be treated with a composition described herein.
Suitable antimicrobial compounds include capreomycins, including capreomycin IA, capreomycin IB, capreomycin IIA and capreomycin IIB; carbomycins, including
carbomycin A; carumonam; cefaclor, cefadroxil, cefamandole, cefatrizine, cefazedone, cefazolin, cefbuperazone, cefcapene pivoxil, cefclidin, cefdinir, cefditoren, cefime, ceftamet, cefmenoxime, cefmetzole, cefminox, cefodizime, cefonicid, cefoperazone, ceforanide, cefotaxime, cefotetan, cefotiam, cefoxitin, cefpimizole, cefpiramide, cefpirome, cefprozil, cefroxadine, cefsulodin, ceftazidime, cefteram, ceftezole, ceftibuten, ceftiofur, ceftizoxime, ceftriaxone, cefuroxime, cefuzonam, cephalexin, cephalogycin, cephaloridine,
cephalosporin C, cephalothin, cephapirin, cephamycins, such as cephamycin C, cephradine, chlortetracycline; chlarithromycin, clindamycin, clometocillin, clomocycline, cloxacillin, cyclacillin, danofloxacin, demeclocyclin, destomycin A, dicloxacillin, dirithromycin, doxycyclin, epicillin, erythromycin A, ethanbutol, fenbenicillin, flomoxef, florfenicol, floxacillin, flumequine, fortimicin A, fortimicin B, forfomycin, foraltadone, fusidic acid, gentamycin, glyconiazide, guamecycline, hetacillin, idarubicin, imipenem, isepamicin, josamycin, kanamycin, leumycins such as leumycin Al, lincomycin, lomefloxacin, loracarbef, lymecycline, meropenam, metampicillin, methacycline, methicillin, mezlocillin, micronomicin, midecamycins such as midecamycin Al, mikamycin, minocycline, mitomycins such as mitomycin C, moxalactam, mupirocin, nafcillin, netilicin, norcardians such as norcardian A, oleandomycin, oxytetracycline, panipenam, pazufloxacin,
penamecillin, penicillins such as penicillin G, penicillin N and penicillin O, penillic acid, pentylpenicillin, peplomycin, phenethicillin, pipacyclin, piperacilin, pirlimycin,
pivampicillin, pivcefalexin, porfiromycin, propiallin, quinacillin, ribostamycin, rifabutin, rifamide, rifampin, rifamycin SV, rifapentine, rifaximin, ritipenem, rekitamycin,
rolitetracycline, rosaramicin, roxithromycin, sancycline, sisomicin, sparfloxacin,
spectinomycin, streptozocin, sulbenicillin, sultamicillin, talampicillin, teicoplanin, temocillin, tetracyclin, thostrepton, tiamulin, ticarcillin, tigemonam, tilmicosin, tobramycin,
tropospectromycin, trovafloxacin, tylosin, and vancomycin, and analogs, derivatives, pharmaceutically acceptable salts, esters, prodrugs, and protected forms thereof.
Suitable anti-fungal compounds include ketoconazole, miconazole, fluconazole, clotrimazole, undecylenic acid, sertaconazole, terbinafme, butenafme, clioquinol, haloprogin, nystatin, naftifme, tolnaftate, ciclopirox, amphotericin B, or tea tree oil and analogs, derivatives, pharmaceutically acceptable salts, esters, prodrugs, and protected forms thereof.
Suitable antiviral agents include acyclovir, azidouridine, anismoycin, amantadine, bromovinyldeoxusidine, chlorovinyldeoxusidine, cytarabine, delavirdine, didanosine, deoxynojirimycin, dideoxycytidine, dideoxyinosine, dideoxynucleoside, desciclovir, deoxyacyclovir, efavirenz, enviroxime, fiacitabine, foscamet, fialuridine, fluorothymidine, floxuridine, ganciclovir, hypericin, idoxuridine, interferon, interleukin, isethionate, nevirapine, pentamidine, ribavirin, rimantadine, stavudine, sargramostin, suramin, trichosanthin, tribromothymidine, trichlorothymidine, trifluorothymidine, trisodium phosphomonoformate, vidarabine, zidoviridine, zalcitabine and 3-azido-3-deoxythymidine and analogs, derivatives, pharmaceutically acceptable salts, esters, prodrugs, and protected forms thereof.
Other suitable antiviral agents include 2',3'-dideoxyadenosine (ddA), 2', 3'- dideoxyguanosine (ddG), 2', 3 '-dideoxycytidine (ddC), 2',3'-dideoxythymidine (ddT), 2'3'- dideoxy-dideoxythymidine (d4T), 2'-deoxy-3'-thia-cytosine (3TC or lamivudime), 2', 3'- dideoxy-2'-fluoroadenosine, 2',3'-dideoxy-2'-fluoroinosine, 2',3'-dideoxy-2'-fluorothymidine, 2',3'-dideoxy-2'-fluorocytosine, 2'3'-dideoxy-2',3'-didehydro-2'-fluorothymidine (Fd4T), 2'3'-dideoxy-2'-beta-fluoroadenosine (F-ddA), 2'3'-dideoxy-2'-beta-fluoro-inosine (F-ddl), and 2',3'-dideoxy-2'-beta-flurocytosine (F-ddC). In some embodiments, the antiviral agent is selected from trisodium phosphomonoformate, ganciclovir, trifluorothymidine, acyclovir, 3 '-azido-3 '-thymidine (AZT), dideoxyinosine (ddl), and idoxuridine and analogs,
derivatives, pharmaceutically acceptable salts, esters, prodrugs, and protected forms thereof.
Pharmaceutical Compositions
In some aspects, the invention relates to a composition (e.g., a pharmaceutical composition comprising agent X, a bacterium that produces agent X, a strain of bacteria comprising Locus 4 (e.g., a P. acnes or P. avidum strain comprising Locus 4), or a composition comprising a strain of bacteria that expresses any one of SEQ ID NOs: 1-5 or
7-14 disclosed herein. The compositions described herein (i.e., compositions comprising a strain of bacteria comprising Locus 4 or a strain of bacteria encoding for any one of SEQ ID NO: 1-5 or 7-14) may be formulated to promote the viability of live, replication- competent bacteria. Exemplary formulations are disclosed in W02012077038,
WO2011004375A1, WO2013188626, WO2011145737, and WO2010138522, each of which is incorporated in its entirety.
The strain of bacteria may be any strain which comprises Locus 4 (e.g., any strain with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology to Locus 4). The strain of bacteria may be any strain that expresses at least one amino acid sequence set forth in SEQ ID NOs: 1-5 or 7-14. The strain of bacteria may be any strain that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein. Exemplary
Propionibacterium bacterium strains for use in the methods and compositions provided herein include, but are not limited to, HL037PA1, HL078PA1, HL053PA2, HL082PA1, HL086PA1, HL092PA1, HL110PA1, HL110PA2, HL030PA2, HL030PA1, HL063PA2, PV-66, Type IA2 P.acnl7, HL097PA1, PRP-38, 5 U 42AFAA, HL082PA2 (e.g., P. acnes strains). Exemplary Propionibacterium bacterium strains for use in the methods and compositions provided herein also include, but are not limited to HL083PV1 or HGH0353 (e.g., P. avidum strains). The compositions provided herein may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of the bacterial strains provided herein. The compositions provided herein may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of any bacterial strain that comprises Locus 4, any bacterial strain that encodes for at least one peptide with at least 50% homology to any amino acid sequence set forth in SEQ ID NOs; 1-5 or 7-14, or any bacterial strain that produces agent X. A strain of bacteria disclosed herein may be any strain which comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with Locus 4. The strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology with at least one amino acid
sequence set forth in SEQ ID NOs: 1-5 or 7-14. The strain of bacteria may be any strain that comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95 %, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homology a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein.
The methods provided herein include methods of administering separate
compositions, each compositions comprising at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of the bacterial strains provided herein. Each composition to be administered may include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten of any bacterial strain that comprises Locus 4, any bacterial strain that encodes for at least one peptide with at least 50% homology to any amino acid sequence set forth in SEQ ID NOs: 1-5 or 7-14, any bacterial strain that comprises a nucleic acid of any one of SEQ ID NOs: 6, 15, or any other nucleic acid sequence disclosed herein, or any bacterial strain that produces agent X. The compositions may be administered concurrently or sequentially. The compositions may be administered conjointly.
The pharmaceutical composition may be formulated for topical administration. The pharmaceutical composition may be a probiotic. The pharmaceutical compositions disclosed herein may be delivered by any suitable route of administration, including orally, buccally, sublingually, parenterally, and topically, as by powders, ointments, drops, liquids, gels, or creams. In certain embodiments, the pharmaceutical compositions are delivered generally (e.g., via oral or parenteral administration). In certain other embodiments, the pharmaceutical compositions are delivered locally through injection, micro needles, or patches.
Actual dosage levels of the active ingredients in the pharmaceutical compositions may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
The selected dosage level will depend upon a variety of factors including the activity of the particular agent employed, the route of administration, the time of
administration, the rate of excretion or metabolism of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in
combination with the particular compound employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
A physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, the physician or veterinarian could prescribe and/or administer doses of the compounds employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
Exemplary identities of various constituents of the topical formulations of some embodiments of the present invention are described below.
Vehicles
Suitable topical vehicles and vehicle components for use with the formulations of the invention are well known in the cosmetic and pharmaceutical arts, and include such vehicles (or vehicle components) as water; organic solvents such as alcohols (particularly lower alcohols readily capable of evaporating from the skin such as ethanol), glycols (such as propylene glycol, butylene glycol, and glycerol (glycerin)), aliphatic alcohols (such as lanolin); mixtures of water and organic solvents (such as water and alcohol), and mixtures of organic solvents such as alcohol and glycerol (optionally also with water); lipid-based materials such as fatty acids, acylglycerols (including oils, such as mineral oil, and fats of natural or synthetic origin), phosphoglycerides, sphingolipids and waxes; protein-based materials such as collagen and gelatin; silicone-based materials (both non-volatile and volatile) such as cyclomethicone, dimethiconol, dimethicone, and dimethicone copolyol; hydrocarbon-based materials such as petrolatum and squalane; and other vehicles and vehicle components that are suitable for administration to the skin, as well as mixtures of topical vehicle components as identified above or otherwise known to the art.
In one embodiment, the compositions of the present invention are oil-in-water emulsions. Liquids suitable for use in formulating compositions of the present invention include water, and water-miscible solvents such as glycols (e.g., ethylene glycol, butylene glycol, isoprene glycol, propylene glycol), glycerol, liquid polyols, dimethyl sulfoxide, and isopropyl alcohol. One or more aqueous vehicles may be present.
In some embodiments, formulations do not have methanol, ethanol, propanols, or butanol.
~urfactants and Emulsifiers
Many topical formulations contain chemical emulsions which use surface active ingredients (emulsifiers and surfactants) to disperse dissimilar chemicals in a particular solvent system. For example, most lipid-like (oily or fatty) or lipophilic ingredients do not uniformly disperse in aqueous solvents unless they are first combined with emulsifiers, which form microscopic aqueous soluble structures (droplets) that contain a lipophilic interior and a hydrophilic exterior, resulting in an oil-in-water emulsion. In order to be soluble in aqueous media, a molecule must be polar or charged so as to favorably interact with water molecules, which are also polar. Similarly, to dissolve an aqueous-soluble polar or charged ingredient in a largely lipid or oil-based solvent, an emulsifier is typically used which forms stable structures that contain the hydrophilic components in the interior of the structure while the exterior is lipophilic so that it can dissolve in the lipophilic solvent to form a water-in-oil emulsion. It is well known that such emulsions can be destabilized by the addition of salts or other charged ingredients which can interact with the polar or charged portions of the emulsifier within an emulsion droplet. Emulsion destabilization results in the aqueous and lipophilic ingredients separating into two layers, potentially destroying the commercial value of a topical product.
Surfactants suitable for use in the present invention may be ionic or non-ionic.
These include, but are not limited to: cetyl alcohol, polysorbates (Polysorbate 20,
Polysorbate 40, Polysorbate 60, Polysorbate 80), steareth-10 (Brij 76), sodium dodecyl sulfate (sodium lauryl sulfate), lauryl dimethyl amine oxide, cetyltrimethylammonium bromide (CTAB), polyethoxylated alcohols, polyoxyethylene sorbitan, octoxynol, N,N- dimethyldodecylamine-N-oxide, hexadecyltrimethylammonium bromide (HTAB), polyoxyl 10 lauryl ether, bile salts (such as sodium deoxycholate or sodium cholate), polyoxyl castor oil, nonylphenol ethoxylate, cyclodextrins, lecithin, dimethicone copolyol, lauramide DEA, cocamide DEA, cocamide MEA, oleyl betaine, cocamidopropyl betaine, cocamidopropyl phosphatidyl PG-dimonium chloride, dicetyl phosphate (dihexadecyl phosphate), ceteareth- 10 phosphate, methylbenzethonium chloride, sodium methyl cocoyl taurate, decyl glucoside, sodium cocoyl glutamate, dicetyl phosphate, ceteth-10 phosphate (ceteth-10 is the polyethylene glycol ether of cetyl alcohol where n has an average value of 10; ceteth-10 phosphate is a mixture of phosphoric acid esters of ceteth-10), ceteth-20, Brij S10
(polyethylene glycol octadecyl ether, average Mn - 711), and Poloxamers (including, but not limited to, Poloxamer 188 (HO(C2H4O)a(CH(CH3)CH20)b(C2H4O)aH, average
molecular weight 8400) and Poloxamer 407 (HO(C2H4O)a(CH(CH3)CH20)b(C2H40)aH, wherein a is about 101 and b is about 56)). Appropriate combinations or mixtures of such surfactants may also be used according to the present invention.Many of these surfactants may also serve as emulsifiers in formulations of the present invention.
Other suitable emulsifiers for use in the formulations of the present invention include, but are not limited to, behentrimonium methosulfate-cetearyl alcohol, non-ionic emulsifiers like emulsifying wax, polyoxyethylene oleyl ether, PEG-40 stearate, cetostearyl alcohol (cetearyl alcohol), ceteareth-12, ceteareth-20, ceteareth-30, ceteareth alcohol, Ceteth-20 (Ceteth-20 is the polyethylene glycol ether of cetyl alcohol where n has an average value of 20), oleic acid, oleyl alcohol, glyceryl stearate, PEG-75 stearate, PEG-100 stearate, and PEG- 100 stearate, ceramide 2, ceramide 3, stearic acid, cholesterol, steareth-2, and steareth-20, or combinations/mixtures thereof, as well as cationic emulsifiers like stearamidopropyl dimethylamine and behentrimonium methosulfate, or
combinations/mixtures thereof.
Moisturizers, Emollients, and Humectants
One of the most important aspects of topical products in general, and cosmetic products in particular, is the consumer's perception of the aesthetic qualities of a product.
For example, while white petrolatum is an excellent moisturizer and skin protectant, it is rarely used alone, especially on the face, because it is greasy, sticky, does not rub easily into the skin and may soil clothing. Consumers highly value products which are
aesthetically elegant and have an acceptable tactile feel and performance on their skin.
Suitable moisturizers for use in the formulations of the present invention include, but are not limited to, lactic acid and other hydroxy acids and their salts, glycerol, propylene glycol, butylene glycol, sodium PCA, sodium hyaluronate, Carbowax 200, Carbowax 400, and Carbowax 800. Suitable emollients or humectants for use in the formulations of the present invention include, but are not limited to, panthenol, acemannan, derivatives of Aloe vera , N-palmitoylethanolamine, N-acetylethanolamine, cetyl palmitate, glycerol (glycerin), PPG- 15 stearyl ether, lanolin alcohol, lanolin, lanolin derivatives, cholesterol, petrolatum, isostearyl neopentanoate, octyl stearate, mineral oil, isocetyl stearate, myristyl myristate, octyl dodecanol, 2-ethylhexyl palmitate (octyl palmitate), dimethicone, phenyl trimethicone, cyclomethicone, C12-C15 alkyl benzoates, dimethiconol, propylene glycol, Theobroma grandiflorum seed butter, ceramides (e.g., ceramide 2 or ceramide 3), hydroxypropyl bispalmitamide MEA, hydroxypropyl bislauramide MEA, hydroxypropyl bisisostearamide
MEA, l,3-bis(N-2-(hydroxyethyl)stearoylamino)-2-hydroxy propane, bis-hydroxy ethyl tocopherylsuccinoylamido hydroxypropane, urea, aloe, allantoin, glycyrrhetinic acid, safflower oil, oleyl alcohol, oleic acid, stearic acid, dicaprylate/dicaprate, diethyl sebacate, isostearyl alcohol, pentylene glycol, isononyl isononanoate, and l,3-bis(N-2- (hydroxyethyl)palmitoylamino)-2-hydroxypropane. In addition, appropriate combinations and mixtures of any of these moisturizing agents and emollients may be used in accordance with the present invention.
Preservatives and Antioxidants
The composition may further include components adapted to improve the stability or effectiveness of the applied formulation.
Suitable preservatives for use in the present invention include, but are not limited to: ureas, such as imidazolidinyl urea and diazolidinyl urea; phenoxy ethanol; sodium methyl paraben, methylparaben, ethylparaben, and propylparaben; potassium sorbate; sodium benzoate; sorbic acid; benzoic acid; formaldehyde; citric acid; sodium citrate; chlorine dioxide; bakuchiol, N-acetyl-L-cysteine, honokiol, magnolol, derivatives of Magnolia officinalis bark, chrysin, quaternary ammonium compounds, such as benzalkonium chloride, benzethonium chloride, cetrimide, dequalinium chloride, and cetylpyridinium chloride; mercurial agents, such as phenylmercuric nitrate, phenylmercuric acetate, and thimerosal; piroctone olamine; Vitis vinifera seed oil; and alcoholic agents, for example, chlorobutanol, dichlorobenzyl alcohol, phenyl ethyl alcohol, and benzyl alcohol.
Suitable antioxidants include, but are not limited to, ascorbic acid and its esters, sodium bisulfite, butylated hydroxytoluene, butylated hydroxyanisole, tocopherols, D- ribose, N-acetyl-L-cysteine, apocynin, bixin, derivatives of Bixa orellana seeds,
nicotinamide, acetyl zingerone, bakuchiol, tiliroside, extracts of Fragraria ananassa seed, fucoxanthin, creatine and its salts and esters, quercetin, luteolin, honokiol, magnolol, derivatives of Magnolia officinalis bark, tocopheryl acetate, sodium ascorbate/ascorbic acid, ascorbyl palmitate, propyl gallate, and chelating agents like EDTA (e.g., disodium EDTA), citric acid, and sodium citrate.
In some embodiments, the antioxidant or preservative comprises (3-(4- chlorophenoxy)-2-hydroxypropyl)carbamate.
In some embodiments, antioxidants or preservatives of the present invention may also function as a moisturizer or emollient, for example.
In addition, combinations or mixtures of these preservatives or anti-oxidants may
also be used in the formulations of the present invention.
Combination agents
The composition can also contain any other agent that has a desired effect when applied topically to a subject. Suitable classes of active agents include, but are not limited to antibiotic agents (i.e., antibiotic agents that dot not target agent X producing organisms), antimicrobial agents, anti-acne agents, antibacterial agents, antifungal agents, antiviral agents, steroidal anti-inflammatory agents, non-steroidal anti-inflammatory agents, anesthetic agents, antipruriginous agents, antiprotozoal agents, anti-oxidants, antihistamines, vitamins, and hormones. Mixtures of any of these active agents may also be employed. Additionally, dermatologically-acceptable salts and esters of any of these agents may be employed.
Viscosity Modifiers
Suitable viscosity adjusting agents (i.e., thickening and thinning agents or viscosity modifying agents) for use in the formulations of the present invention include, but are not limited to, protective colloids or non-ionic gums such as hydroxyethylcellulose, xanthan gum, and sclerotium gum, as well as magnesium aluminum silicate, silica, microcrystalline wax, beeswax, paraffin, and cetyl palmitate. In addition, appropriate combinations or mixtures of these viscosity adjusters may be utilized according to the present invention.
Additional constituents
Additional constituents suitable for incorporation into the emulsions of the present invention include, but are not limited to: skin protectants, adsorbents, demulcents, emollients, moisturizers, sustained release materials, solubilizing agents, skin-penetration agents, skin soothing agents, deodorant agents, antiperspirants, sun screening agents, sunless tanning agents, vitamins, hair conditioning agents, anti-irritants, anti-aging agents, abrasives, absorbents, anti-caking agents, anti-static agents, astringents (e.g., witch hazel, alcohol, and herbal extracts such as chamomile extract), binders/excipients, buffering agents, chelating agents, film forming agents, conditioning agents, opacifying agents, lipids, immunomodulators, and pH adjusters (e.g., citric acid, sodium hydroxide, and sodium phosphate). For example, lipids normally found in healthy skin (or their functional equivalents) may be incorporated into the emulsions of the present invention. In certain embodiments, the lipid is selected from the group consisting of ceramides, cholesterol, and free fatty acids. Examples of lipids include, but are not limited to, ceramide 1, ceramide 2,
ceramide 3, ceramide 4, ceramide 5, ceramide 6, hydroxypropyl bispalmitamide MEA, and hydroxypropyl bislauramide MEA, and combinations thereof.
Examples of peptides that interact with protein structures of the dermal-epidermal junction include palmitoyl dipeptide-5 diaminobutyloyl hydroxythreonine and palmitoyl dipeptide-6 diaminohydroxybutyrate.
Examples of skin soothing agents include, but are not limited to algae extract, mugwort extract, stearyl glycyrrhetinate, bisabolol, allantoin, aloe, avocado oil, green tea extract, hops extract, chamomile extract, colloidal oatmeal, calamine, cucumber extract, and combinations thereof.
In certain embodiments, the compositions comprise bergamot or bergamot oil.
Bergamot oil is a natural skin toner and detoxifier. In certain embodiments, it may prevent premature aging of skin and may have excellent effects on oily skin conditions and acne.
In some embodiments, the composition comprises a vitamin. Examples of vitamins include, but are not limited to, vitamins A, D, E, K, and combinations thereof. Vitamin analogues are also contemplated; for example, the vitamin D analogues calcipotriene or calcipotriol. In some embodiments, the vitamin may be present as tetrahexyldecyl ascorbate. This compound exhibits anti-oxidant activity, inhibiting lipid peroxidation. In certain embodiments, use can mitigate the damaging effects of UV exposure. Studies have shown it to stimulate collagen production as well as clarifying and brightening the skin by inhibiting melanogenesis (the production of pigment) thereby promoting a more even skin tone.
In some embodiments, the composition comprises a sunscreen. Examples of sunscreens include, but are not limited to, p-aminobenzoic acid, avobenzone, cinoxate, dioxybenzone, homosalate, menthyl anthranilate, octocrylene, octyl methoxycinnamate, octyl salicylate, oxybenzone, padimate O, phenylbenzimidazole sulfonic acid,
sulisobenzone, titanium dioxide, trolamine salicylate, zinc oxide, 4-methylbenzylidene camphor, methylene bis-benzotriazolyl tetramethylbutylphenol, bis-ethylhexyloxyphenol methoxyphenyl triazine, terephthalylidene dicamphor sulfonic acid, drometrizole
trisiloxane, disodium phenyl dibenzimidazole tetrasulfonate, diethylamino hydroxybenzoyl hexyl benzoate, octyl triazone, diethylhexyl butamido triazone, polysilicone-15, and combinations thereof.
Suitable fragrances and colors may be used in the formulations of the present invention. Examples of fragrances and colors suitable for use in topical products are known in the art.
Exemplification
The human skin is host to a diverse community of bacterial species. Hosting a relatively pro-inflammatory bacterial population is thought to contribute to inflammatory skin diseases, while a non-inflammatory population is believed to maintain healthy skin. Lantibiotics are a type of bacteriocin that can cause great changes in the microbial community due to their ability to kill neighboring cells. In this study, a novel lantibiotic in Propionibacterium is identified, the dominant resident bacteria in sebaceous sites. The lantibiotic, which was named Pilosebin L4, can inhibit the growth of a broad range of Gram-positive bacteria, including those found on the skin as well as important clinical pathogens such as MRSA and VRE. Using mock bacterial communities, it was
demonstrated that Propionibacterium strains that expressed Pilosebin L4 were able to out- compete those that do not express the lantibiotic and become the dominant members of the community. Colonization of a Propionibacterium strain expressing Pilosebin L4 can thus highly influence the microbiome composition and the host’s susceptibility to skin diseases. Propionibacterium strains with pilosebin L4 can be further exploited as a probiotic to modulate the virulence property of the microbiome and to maintain skin health.
INTRODUCTION
The human skin is host to a multitude of commensal bacterial communities.
Propionibacterium species, primarily P. acnes, are the dominant genera at sebaceous sites (Fitz-Gibbon et al 2013, Grice et al 2009). Hosting a commensal bacterial flora is an important factor of skin health, and disruptions or shifts in skin microbial community are associated with a variety of inflammatory skin diseases, including acne vulgaris (acne)(Fitz- Gibbon 2013 and Barnard 2016). Acne is a chronic inflammatory disease of the
pilosebaceous unit, characterized by papules and pustules arising on the affected skin. The cause of acne is multifactorial, characterized by hyperkeratiniation, increased sebum production, and pro-inflammatory bacteria in the affected region (Tanghetti 2013).
As the major colonizer of the pilosebaceous unit, along with its presence in both acneic and healthy skin, the role of P. acnes in acne pathogenesis has historically been debated. Recent studies have found that different lineages and strains of P. acnes have different genomic, transcriptomic, and metabolomic potential, suggesting that certain strains are more pathogenic, or pro-inflammatory than others (Brzuszkiewicz et al 2011,
Fitz-Gibbon et al 2013, Johnson et al 2016, Kang et al 2015, McDowell et al 2012a,
Tomida et al 2013). This suggests that having the health-associated P. acnes strains or community on the skin can help maintain a healthy skin status and reduce the incidence of inflammatory skin disease.
Bacteriocins are ribosomally synthesized antimicrobial peptides produced by a wide-range of bacteria. Lantibiotics (lanthionine containing antibiotics) are a type of bacteriocin produced by Gram-positive bacteria. They are characterized by their small sizes (< 5 kDa), extensive post-translational modifications, and the presence of the amino acids lanthionine (Lan) and/or b-methyl-lanthionine (meLan) (Rea et al 2011b). The genes involved in lantibiotic biosynthesis are generally found on an operon, and encode for a precursor peptide and modification enzymes. Lantibiotic operons may also come with genes encoding for an exporter, protease, immunity proteins, and/or two-component regulatory system consisting of a histidine kinase receptor and a transcriptional response regulator (Chatterjee, 2005) (Dischinger et al 2014). Lantibiotic biosynthesis involves the translation of the prepeptide, followed by dehydration of serine and threonine residues to didehydroalanines (Dha) and didehydrobutyrines (Dhb), respectively. Subsequent intramolecular Michael addition of cysteine -SH groups to Dha/Dhb form the characteristic thioether crosslinks of Lan and MeLan (Goto et al 2010).
Lantibiotics are classified based on their biosynthetic genes: Class I are linear peptides with two modification enzymes LanB and LanC, a lantibiotic ABC transporter LanT, and a proteinase LanP that cleaves the leader peptides; Class II are generally more globular than Class I, and are modified by a single enzyme LanM, and processed and secreted by LanT; Class III are modified by LanKC (sometimes referred to as LabKC), while Class IV are modified by LanL (Alkhatib et al 2012, Dischinger et al 2014, Rea et al 2011b). Lantibiotics act by binding to lipid I or lipid II of the peptidoglycan cell wall to inhibit cell wall biosynthesis, or by forming pores in the cell membrane to kill the target bacteria (Brotz and Sahl 2000, Draper et al 2015). Only lantibiotics of Class I and Class II have shown antimicrobial activity (Goto et al 2010). Despite their lack of antimicrobial activity, many Class III lantibiotics have been well characterized (Krawczyk et al 2012, Krawczyk et al 2013, Voller et al 2012). To date, all Class III lantibiotics have been isolated from bacteria of the order Actinomycetales.
The production of bacteriocins such as lantibiotics by certain species/strains in a microbial community can have profound effects on community composition due to their
ability to inhibit neighboring cells (Hawlena et al 2012, Perez-Gutierrez et al 2013). The production of bacteriocins by certain members of the microbiota has also been suggested to affect health and disease (Belda-Ferre et al 2012). There is only one reported case of bacteriocin characterization in P. acnes , identified from an oral isolate over 30 years ago (Fujimura and Nakamura 1978).
Previously, a lineage of P. acnes strains belonging to clade IB-1 and ribotyping scheme RT8 (Fitz-Gibbon et al 2013) was identified. Despite infrequently observed when present on the skin of acne patients, RT8 strains were in high relative abundance to almost 100% (Fitz-Gibbon et al 2013) (Barnard, 2016). In this study, a genome comparison and functional assays is combined to determine if these strains possessed genetic elements that allowed them to outcompete other bacterial species and strains in their community. A minor subset of P. acnes strains was discovered, including RT8 of clade IB-1, and some Propionibacterium avidum strains produced a novel lantibiotic that was named Pilosebin L4. Pilosebin L4 can kill a broad-range of Gram-positive bacteria, thus allowing the producer strains to dramatically change the microbial community composition. The implications for the presence of Pilosebin L4 in select propionibacteria and therapeutic applications are discussed.
MATERIALS & METHODS
Bacterial strains and culture conditions
Bacterial strains, media, and culture conditions used in this study are summarized in Table 1. Culture medium A is a synthetic medium composed of (per litre): 12 g tryptone,
12 g yeast extract, 4 g glucose, 4 g KH2P04, and 1 g MgS04-7H20. Propionibacterium granulosum, Propionibacterium humerusii, Staphylococcus epidermidis, P. avidum, and all P. acnes strains except for KPA171202 were previously isolated from human skin samples (Fitz-Gibbon et al 2013). Bacillus subtilis JH642 was kindly provided by Dr. Beth Lazazzera at UCLA. All other strains were purchased from sources listed in Table 1.
Bacteriocin genome mining
The online tool BAGEL3 (van Heel et al 2013) was used to scan for bacteriocins in all publicly available genomes of P. acnes. FASTA files containing nucleotide sequences of all genomic scaffolds were used for analysis.
KEGG Orthology (KO) identities
The KEGG Automatic Annotation Server (KAAS) was used to determine the KO assignments of genes. The bi-directional best hit method was used on amino acid sequences, with the default prokaryotic genes data set.
Phylogenetic reconstruction
For the multi-gene phylogenetic reconstruction, amino acid sequences of the following 31 genes were selected and used, based on the Genomic Encyclopedia of Bacteria and Archaea (Wu et al 2009): dnaG, frr, infC, lepA, nusA, pgk, pnpA, rplA, rplB, rplC, rplD, rplE, rplF, rplK, rplL, rplM, rplP, rplS, rplT, rpmA, rpoA, rpoB, rpoD, rpsB, rpsC, rpsE, rpsl, rpsJ, rpsS, smpB, and tsf; all sequences were obtained from IMG (Markowitz et al 2012), except for/1 avidum HL083PV1 and P. avidum HL307PV1, which were recently sequenced by the Applicant. Amino acid sequences were aligned using MUSCLE (Edgar 2004), and the individually aligned protein sequences were concatenated. A Bayesian phylogenetic tree was constructed in MrBayes v.3.2 (Ronquist et al 2012) using the amino acid model mixed+I+G to identify substitution models that best fit the data. The analysis was run with 25% burn-in for 200,000 generations. The average standard deviation of split frequencies was used as a convergence diagnostic. The Maximum Likelihood tree was constructed using PHYML (Guindon and Gascuel 2003) with 1,000 bootstrap replicates and the WAG+I+G (Whelan and Goldman 2001) amino acid substitution model.
Inhibition overlay assay
Antimicrobial activity of the lantibiotic was detected using a soft agar overlay assay. Strains producing Pilosebin L4 were sub-cultured to OD595 of 1.0, spotted onto A-media plates, and incubated anaerobically at 37°C for 48 h. Plates were then overlaid with soft agar media (0.7% agar + appropriate media as indicated in Table 1) containing target strains at OD595 of 1.0, and incubated anaerobically at 37°C for 48 h for Propionibacterium species, or aerobically at 37°C overnight for all other species. After incubation, overlays were examined for growth inhibition zones. Where observed, inhibition zones were measured from the inside edge (edge of the spotted producer strain) to the outer edge of the inhibition zone.
RNA extraction and quantitative PCR analysis
Fresh plate cultures of P. acnes HL030PA2 were harvested and sub-cultured in fresh BHI media to an OD595 of 1.0, and serially diluted in 1/5 dilutions up to 1/625. The dilutions were spread evenly on A-media plates, and incubated anaerobically at 37°C for 48
h. Each plate, therefore, contained P. acnes HL030PA2 grown at various cell densities. Total RNA was extracted from each of the plates using RNAprotect Bacteria Reagent + RNeasy Mini Kit (Qiagen), following the protocol for“Disruption of Bacteria Grown on Solid Media” followed by the standard protocol for RNA purification. Potential DNA contaminants were removed using TURBO DNA-free DNase Treatment kit (Ambion).
Total RNA was then converted to cDNA using Superscript® III First-Strand Synthesis Kit (Invitrogen). qPCR was performed on the LightCycler® 480 System (Roche), with the LightCycler® 480 High Resolution Melting Dye (Roche) following the manufacturer’s protocol. The following primer sets were used for the analysis on density-dependent regulation of pilosebin L4: for the gene encoding LanKC modification enzyme, LanKC-qF (5’-GGTTCCATCCTCTGATTGGTAGG-3’) and LanKC-qR (5’- CCCTCGTGACATTCCTCAAGC-3’); for the histidine kinase, HisK-qF (5’- CCAGTTGCGTTCCATCATCCA-3’) and HisK-qR (5’-
GGAAGTCGATGTGGAGTCGG-3’); for the PaPak gene, a single copy house-keeping gene used as a normalizer, Pak-qF (5’-GCAACCCGACATCCTCATTA-3’) and Pak-qR (5’ - AGTCGAAGAAGTCGCTC AGG-3’ ) . The qPCR conditions used are: 1 cycle of 95°C for 10 min, 50 cycles of 95°C for 10 min, 57°C for 30 sec, and 72°C for 30 sec, and 1 cycle each of 95°C, 40°C, 55°C, and 99°C for melting curve analyses. Three biological replicates were analyzed, with 3 technical replicates each.
Mock microbial community analysis
Fresh plate cultures of P. acnes HL030PA2, HL056PA1, HL086PA1, HL110PA3, and P. avidum HL083PV1 were harvested and sub-cultured in fresh BHI media to an OD595 of 1.0. The cultures were mixed in various ratios and spread evenly onto A-media plates. The plates were incubated anaerobically at 37 °C for 48 h. The mock communities were harvested, and genomic DNA was extracted using the Wizard® Genomic DNA Purification Kit (Promega) following the manufacturer’s protocol for Gram Positive Bacteria. The community DNA was diluted to 20 ng/mL, and absolute quantity of each strain was analyzed using qPCR on the LightCycler® 480 System (Roche), with the LightCycler® 480 High Resolution Melting Dye (Roche) following the manufacturer’s protocol. The following primer sets were used: for identification of HL056PA1, Ll-qF (5’- GAAGAATCCCGCTCCATTTCC-3’) and Ll-qR (5’-CCTTTCTTGTAGCCGAGC AG S’); for identification of HL030PA2, HL086PA1, and I\ avidum , HisK-qF (5’- CCAGTTGCGTTCCATCATCCA-3’) and HisK-qR (5’-
GGAAGTCGATGTGGAGTCGG-3’); for identification of HL 11 OP A3, cas3-qF (5’- GGC AAGAC AAACGAGGTAGGAG-3’ ) and cas3-qR (5’-
GATGGATTGTGGTTGGAGTCTCC-3’); for the Pak gene, a single copy house keeping gene found in all P. aeries, Pak-qF (5’-GCAACCCGACATCCTCATTA-3’) and Pak-qR (5’- AGTCGAAGAAGTCGCTCAGG-3’). The qPCR conditions used are: 1 cycle of 95°C for 10 min, 50 cycles of 95°C for 10 min, 57°C for 30 sec, and 72°C for 30 sec, and 1 cycle each of 95°C, 40°C, 55°C, and 99°C for melting curve analyses. Three biological replicates were analyzed, with three technical replicates each.
RESULTS
A subset ofP. acnes strains encode a type III lantibiotic
Non-core regions of all sequenced P. acnes strains were identified, which lead to the identified a genomic locus in RT8 strains of clade IB-1 and RT5 strains of clade IC
(Tomida, 2013), which was named Locus 4. Using BAGEL3 (van Heel et al 2013), a class III lantibiotic gene cluster at the beginning of the Locus 4 in above mentioned clades IB-1 and IC strains were identified. The lantibiotic gene cluster contains 4 genes: the prepeptide, the modification gene LanKC, and a two-component system consisting of a histidine kinase and a response regulator (Figure 1). A membrane transporter directly follows the lantibiotic gene cluster in locus 4, with homology to known drug efflux systems. Furthermore, an ABC transporter containing a domain subfamily involved in lantibiotic immunity is also encoded at the end of locus 4 (genes 1348 and 1349, Figure 1).
Locus 4 with and without the lantibiotic operon is found in other Actinomycetales species To determine if locus 4 containing the lantibiotic gene cluster is encoded in other bacteria, a BLAST search of the locus 4 DNA sequence was performed on all deposited bacterial sequences (including partial and draft sequences) on IMG (Markowitz et al 2012). The full locus 4 with the lantibiotic operon was detected in some P. avidum strains, including HGH0353 and HL083PV1 (Figure 2A). Additionally, a partial locus 4 that lacks the lantibiotic operon was detected in other Actinomycetales species, specifically in the families of Streptomycetaceae and Propionibacteriaceae (Figure 2A, Figure 9). The full locus 4 regions in all the examined Propionibacterium strains are 99.8% identical, and are found in the same genomic location, indicating that this genetic island was likely acquired by an ancestor of P. acnes and P. avidum (Figure 2B, Figure 10). Only a small subset of Propionibacterium strains seems to have maintained this genetic locus, while the majority
of strains have eliminated it from their genomes. In addition to clades IB-1 and IC, some strains from clade IB-2 (RT3) also harbor locus 4 (Figure 2B). A BLAST search of the lantibiotic operon alone did not yield any results beyond the Propionibacterium species mentioned above. Since Propionibacterium species are the dominant residents in the pilosebaceous unit, and the lantibiotic genes are found in locus 4, this novel lantibiotic was named Pilosebin L4.
Propionibacterium species harboring the lantibiotic can inhibit a broad-range of Gram positive species
To determine if the lantibiotic has antimicrobial activity, an inhibition overlay assay was performed using 10 P. acnes strains (1 RT1 strain of clade IA-2, 6 RT8 strains of clade IB-1, 2 RT3 strains of clade IB-2, and 1 RT5 strain of clade IC) and 1 P. avidum strain that produce Pilosebin L4. The P. acnes strain HL037PA1 (RT3 from clade IB-2) was used as a negative control due to its phylogenetic closeness to the IB-1 and IB-2 strains that produce Pilosebin L4 (Figure 2B). The ability of Pilosebin L4 to carry out strains to inhibit bacteria normally found on the skin and in the pilosebaceous unit. Pilosebin L4-negative P. acnes strains of all major lineages, a Pilosebin L4-negative P. avidum strain, P. granulosum , P. humerusii, S. epidermidis , and S. aureus were used as the target species and strains. All of the above bacteria were found in skin follicles (Fitz-Gibbon et al 2013). Pilosebin L4 producers were all able to inhibit the growth of the target species from the skin (Figure 3). The RT3 strains from the IB-2 clade showed a slightly better inhibitory ability than RT8 strains from the IB-1 clade and P. avidum. Among the propionibacteria target strains, type I P. acnes strains were inhibited the most, while types II and III, and other
Propionibacterium species (P. granulosum, P. humerusii, P. avidum) were inhibited less than P. acnes type I. The negative control strain P. acnes HL037PA1 was unable to inhibit any of the target strains. Pilosebin L4 producers were also unable to inhibit other Pilosebin L4 producers, indicating the presence of a functional lantibiotic immunity mechanism within locus 4 (Figure 3).
The lantibiotic protects against a broad-range of Gram-positive species, including those of clinical importance, such as methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant enterococci (VRE, Enterococcus faecalis), group A streptococcus (GAS, Streptococcus pyogenes), and Clostridium difficile. Pilosebin L4 producers were able to inhibit the growth of all the species tested (Figures 3-5). ISon-Propionibacterium species generally showed the greatest sensitivity to Pilosebin L4. Since lantibiotics are
known to only be effective against Gram-positive species, two Gram-negative species, Escherichia coli and Moraxella catarrhalis , were tested and confirmed the functionality for Pilosebin L4. As expected, growth of the two Gram-negative species was not affected by Pilosebin L4.
Pilosebin L4 is regulated by cell density
The presence of the two-component regulatory system in the lantibiotic operon (Figure 1) led us to hypothesize that Pilosebin L4 is auto-regulated and affected by cell- density as in other lantibiotic systems (Hoover et al 2015, Lee et al 2011). Gene regulation by performing quantitative real-time PCR (qPCR) on the transcripts of the LanKC modification enzyme (locus tag HMPREF9602 01329) and the histidine kinase regulatory gene (locus tag HMPREF9602 01326) in P. acnes HL030PA2, at various cell densities.
The LanKC modification gene expression was proportionate to cell density, where high cell density up-regulated transcription, and low cell density down-regulated transcription (Figure 6).
Pilosebin L4 producers can dominate a bacterial community by out-competing other strains While the inhibition assays (Figure 3) showed that the bacterial strains harboring Pilosebin L4 are able to inhibit Gram-positive species, the assay was performed in such way that the lantibiotic producers grow and release the lantibiotics prior to the placement of the target strains. Thus, mock bacterial communities were tested where both Pilosebin L4 producers and target strains were grown simultaneously, with no initial growth advantage of the producers. To assemble the mock communities, various combinations of two or three of the following strains in different ratios were grown: three Pilosebin L4 producing strains: P. acnes HL030PA2, P. acnes HL086PA1, and P. avidum HL083PV1, and two Pilosebin L4-negative strains: P. acnes HL056PA1 and P. acnes HL110PA3 (Figure 7). The mock communities were monitored and the individual strain compositions of the mock
communities were measured after 48 hours of growth using qPCR with strain-specific primers. In vitro mock communities showed that Pilosebin L4 producing P. acnes and P. avidum strains were able to significantly out-compete Pilosebin L4-negative strains, even if they were initially grown at lower proportions (Figure 7). When either two Pilosebin L4 producing strains were grown together, or when two Pilosebin L4-negative strains were grown together, the composition of the mock communities remained similarly to the initial proportions. The output ratios between the strains showed no significant differences in five
of the six sets, and only one set with marginal significant difference. This indicates that Pilosebin L4 provides a strong growth advantage in a mixed community to the producer strains over other Gram-positive strains that do not have Pilosebin L4 immunity. To further investigate at the molecular and transcriptional levels how Pilosebin L4 provides such growth advantage, a transcriptomic analysis comparing the gene expression of Pilosebin L4 positive P. acnes strains was performed in pure culture versus co-culture with other strains. As shown in Figure 8, multiple genes encoded in locus 4 were significantly upregulated in co-cultures, suggesting that the presence of other strains or species signals the production of Pilosebin L4.
Table 1. Bacterial strains used in this study.
Fitz-Gibbon S, Tomida S, Chiu BH, Nguyen L, Du C, Liu M et al (2013).
Propionibacterium acnes strain populations in the human skin microbiome associated with
acne. J Invest Dermatol 133: 2152-2160.
Incorporation by Reference
All publications, patents, and patent applications mentioned herein are hereby incorporated by reference in their entirety as if each individual publication, patent or patent application was specifically and individually indicated to be incorporated by reference. In case of conflict, the present application, including any definitions herein, will control.
Equivalents
Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments are described herein. Such equivalents are intended to be encompassed by the following claims.
Claims
1. A method of treating or preventing a disease in a subject in need thereof, comprising administering a composition comprising a Propionibacterium bacterium that comprises Locus 4 to the subject.
2. The method of claim 1, wherein the Propionibacterium bacterium is P. acnes.
3. The method of claim 2, wherein the Propionibacterium acnes bacterium is a P. acnes strain selected from HL037PA1, HL078PA1, HL053PA2, HL082PA1, HL086PA1, HL092PA1, HL110PA1, HL110PA2, HL030PA2, HL030PA1, HL063PA2, PV-66, Type IA2 P.acnl7, HL097PA1, PRP-38, 5 U 42AFAA, and HL082PA2
4. The method of claim 2, wherein the P. acnes is RT8, RT1, RT3, or RT5 P. acnes.
5. The method of claim 2, wherein the P. acnes belongs to the IB-1, IB-2, or IC clade.
6. The method of claim 1, wherein the Propionibacterium bacterium is P. avidum.
7. The method of claim 6, wherein the Propionibacterium avidum is P. avidum strain HL083PV1 or HGH0353.
8. The method of any one of the preceding claims, wherein the a Propionibacterium bacterium encodes for an amino acid sequence with at least 80% homology to any one of the amino acid sequences set forth in SEQ ID NO: 1-5 or 7-14.
9. The method of any one of claims 1 to 8, wherein the disease is a caused by Gram- positive bacteria.
10. The method of claim 9, wherein the Gram positive bacteria is Staphylococcus.
11. The method of claim 10, wherein the Staphylococcus bacteria is Methicillin-resistant Staphylococcus aureus (MRSA).
12. The method of claim 9, wherein the Gram positive bacteria is Enterococcus.
13. The method of claim 12, wherein the Enterococcus bacteria is Vancomycin-resistant Enterococcus (VRE).
14. The method of claim 9, wherein the Gram positive bacteria is Streptococcus.
15. The method of claim 14, wherein the Streptococcus bacteria is Group A Streptococcus
(GAS).
16. The method of claim 9, wherein the Gram positive bacteria is C. difficile, P. acnes, P. avidum, P. granulosum, or P. humerusii.
17. The method of any one of claims 1 to 16, wherein the disease is a skin disease associated with inflammation.
18. The method of claim 17, wherein the skin disease associated with inflammation is atopic dermatitis, psoriasis, or acne.
19. The method of any one of claims 1 to 18, wherein the Propionibacterium bacterium produces agent X.
20. The method of any one of claims 1 to 18, wherein the composition comprising a
Propionibacterium bacterium that comprises Locus 4 is heat treated, tyndallized or supernatant-derived.
21. A method of treating or preventing a disease in a subject in need thereof, comprising administering a composition comprising agent X to the subject.
22. The method of claim 21, wherein agent X is encoded by Locus 4.
23. The method of claim 21, wherein agent X comprises an amino acid sequence with at least 90% homology to an amino acid set forth in SEQ ID NOs: 1-5 or 7-14.
24. A method of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof, comprising administering a composition comprising a
Propionibacterium bacterium that comprises Locus 4 to the subject.
25. A method of reducing the levels of a Gram-positive bacteria on the skin of a subject in need thereof, comprising administering a composition comprising a Propionibacterium bacterium that comprises Locus 4 to the subject.
26. The method of claim 24 or 25, wherein the Propionibacterium bacterium is P. acnes.
27. The method of claim 26, wherein the Propionibacterium acnes bacterium is a P. acnes strain selected from HL037PA1, HL078PA1, HL053PA2, HL082PA1, HL086PA1, HL092PA1, HL110PA1, HL110PA2, HL030PA2, HL030PA1, HL063PA2, PV-66, Type IA2 P.acnl7, HL097PA1, PRP-38, 5 U 42AFAA, and HL082PA2.
28. The method of claim 26, wherein the P. acnes is RT8, RT1, RT3, or RT5 P. acnes.
29. The method of claim 26, wherein the P. acnes belongs to the IB-1, IB-2, or IC clade.
30. The method of claim 24 or 25, wherein the Propionibacterium bacterium is P.
avidum.
31. The method of claim 30, wherein the Propionibacterium avidum is P. avidum strain HL083PV1 or HGH0353.
32. The method of any one of claims 24 to 31, wherein the a Propionibacterium bacterium encodes for an amino acid sequence with at least 80% homology to any one of the amino acid sequences set forth in SEQ ID NO: 1-5 or 7-14.
33. The method of any one of claims 24 to 32, wherein the Gram positive bacteria is Staphylococcus.
34. The method of claim 32, wherein the Staphylococcus bacteria is Methicillin-resistant Staphylococcus aureus (MRSA).
35. The method of any one of claims 24 to 32, wherein the Gram positive bacteria is Enterococcus.
36. The method of claim 35, wherein the Enterococcus bacteria is Vancomycin-resistant Enterococcus (VRE).
37. The method of any one of claims 24 to 32, wherein the Gram positive bacteria is Streptococcus.
38. The method of claim 37, wherein the Streptococcus bacteria is Group A Streptococcus (GAS).
39. The method of any one of claims 24 to 32, wherein the Gram positive bacteria is Clostridium difficile.
40. The method of any one of claims 24 to 32, wherein the Gram positive bacteria is P. acnes, P. avidum, P. granulosum, or P. humerusii.
41. The method of any one of claims 24 to 40, wherein the subject has a skin disease associated with inflammation.
42. The method of claim 41, wherein the skin disease associated with inflammation is atopic dermatitis or psoriasis.
43. The method of claim 41, wherein the skin disease associated with inflammation is acne.
44. A method of treating or preventing an infection caused by Gram-positive bacteria in a subject in need thereof, comprising administering a composition comprising agent X to the subject.
45. A method of reducing the levels of a Gram-positive bacteria on the skin of a subject in need thereof, comprising administering a composition comprising agent X to the subject.
46. The method of claim 44 or 45, wherein agent X is encoded by Locus 4.
47. The method of claim 44 or 45, wherein agent X comprises an amino acid sequence with at least 90% homology to an amino acid set forth in SEQ ID NOs: 1-5 or 7-14.
48 The method of any one of the preceding claims, wherein the composition further comprises an antibiotic.
49 The method of any one of the preceding claims, wherein the method further comprises administering iron to the subject.
50. The method of any one of the preceding claims, wherein the composition is formulated for topical delivery.
51. The method of any one of the preceding claims, wherein the composition is formulated for oral delivery.
52. The method of any one of the preceding claims, wherein the subject is a human.
53. A pharmaceutical composition comprising agent X.
54. A pharmaceutical composition comprising a Propionibacterium bacterium that produces agent X.
55. The pharmaceutical composition of claim 53 or 54, wherein the composition is formulated for topical delivery .
56. The pharmaceutical composition of claim 53 or 54, wherein the composition is formulated for oral delivery.
57. The pharmaceutical composition of claim 53 or 54, wherein the composition further comprises an antibiotic.
58. A pharmaceutical composition comprising a Propionibacterium bacterium that comprises Locus 4.
59. The pharmaceutical composition of claim 58, wherein the composition is heat treated, tyndallized or supernatant-derived.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP20844831.6A EP4003381A4 (en) | 2019-07-22 | 2020-07-22 | Compositions and methods for treating skin infections and other diseases |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201962877045P | 2019-07-22 | 2019-07-22 | |
US62/877,045 | 2019-07-22 | ||
PCT/US2020/042542 WO2021011875A1 (en) | 2019-07-18 | 2020-07-17 | Compositions and methods for treating skin conditions |
USPCT/US2020/042542 | 2020-07-17 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2021016347A1 true WO2021016347A1 (en) | 2021-01-28 |
Family
ID=74194291
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2020/043061 WO2021016347A1 (en) | 2019-07-22 | 2020-07-22 | Compositions and methods for treating skin infections and other diseases |
Country Status (2)
Country | Link |
---|---|
EP (1) | EP4003381A4 (en) |
WO (1) | WO2021016347A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3999076A4 (en) * | 2019-07-18 | 2023-08-09 | The Regents of the University of California | Compositions and methods for treating skin conditions |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA2867621A1 (en) * | 2012-03-17 | 2013-09-26 | The Regents Of The University Of California | Fast diagnosis and personalized treatments for acne |
KR101927988B1 (en) * | 2018-08-23 | 2018-12-12 | 주식회사 지놈앤컴퍼니 | Novel strain of Cutibacterium granulosum, and composition for preventing or treating acne comprising the strain or its culture fluid |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2019079618A2 (en) * | 2017-10-20 | 2019-04-25 | Naked Biome, Inc. | Formulations for treatment of skin conditions |
-
2020
- 2020-07-22 EP EP20844831.6A patent/EP4003381A4/en active Pending
- 2020-07-22 WO PCT/US2020/043061 patent/WO2021016347A1/en unknown
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA2867621A1 (en) * | 2012-03-17 | 2013-09-26 | The Regents Of The University Of California | Fast diagnosis and personalized treatments for acne |
KR101927988B1 (en) * | 2018-08-23 | 2018-12-12 | 주식회사 지놈앤컴퍼니 | Novel strain of Cutibacterium granulosum, and composition for preventing or treating acne comprising the strain or its culture fluid |
Non-Patent Citations (7)
Title |
---|
HRISTENSEN GITTE J. M., SCHOLZ CHRISTIAN F. P., ENGHILD JAN, ROHDE HOLGER, KILIAN MOGENS, THÜRMER ANDREA, BRZUSZKIEWICZ ELZBIETA, : "Antagonism between Staphylococcus epidermidis and Propionibacterium acnes and its genomic basis", BMC GENOMICS, vol. 17, no. 152, 29 February 2016 (2016-02-29), pages 1 - 14, XP055785433 * |
LETZEL, A. C. ET AL.: "Genome mining for ribosomally synthesized and post-translationally modified peptides (RiPPs) in anaerobic bacteria", BMC GENOMICS, vol. 15, no. 1, 18 November 2014 (2014-11-18), pages 983, XP021204605, DOI: 10.1186/1471-2164-15-983 * |
LIU J., CHENG A., BANGAYAN N. J., BARNARD E., CURD E., CRAFT N., LI H.: "Draft genome sequences of Propionibacterium acnes type strain ATCC6919 and antibiotic-resistant strain HL411PA1", GENOME ANNOUNCEMENTS, vol. 2, no. 4, 14 August 2014 (2014-08-14), XP055785436 * |
PAETZOLD BERNHARD, WILLIS JESSE R., PEREIRA DE LIMA JOÃO, KNÖDLSEDER NASTASSIA, BRÜGGEMANN HOLGER, QUIST SVEN R., GABALDÓN TONI, G: "Skin microbiome modulation induced by probiotic solutions", MICROBIOME, vol. 7, no. 95, 24 June 2019 (2019-06-24), pages 1 - 9, XP055785440 * |
See also references of EP4003381A4 * |
SHU MUYA, WANG YANHAN, YU JINGHUA, KUO SHERWIN, CODA ALVIN, JIANG YONG, GALLO RICHARD L., HUANG CHUN-MING: "Fermentation of Propionibacterium acnes, a commensal bacterium in the human skin microbiome, as skin probiotics against methicillin-resistant Staphylococcus aureus", PLOS ONE, vol. 8, no. 2, 6 February 2013 (2013-02-06), pages e55380, XP055356917 * |
TOMIDA, S.: "Pan-genome and comparative genome analyses of propionibacterium acnes reveal its genomic diversity in the healthy and diseased human skin microbiome", MBIO, vol. 4, no. 3, 30 April 2013 (2013-04-30), XP055475229, DOI: 10.1128/mBio.00003-13 * |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3999076A4 (en) * | 2019-07-18 | 2023-08-09 | The Regents of the University of California | Compositions and methods for treating skin conditions |
Also Published As
Publication number | Publication date |
---|---|
EP4003381A1 (en) | 2022-06-01 |
EP4003381A4 (en) | 2024-02-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20210137997A1 (en) | Compositions and methods for promoting skin health | |
US20200121744A1 (en) | Compositions and methods for treating skin diseases and maintaining healthy skin | |
US20220184144A1 (en) | Compositions and methods for inhibiting seizures | |
US10077293B2 (en) | Antimicrobial peptide analogues derived from abalone (Haliotis discus) and antimicrobial pharmaceutical composition containing the same | |
CN114901246A (en) | Novel skin care compositions | |
KR101734064B1 (en) | Novel antimicrobial peptide derived from myxinidin peptide and uses thereof | |
JP7326498B2 (en) | A cosmetic composition comprising a Bifidobacterium species lysate, a yeast extract of the genus Saccharomyces and a simple sugar and its cosmetic use | |
JP2019514419A (en) | Compositions and methods for treating acne | |
JP5647137B2 (en) | Novel polyaminopolyketide antibiotics and uses thereof | |
CN114929193A (en) | Novel skin care compositions | |
US20190008930A1 (en) | Mycobacterium lysterase: a novel treatment for acne | |
US20210283215A1 (en) | Bacteriotherapy against proprionibacterium acnes for the treatment of acne | |
WO2021016347A1 (en) | Compositions and methods for treating skin infections and other diseases | |
US20230310515A1 (en) | Compositions and methods for treating skin infections and other diseases | |
US20210069259A1 (en) | Compositions and methods for treating skin infections and other diseases | |
US20220153789A1 (en) | Novel antimicrobial peptide derived from pseudin-2 peptide and uses thereof | |
WO2016018001A1 (en) | Skin whitening composition containing chemokine | |
US20220257646A1 (en) | Compositions and methods for treating skin conditions | |
JP2019019129A (en) | Collagen production accelerator | |
US20210017236A1 (en) | Antibacterial method | |
KR20180032955A (en) | A composition for skin brightening comprising TNFRSF14 inhibiting materials and a method for screening TNFRSF14 inhibiting materials | |
JP2015063510A (en) | Moisture retention-related gene expression promoter involved in improved moisture retention function of skin | |
EP3950697A1 (en) | Novel compound and use of same | |
WO2023102170A1 (en) | Compositions and methods for inhibiting seizures | |
KR20140057054A (en) | Micro rna, and screening method using the micro rna |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20844831 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2020844831 Country of ref document: EP Effective date: 20220222 |