WO2021003469A2 - Recombinant human sialidases, sialidase fusion proteins, and methods of using the same - Google Patents
Recombinant human sialidases, sialidase fusion proteins, and methods of using the same Download PDFInfo
- Publication number
- WO2021003469A2 WO2021003469A2 PCT/US2020/040828 US2020040828W WO2021003469A2 WO 2021003469 A2 WO2021003469 A2 WO 2021003469A2 US 2020040828 W US2020040828 W US 2020040828W WO 2021003469 A2 WO2021003469 A2 WO 2021003469A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- wild
- residue
- type human
- position corresponding
- sialidase
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/47—Hydrolases (3) acting on glycosyl compounds (3.2), e.g. cellulases, lactases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001154—Enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4244—Enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6815—Enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01018—Exo-alpha-sialidase (3.2.1.18), i.e. trans-sialidase
Definitions
- the invention relates generally to recombinant human sialidases and recombinant sialidase fusion proteins, and their use in the treatment of cancer.
- a growing body of evidence supports roles for glycans, and sialoglycans in particular, at various pathophysiological steps of tumor progression. Glycans regulate tumor
- sialylation of cell surface glycoconjugates is frequently altered in cancers, resulting in the expression of sialylated tumor-associated carbohydrate antigens.
- the expression of sialylated glycans by tumor cells is often associated with increased aggressiveness and metastatic potential of a tumor.
- Siglecs sialic acid-binding immunoglobulin-like lectins
- a family of sialic acid binding lectins play a role in cancer immune suppression by binding to hypersialylated cancer cells and mediating the suppression of signals from activating NK cell receptors, thereby inhibiting NK cell-mediated killing of tumor cells
- sialic acids can enhance NK cell- mediated killing of tumor cells (Jandus, supra ; Hudak, supra; Xiao et al. (2016) PROC. NATL. ACAD. SCI. USA 113(37): 10304-9.)
- Cancer immunotherapy with immune checkpoint inhibitors including antibodies blocking the PD-1/PD-L1 pathway, has improved the outcome of many cancer patients.
- many patients do not respond to currently available immune checkpoint inhibitors. Accordingly, there is still a need for effective interventions that overcome the immune suppressive tumor microenvironment and for treating cancers associated with hypersialylated cancer cells.
- the invention is based, in part, upon the discovery that it is possible to produce recombinant mutant forms of human sialidase enzymes and fusion proteins and/or antibody conjugates containing such enzymes that have suitable substrate specificities and activities to be useful in removing sialic acid and/or sialic acid containing molecules from the surface of cancer cells and/or removing sialic acid and/or sialic acid containing molecules from the tumor microenvironment, and/or reducing the concentration of sialic acid and/or sialic acid containing molecules in the tumor microenvironment.
- the invention provides a recombinant mutant human sialidase enzyme, wherein the sialidase comprises: (a) a substitution of a proline residue at a position corresponding to position 5 of wild-type human Neu2 (P5); (b) a substitution of a lysine residue at a position corresponding to position 9 of wild-type human Neu2 (K9); (c) a substitution of a lysine residue at a position corresponding to position 44 of wild-type human Neu2 (K44); (d) a substitution of a lysine residue at a position corresponding to position 45 of wild-type human Neu2 (K45); (e) a substitution of a leucine residue at a position corresponding to position 54 of wild-type human Neu2 (L54); (f) a substitution of a proline residue at a position corresponding to position 62 of wild-type human Neu2 (P62); (g) a substitution of a glutamine residue at a position
- the proline residue at a position corresponding to position 5 of wild-type human Neu2 is substituted by histidine (P5H);
- the lysine residue at a position corresponding to position 9 of wild-type human Neu2 is substituted by aspartic acid (K9D);
- the lysine residue at a position corresponding to position 44 of wild-type human Neu2 is substituted by arginine (K44R) or glutamic acid (K44E);
- the lysine residue at a position corresponding to position 45 of wild-type human Neu2 is substituted by alanine (K45A), arginine (K45R), or glutamic acid (K45E);
- the leucine residue at a position corresponding to position 54 of wild-type human Neu2 is substituted by methionine (L54M);
- the proline residue at a position corresponding to position 62 of wild-type human Neu2 is substituted by methionine (L54M);
- tyrosine (R241 Y) the alanine residue at a position corresponding to position 242 of wild-type human Neu2 is substituted by cysteine (A242C), phenylalanine (A242F), glycine (A242G), histidine (A242H), isoleucine (A242I), lysine (A242K), leucine (A242L), methionine (A242M), asparagine (A242N), glutamine (A242Q), arginine (A242R), serine (A242S), valine (A242V), tryptophan (A242W), or tyrosine (A242Y); (ee) the valine residue at a position corresponding to position 244 of wild-type human Neu2 is substituted by isoleucine (V244I), lysine (V244K), or proline (V244P); (ff) the glutaline residue at
- the sialidase may comprise a substitution selected from K9D, P62G, P62N, P62S, P62T, A93E, Q126Y, A242F, A242W, A242Y, Q270A, Q270T, S301A, S301R, W302K, W302R, V363R, or L365I, or a combination of any of the foregoing substitutions.
- the sialidase further comprises: (a) a substitution or deletion of a methionine residue at a position corresponding to position 1 of wild-type human Neu2 (Ml); (b) a substitution of a valine residue at a position corresponding to position 6 of wild- type human Neu2 (V6); (c) a substitution of an isoleucine residue at a position corresponding to position 187 of wild-type human Neu2 (1187); or (d) a substitution of a cysteine residue at a position corresponding to position 332 of wild-type human Neu2 (C332); or a combination of any of the foregoing substitutions.
- the sialidase comprises a combination of any of the foregoing substitutions.
- the sialidase comprises: (a) the MID, V6Y, P62G, A93E, I187K, and C332A substitutions; (b) the MID, V6Y, K9D, A93E, I187K, C332A, V363R, and L365I substitutions; (c) the MID, V6Y, P62N, I187K, and C332A substitutions; (d) the MID, V6Y, I187K, Q270A, S301R, W302K, and C332A substitutions; (e) the MID, V6Y, P62S, I187K, Q270A, S301R, W302K, and C332A substitutions; (f) the MID, V6Y, P62T, I187K, Q270A, S301R, W302K, and C332A substitutions; (g) the MID, V6Y, P62N, I187K, Q270A, S301R, W302K, and
- the sialidase has a different substrate specificity than the corresponding wild-type sialidase.
- the sialidase can cleave a2,3, a2,6, and/or a2,8 linkages.
- the sialidase can cleave a2,3 and a2,8 linkages.
- the sialidase comprises any one of SEQ ID NOs: 48-54, 149, 154, 159, or 191, or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOs: 48-54, 149, 154, 159, or 191.
- the invention provides a recombinant mutant human sialidase comprising a mutation or combination of mutations set forth in any one of Tables 5-9, 11-13, or 15-30.
- the sialidase further comprises a mutation or combination of mutations set forth in any one of Tables 1-4.
- the invention provides a fusion protein comprising (or consisting essentially of): (a) a recombinant mutant human sialidase disclosed herein; and (b) an immunoglobulin Fc domain and/or an immunoglobulin antigen-binding domain; wherein the sialidase and the Fc domain and/or the antigen-binding domain are linked by a peptide bond or an amino acid linker.
- the fusion protein further comprises a linker, for example, an amino acid linker, connecting the sialidase enzyme and the Fc domain and/or the antigen-binding domain.
- the immunoglobulin antigen binding domain is associated (for example, covalently or non-covalently associated) with a second immunoglobulin antigen-binding domain to produce an antigen-binding site.
- the immunoglobulin Fc domain is derived from a human IgGl, IgG2, IgG3, IgG4, IgAl, IgA2, IgD, IgE, or IgM Fc domain, e.g., the immunoglobulin Fc domain is derived from a human IgGl, IgG2, IgG3, or IgG4 Fc domain, e.g, the immunoglobulin Fc domain is derived from a human IgGl Fc domain.
- the immunoglobulin antigen-binding domain is derived from an antibody selected from trastuzumab, daratumumab, girentuximab, ofatumumab, avelumab, and rituximab.
- the invention provides an antibody conjugate comprising any of the foregoing fusion proteins.
- the antibody conjugate comprises a single sialidase.
- the antibody conjugate comprises two sialidases, which can be the same or different.
- the antibody conjugate comprises two identical sialidases.
- the antibody conjugate comprises a single antigen-binding site.
- the antibody conjugate comprises two antigen-binding sites, which can be the same or different.
- the antibody conjugate comprises two identical antigen-binding sites.
- the antibody conjugate has a molecular weight from about 135 kDa to about 165 kDa, or the antibody conjugate has a molecular weight from about 215 kDa to about 245 kDa.
- the antibody conjugate comprises: (a) a first polypeptide comprising an immunoglobulin light chain; (b) a second polypeptide comprising an immunoglobulin heavy chain; and (c) a third polypeptide comprising an immunoglobulin Fc domain and a sialidase; wherein the first and second polypeptides are covalently linked together and the second and third polypeptides are covalently linked together, and wherein the first polypeptide and the second polypeptide together define an antigen-binding site.
- the third polypeptide may, for example, comprise the sialidase and the immunoglobulin Fc domain in an N- to C-terminal orientation.
- the antibody conjugate comprises: (a) a first polypeptide comprising a first immunoglobulin light chain; (b) a second polypeptide comprising a first immunoglobulin heavy chain and a first sialidase; (c) a third polypeptide comprising a second immunoglobulin heavy chain and a second sialidase; and (d) a fourth polypeptide comprising a second immunoglobulin light chain; wherein the first and second polypeptides are covalently linked together, the third and fourth polypeptides are covalently linked together, and the second and third polypeptides are covalently linked together, and wherein the first polypeptide and the second polypeptide together define a first antigen-binding site, and the third polypeptide and the fourth polypeptide together define a second antigen-binding site.
- the second and third polypeptides may, for example, comprise the first and second immunoglobulin heavy chain and the first and second sialidase, respectively, in an N- to
- the antibody conjugate comprises: (a) a first polypeptide comprising a first sialidase, a first immunoglobulin Fc domain, and a first single chain variable fragment (scFv); and (b) a second polypeptide comprising a second sialidase, a second immunoglobulin Fc domain, and an optional second single chain variable fragment (scFv); wherein the first and second polypeptides are covalently linked together, and wherein the first scFv defines a first antigen-binding site, and the second scFv, when present, defines a second antigen-binding site.
- the first polypeptide may, for example comprise the first sialidase, the first immunoglobulin Fc domain, and the first scFv in an N- to C-terminal orientation.
- the second polypeptide may, for example, comprise the second sialidase, the second immunoglobulin Fc domain, and the optional second scFv in an N- to C-terminal orientation.
- the antibody conjugate comprises: (a) a first polypeptide comprising an immunoglobulin light chain; (b) a second polypeptide comprising an immunoglobulin heavy chain and a single chain variable fragment (scFv); and (c) a third polypeptide comprising an immunoglobulin Fc domain and a sialidase, wherein the first and second polypeptides are covalently linked together and the second and third polypeptides are covalently linked together, and wherein the immunoglobulin light chain and immunoglobulin heavy chain together define a first antigen-binding site and the scFv defines a second antigen-binding site.
- the second polypeptide may, for example comprise the
- the third polypeptide may, for example, comprise the sialidase and the immunoglobulin Fc domain in an N- to C-terminal orientation.
- the invention provides an isolated nucleic acid comprising a nucleotide sequence encoding any of the foregoing recombinant mutant human sialidases, any of the foregoing fusion proteins, or at least a portion of any of the foregoing antibody conjugates.
- the invention provides an expression vector comprising any of the foregoing nucleic acids.
- the invention provides a host cell comprising any of the foregoing expression vectors.
- the invention provides a pharmaceutical composition comprising any of the foregoing recombinant mutant human sialidases, any of the foregoing fusion proteins, or any of the foregoing antibody conjugates.
- the invention provides a method of treating cancer in a subject in need thereof.
- the method comprises administering to the subject an effective amount of any of the foregoing sialidases, any of the foregoing fusion proteins, any of the foregoing antibody conjugates, or any of the foregoing pharmaceutical compositions.
- the cancer is an epithelial cancer.
- the cancer is a solid tumor, soft tissue tumor, hematopoietic tumor or metastatic lesion.
- the solid tumor is a sarcoma, adenocarcinoma, or carcinoma.
- the solid tumor is a head and neck (e.g ., pharynx), thyroid, lung (e.g, small cell or non-small cell lung carcinoma (NSCLC)), breast, lymphoid, gastrointestinal (e.g, oral, esophageal, stomach, liver, pancreas, small intestine, colon and rectum, anal canal), genital or
- genitourinary tract e.g, renal, urothelial, bladder, ovarian, uterine, cervical, endometrial, prostate, testicular
- CNS e.g, neural or glial cell, e.g, neuroblastoma or glioma
- skin e.g, melanoma
- the hematopoietic tumor is a leukemia, acute leukemia, acute lymphoblastic leukemia (ALL), B-cell, T-cell or FAB ALL, acute myeloid leukemia (AML), chronic yelocytic leukemia (CML), chronic lymphocytic leukemia (CLL), e.g, transformed CLL, diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, hairy cell leukemia, myelodyplastic syndrome (MDS), lymphoma, Hodgkin’s disease, malignant lymphoma, non-Hodgkin’s lymphoma, Burkitt’s lymphoma, multiple myeloma, or Richter’s Syndrome (Richter’s Transformation).
- ALL acute lymphoblastic leukemia
- B-cell B-cell
- T-cell or FAB ALL acute myeloid leukemia
- AML acute myeloid leukemia
- CML chronic yelocytic leuk
- the cancer is selected from an endometrial cancer, ovarian cancer, cervical cancer, vulvar cancer, uterine cancer, fallopian tube cancer, breast cancer, prostate cancer, lung cancer, pancreatic cancer, urinary cancer, bladder cancer, head and neck cancer, oral cancer and liver cancer.
- the invention provides a method of increasing expression of HLA- DR, CD86, CD83, PTNGg, IL-lb, IL-6, TNFa, IL-17A, IL-2, or IL-6 in a cell or tissue.
- the method comprises contacting the cell or tissue with an effective amount of any of the foregoing sialidases, any of the foregoing fusion proteins, any of the foregoing antibody conjugates, or any of the foregoing pharmaceutical compositions.
- the cell is selected from a dendritic cell and a peripheral blood mononuclear cell (PBMC).
- PBMC peripheral blood mononuclear cell
- FIGURE 1 depicts an SDS-PAGE gel showing recombinant human Neul, Neu2, Neu3, and Salmonella typhimurium (St-sialidase) under non-reducing and reducing conditions. Monomer and dimer species are indicated.
- FIGURE 2 is a bar graph showing the enzymatic activity of recombinant human Neul, Neu2, and Neu3.
- FIGURE 3 is a line graph showing enzymatic activity as a function of substrate concentration for recombinant human Neu2 and Neu3 at the indicated pH.
- FIGURE 4 depicts a schematic representation of an exemplary sialic acid biotinylated probe that can be used in phage display or yeast display screening for Neu2 variants.
- FIGURE 5 depicts an exemplary protocol that facilitates phage display screening of Neu2 variants.
- FIGURE 6 depicts an exemplary protocol that facilitates yeast display screening of Neu2 variants.
- FIGURE 7A depicts an SDS-PAGE gel showing recombinant Neu2-Fc (wildtype) and Neu2-M106-Fc under non-reducing and reducing conditions.
- FIGURE 7B is an SEC- HPLC trace of Neu2-Fc (wildtype) and Neu2-M106-Fc. The monomer species has a retention time of 21 minutes.
- FIGURE 8 is a line graph depicting the enzymatic activity of Neu2 variant M106.
- FIGURES 9A-9I depict schematic representations of certain antibody conjugate constructs containing a sialidase enzyme, e.g ., a human sialidase enzyme, and an antigen binding site.
- a sialidase enzyme e.g ., a human sialidase enzyme
- an antigen binding site e.g., an antigen binding site.
- each sialidase may be the same or different.
- each antigen binding site may be the same or different.
- Fc domain it is understood that the Fc domain can be a wild type Fc domain or can be an engineered Fc domain.
- the Fc domain may be engineered to contain either a“knob” mutation, e.g, T366Y, or a“hole” mutation, e.g, Y407T, or both, to promote heterodimerization, or the Fc domain may be engineered to contain one or more modifications, e.g. , point mutations, to provide any other modified Fc domain functionality.
- a“knob” mutation e.g, T366Y
- a“hole” mutation e.g, Y407T, or both
- modifications e.g. , point mutations
- FIGURE 10 depicts schematic representations of certain antibody conjugate constructs containing a sialidase enzyme, e.g. , a human sialidase enzyme, and an antigen binding site.
- a sialidase enzyme e.g. , a human sialidase enzyme
- an antigen binding site may be the same or different.
- an Fc domain it is understood that the Fc domain can be a wild type Fc domain or can be an engineered Fc domain.
- the Fc domain may be engineered to contain either a“knob” mutation, e.g, T366Y, or a“hole” mutation, e.g, Y407T, or both, to promote heterodimerization, or the Fc domain may be engineered to contain one or more modifications, e.g. , point mutations, to provide any other modified Fc domain functionality.
- a“knob” mutation e.g, T366Y
- a“hole” mutation e.g, Y407T, or both
- modifications e.g. , point mutations
- FIGURES 11A-11D are schematic representations of exemplary fusion protein conjugates referred to as a Raptor antibody sialidase conjugate (FIGURE 11 A), a Janus antibody sialidase conjugate (FIGURE 11B), a Lobster antibody sialidase conjugate
- FIGURE 11C a Bunk antibody sialidase conjugate
- FIGURE 11D a Bunk antibody sialidase conjugate
- FIGURE 12 depicts an SDS-PAGE gel showing purified recombinant human Janus Trastuzumab under non-reducing and reducing conditions.
- FIGURE 13 depicts an SEC-HPLC trace of purified Janus Trastuzumab, showing approximately 90% monomer purity.
- FIGURE 14 depicts the enzyme activity of Janus Trastuzumab assayed using 4-MU- Neu5Ac as a substrate.
- FIGURE 15 depicts binding to HER2 antigen as determined by ForteBio Octet for Janus Trastuzumab (top), and trastuzumab (bottom). Equilibrium dissociation constants (KD) are indicated.
- FIGURES 16A-D depict the testing of various configurations of antibody sialidase conjugates in a mouse syngeneic tumor model utilizing EMT6 mouse breast cancer cells engineered to express human Her2. Mice are treated via intraperitoneal injection of 10 mg/kg of each test article on the days marked with black triangles and tumor volume (mm 3 ) recorded. Each line represents an individual mouse. Mice are treated with either
- trastuzumab (FIGURE 16A), Raptor (FIGURE 16B), Janus (FIGURE 16C) or Lobster (FIGURE 16D).
- FIGURES 17A-D depict the testing of the Janus antibody sialidase conjugate in a mouse syngeneic tumor model utilizing EMT6 mouse breast cancer cells engineered to express human Her2. Mice were treated via intraperitoneal injection of 10 mg/kg of Janus on the days marked with black triangles and tumor volume (mm 3 ) recorded.
- FIGURE 17A depicts the mean tumor volume with error bars of the indicated treatment groups from Example 5.
- FIGURES 18A-B depict the testing of the Janus antibody sialidase conjugate in a mouse syngeneic orthotopic tumor model utilizing a second source of EMT6 mouse breast cancer cells engineered to express human Her2.
- Mice are treated via intraperitoneal injection of 10 mg/kg of each test article on the days marked with black triangles and tumor volume (mm 3 ) recorded. Each line represents an individual mouse.
- Mice are treated (T) with either vehicle, trastuzumab, Janus or Janus Loss of Function (FIGURE 18A).
- FIGURE 18B depicts the rechallenge experiment of either the three mice treated with Janus from FIGURE 18A with complete regressions of the original EMT6-Her2 tumors (cured mice) or naive mice.
- Cured mice were inoculated with either EMT6-Her2 cells or parental EMT6 cells on the left and right lower flank region. Naive mice were inoculated with EMT6-Her2 cells.
- FIGURES 19A-B depict the testing of the Janus antibody sialidase conjugate in a mouse syngeneic orthotopic tumor model in combination with anti-mouse PD1.
- Mice are treated via intraperitoneal injection of 10 mg/kg of either anti-mouse PD1 alone (FIGURE 19A) or Janus and anti-mouse PD1 (10 mg/kg of each, FIGURE 19B) on the days marked with black triangles ( ⁇ ) and tumor volume (mm 3 ) recorded. Each line represents an individual mouse.
- FIGURE 20 depicts the testing of various test articles in a mouse syngeneic tumor model injected with a B16 melanoma cell line expressing human Her2. Mice are treated via intraperitoneal injection of 10 mg/kg of either Janus, trastuzumab or a combination of anti mouse PD1 and anti-mouse CTLA4 (10 mg/kg of each) on the days marked with black triangles ( ⁇ ) and tumor volume (mm 3 ) recorded. Each line represents an individual mouse.
- FIGURE 21 depicts the testing of Janus Trastuzumab in a mouse syngeneic tumor model utilizing EMT6 mouse breast cancer cells engineered to express human Her2. Each line represents an individual mouse. Tick marks indicate dosing frequency (total of 5 doses, biweekly). Mice are treated with either Janus Trastuzumab or isotype control.
- FIGURE 22A depicts an SDS-PAGE gel showing Neu2-M173-Fc under non reducing and reducing conditions.
- FIGURE 22B is an SEC-HPLC trace of Neu2-M173-Fc.
- the monomer species has a retention time of 6.367 minutes.
- the monomer species has a purity of approximately 90% after purification by Protein A and CHT chromatography.
- FIGURE 23 depicts the enzyme activity of Neu2-M173-Fc, using 4-MU-Neu5Ac as the substrate, and fixing enzyme concentration to 2 pg/well.
- FIGURE 24A depicts an SDS-PAGE gel showing Neu2-M106 under non-reducing (NR) and reducing (R) conditions.
- FIGURE 24B depicts a schematic representation of the Neu2 structure with the position of the R243 cleavage site indicated.
- FIGURE 25 depicts a reducing SDS-PAGE gel showing Neu2-M106 produced by a large or small scale expression with (+) or without (-) trypsin treatment.
- FIGURE 26 depicts an SDS-PAGE gel showing Neu2 -Ml 06 following incubation with trypsin and one of the protease inhibitors iron citrate (Fe Cit), aprotinin, AEBSF, leupeptin, or E-64 at the indicated concentrations.
- iron citrate Fe Cit
- AEBSF aprotinin
- leupeptin leupeptin
- FIGURE 27 is a table depicting different mutations and combinations of mutations surrounding the trypsin cleavage site in Neu2.
- FIGURE 28A depicts a reducing SDS-PAGE analysis of Neu2 variants with the indicated mutation at position A242 with or without trypsin treatment. Trypsin digestion was for 5 minutes at 4 °C using a 5,000% dilution of trypsin. The digestion was quenched by addition of SDS, and 2 pg of protein was loaded on the gel.
- FIGURE 28B depicts the enzymatic activity of Neu2 variants with the indicated mutation at position A242.
- FIGURE 28C is an SEC-HPLC trace of Neu2 variants with the indicated mutation at position A242.
- Neu2-M106 the mutational background in which the mutations at position A242 were tested is shown as a control.
- FIGURE 29 depicts a reducing SDS-PAGE analysis of the indicated Neu2 variants with or without trypsin treatment.
- Neu2-M106 is shown as a control.
- Neu2- M255 was shown to have a greater than 10 fold improved trypsin resistance relative to Neu2- M106.
- the invention relates to a recombinant human sialidase that comprises at least one mutation relative to a wild-type human sialidase, e.g. , a substitution, deletion, or addition (insertion) of at least one amino acid.
- the mutations, or combination of mutations can improve the expression, activity or both the expression and activity of the sialidase to improve its use in cancer diagnosis and/or treatment.
- the invention further relates to fusion proteins and/or antibody conjugates comprising a sialidase enzyme and an antibody or portion thereof, e.g., an immunoglobulin Fc domain and/or an antigen-binding domain.
- the sialidase enzyme portion of the fusion protein and/or antibody conjugate may comprise at least one mutation relative to a wild-type human sialidase.
- the invention further relates to pharmaceutical compositions and methods of using fusion proteins and/or antibody conjugates to treat cancer, e.g ., a solid tumor, soft tissue tumor, hematopoietic tumor, metastatic lesion, or an epithelial cell cancer.
- sialidase refers to any enzyme, or a functional fragment thereof, that cleaves a terminal sialic acid residue from a substrate, for example, a
- sialidase includes variants having one or more amino acid substitutions, deletions, or insertions relative to a wild-type sialidase sequence, and/or fusion proteins or conjugates including a sialidase.
- Sialidases are also called neuraminidases, and, unless indicated otherwise, the two terms are used interchangeably herein.
- the term“functional fragment” of a sialidase refers to fragment of a full-length sialidase that retains, for example, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the enzymatic activity of the corresponding full-length, naturally occurring sialidase.
- Sialidase enzymatic activity may be assayed by any method known in the art, including, for example, by measuring the release of sialic acid from the fluorogenic substrate 4-methylumbelliferyl- N-acetylneuraminic acid (4MU-NeuAc).
- the functional fragment comprises at least 100, 150, 200, 250, 300, 310, 320, 330, 340, 350, 360, or 370 consecutive amino acids present in a full-length, naturally occurring sialidase.
- Human Neul is a lysosomal neuraminidase enzyme which functions in a complex with beta-galactosidase and cathepsin A.
- the amino acid sequence of human Neul is depicted in SEQ ID NO: 7, and a nucleotide sequence encoding human Neul is depicted in SEQ ID NO: 23.
- Human Neu2 is a cytosolic sialidase enzyme. The amino acid sequence of human Neu2 is depicted in SEQ ID NO: 1, and a nucleotide sequence encoding human Neu2 is depicted in SEQ ID NO: 24. Unless stated otherwise, as used herein, wild-type human Neu2 refers to human Neu2 having the amino acid sequence of SEQ ID NO: 1.
- Human Neu3 is a plasma membrane sialidase with an activity specific for
- Human Neu3 has two isoforms: isoform 1 and isoform 2.
- the amino acid sequence of human Neu3, isoform 1 is depicted in SEQ ID NO: 8, and a nucleotide sequence encoding human Neu3, isoform 1 is depicted in SEQ ID NO: 25.
- the amino acid sequence of human Neu3, isoform 2 is depicted in SEQ ID NO: 9, and a nucleotide sequence encoding human Neu3, isoform 2 is depicted in SEQ ID NO: 34.
- Human Neu4 has two isoforms: isoform l is a peripheral membrane protein and isoform 2 localizes to the lysosome lumen.
- the amino acid sequence of human Neu4, isoform 1 is depicted in SEQ ID NO: 10, and a nucleotide sequence encoding human Neu4, isoform 1 is depicted in SEQ ID NO: 26.
- the amino acid sequence of human Neu4, isoform 2 is depicted in SEQ ID NO: 11, and a nucleotide sequence encoding human Neu4, isoform 2 is depicted in SEQ ID NO: 35.
- mice Neu2 The amino acid sequence of mouse Neul is depicted in SEQ ID NO: 38, and a nucleotide sequence encoding mouse Neul is depicted in SEQ ID NO: 42.
- the amino acid sequence of mouse Neu2 is depicted in SEQ ID NO: 39 and a nucleotide sequence encoding mouse Neu2 is depicted in SEQ ID NO: 43.
- the amino acid sequence of mouse Neu3 is depicted in SEQ ID NO: 40, and a nucleotide sequence encoding mouse Neu3 is depicted in SEQ ID NO: 44.
- the amino acid sequence of mouse Neu4 is depicted in SEQ ID NO: 41, and a nucleotide sequence encoding mouse Neu4 is depicted in SEQ ID NO: 45.
- Exemplary prokaryotic sialidases include sialidases from Salmonella typhimurium and Vibrio cholera.
- the amino acid sequence of Salmonella typhimurium sialidase (St- sialidase) is depicted in SEQ ID NO: 30, and a nucleotide sequence encoding Salmonella typhimurium sialidase is depicted in SEQ ID NO: 6.
- the amino acid sequence of Vibrio cholera sialidase is depicted in SEQ ID NO: 36, and a nucleotide sequence encoding Vibrio cholera sialidase is depicted in SEQ ID NO: 37.
- a recombinant mutant human sialidase has about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 100%, or more than 100% of the enzymatic activity of a corresponding (or template) wild-type human sialidase.
- the recombinant mutant human sialidase has the same substrate specificity as the corresponding wild-type human sialidase. In other embodiments, the recombinant mutant human sialidase has a different substrate specificity than the corresponding wild-type human sialidase.
- the recombinant mutant human sialidase can cleave a2,3, a2,6, and/or a2,8 linkages. In certain embodiments the sialidase can cleave a2,3 and a2,8 linkages.
- the expression yield of the recombinant mutant human sialidase in mammalian cells is greater than about 10%, about 20%, about 50%, about 75%, about 100%, about 150%, about 200%, about 250%, about 300%, about 400%, about 500%, about 600%, about 700%, about 800%, about 900%, or about 1,000% of the expression yield of the corresponding wild-type human sialidase.
- the recombinant mutant human sialidase has about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 100%, or more than 100% of the enzymatic activity of a corresponding wild-type human sialidase, and the expression yield of the recombinant mutant human sialidase in mammalian cells, e.g, HEK293 cells, is greater than about 10%, about 20%, about 50%, about 75%, about 100%, about 150%, about 200%, about 250%, about 300%, about 400%, about 500%, about 600%, about 700%, about 800%, about 900%, or about 1,000% of the expression yield of a corresponding wild-type human sialidase.
- the amino acid sequence of the recombinant mutant human sialidase has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of a corresponding wild-type human sialidase.
- the recombinant mutant human sialidase comprises a substitution of at least one cysteine (cys, C) residue. It has been discovered that certain cysteine residues in sialidases may inhibit expression of functional protein as a result of protein aggregation.
- the recombinant mutant human sialidase contains at least one mutation to remove a free cysteine (e.g, for Neul (SEQ ID NO: 7), a mutation of, for example, one or more of Cl l l, C117, 071, Cl 83, C218, C240, C242, and C252; for Neu2 (SEQ ID NO: 1), a mutation of, for example, one or more of C125, Cl 96, C219, C272, C332, and C352; for Neu3 (SEQ ID NO: 8), a mutation of, for example, one or more of C7, C90, C99, C106, C127, C136, C189, C194, C226, C242, C250, C273, C279, C295, C356, C365, C368, C384, C383, C394, and C415; and for Neu4 (SEQ ID NO: 10), a mutation of, for example, one or more of C88, C125, C
- Free cysteines can be substituted with any amino acid.
- the free cysteine is substituted with serine (ser, S), isoleucine (iso, I), valine (val, V), phenylalanine (phe, F), leucine (leu, L), or alanine (ala, A).
- Exemplary cysteine substitutions in Neu2 include C125A, C125I, C125S, C125V, C196A, C196L, Cl 96V, C272S, C272V, C332A, C332S, C332V, C352L, and C352V.
- the recombinant mutant human sialidase comprises two or more cysteine substitutions.
- Exemplary double or triple cysteine substitutions in Neu2 include: C125S and C332S; C272V and C332A; C272V and C332S; C332A and C352L; C125S and C196L; C196L and C352L; C196L and C332A; C332A and C352L; and C196L, C332A and C352L.
- the recombinant mutant human sialidase is a Neu2 sialidase and comprises the substitutions C322A and C352L (SEQ ID NO: 5).
- the sialidase contains an amino acid substitution at 2, 3, 4, 5, or 6 cysteines typically present in a human sialidase, e.g., Neu2 or Neu3.
- the recombinant mutant human sialidase comprises a substitution or combination of substitutions corresponding to a substitution or combination of substitutions listed in TABLE 1 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)).
- the isoelectric point (pi) of a protein is the pH at which the net charge is zero.
- the pi also generally indicates the pH at which the protein is least soluble, which may affect the ability to express and purify the protein.
- a protein has good solubility if its pi is greater than 2 units above the pH of the solution.
- Human Neu2 has a predicted pi of 7.5.
- human Neu2 is least soluble around neutral pH, which is undesirable because expression and physiological systems are at neutral pH.
- the sialidase from Salmonella typhimurium (St-sialidase), which exhibits good solubility and recombinant expression, has a pi of 9.6.
- a recombinant mutant human sialidase may be designed to contain one or more amino acid substitution(s) wherein the substitution(s) increase(s) the pi of the sialidase relative to a sialidase without the substitution.
- a recombinant mutant human sialidase may be designed to contain one or more amino acid substitution(s) wherein the substitution(s) decrease(s) the hydrophobicity of a surface of the sialidase relative to a sialidase without the substitution(s).
- the recombinant mutant human sialidase comprises at least one amino acid substitution, wherein the substitution increases the isoelectric point (pi) of the sialidase and/or decreases the hydrophobicity of the sialidase relative to a sialidase without the substitution.
- This may be achieved by introducing one or more charged amino acids, for example, positively or negatively charged amino acids, into the recombinant sialidase.
- the amino acid substitution is to a charged amino acid, for example, a positively charged amino acid such as lysine (lys, K), histidine (his, H), or arginine (arg, R), or a negatively charged amino acid such as aspartic acid (asp,
- the amino acid substitution is to a lysine residue.
- the substitution increases the pi of the sialidase to about 7.75, about 8, about 8.25, about 8.5, about 8.75, about 9, about 9.25, about 9.5, or about 9.75.
- the amino acid substitution occurs at a surface exposed D or E amino acid, in a helix or loop, or in a position that has a K or R in the corresponding position of St-sialidase.
- the amino acid substitution occurs at an amino acid that is remote from the catalytic site or otherwise not involved in catalysis, an amino acid that is not conserved with the other human Neu proteins or with St-Sialidase or Clostridium NanH, or an amino acid that is not located in a domain important for function ( e.g ., an Asp -box or beta strand).
- Exemplary amino acid substitutions in Neu2 that increase the isoelectric point (pi) of the sialidase and/or decrease the hydrophobicity of the sialidase relative to a sialidase without the substitution include A2E, A2K, D215K, V325E, V325K, E257K, and E319K.
- the recombinant mutant human sialidase comprises two or more amino acid substitutions, including, for example, A2K and V325E, A2K and V325K, E257K and V325K, A2K and E257K, and E257K and A2K and V325K.
- the recombinant mutant human sialidase comprises a substitution or combination of substitutions corresponding to a substitution or combination of substitutions listed in TABLE 2 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)).
- the addition of a peptide sequence of two or more amino acids to the N-terminus of a human sialidase can improve expression and/or activity of the sialidase.
- the peptide is at least 2 amino acids in length, for example, from 2 to 20, from 2 to 10, from 2 to 5, or 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14,
- the peptide may form, or have a propensity to form, an a-helix.
- a Neu2 isoform (type B) found in thymus contains six amino acids not present in the canonical isoform of Neu2 found in skeletal muscle.
- the N-terminal six amino acids of the mouse thymus Neu2 isoform, MEDLRP (SEQ ID NO: 4), or variations thereof, can be added onto a human Neu, e.g., human Neu2.
- the recombinant mutant human sialidase comprises a peptide at least two amino acid residues in length covalently associated with an N-terminal amino acid of the sialidase.
- the recombinant mutant human sialidase comprises the peptide MEDLRP (SEQ ID NO: 4) or EDLRP (SEQ ID NO: 3) covalently associated with an N-terminal amino acid of the sialidase.
- the sialidase may further comprise a cleavage site, e.g. , a proteolytic cleavage site, located between the peptide, e.g, MEDLRP (SEQ ID NO: 4) or EDLRP (SEQ ID NO: 3), and the remainder of the sialidase.
- the peptide e.g., MEDLRP (SEQ ID NO: 4) or EDLRP (SEQ ID NO: 3), may be post-translationally cleaved from the remainder of the sialidase.
- 1-5 amino acids of the 12 amino acid N-terminal region of the recombinant mutant human sialidase may be removed, e.g. , the N-terminal methionine can be removed.
- the N-terminal methionine can be removed, the first five amino acids (MASLP; SEQ ID NO: 12) can be removed, or the second through fourth amino acids (ASLP; SEQ ID NO: 13) can be removed.
- 1-5 amino acids of the 12 amino acid N-terminal region of the recombinant mutant human sialidase are substituted with MEDLRP (SEQ ID NO: 4), EDLRP (SEQ ID NO: 3), or TVEKSVVF (SEQ ID NO: 14).
- MEDLRP SEQ ID NO: 4
- EDLRP SEQ ID NO: 3
- TVEKSVVF SEQ ID NO: 14
- the amino acids MASLP SEQ ID NO: 12
- ASLP SEQ ID NO: 13
- M are substituted with MEDLRP (SEQ ID NO: 4), EDLRP (SEQ ID NO: 3) or TVEKSVVF (SEQ ID NO: 14).
- Human sialidases have a b-propeller structure, characterized by 6 blade-shaped b- sheets arranged toroidally around a central axis. Generally, hydrophobic interactions between the blades of a b-propeller, including between the N- and C-terminal blades, enhance stability. Accordingly, in order to increase expression of human Neu2 or the other human sialidases, a recombinant mutant human sialidase can be designed comprising an amino acid substitution that increases hydrophobic interactions and/or hydrogen bonding between the N- and C-terminal b-propeller blades of the sialidase.
- the recombinant mutant human sialidase comprises a substitution of at least one wild-type amino acid residue, wherein the substitution increases hydrophobic interactions and/or hydrogen bonding between the N- and C-termini of the sialidase relative to a sialidase without the substitution.
- the wild-type amino acid is substituted with asparagine (asn, N), lysine (lys, K), tyrosine (tyr, Y), phenylalanine (phe, F), or tryptophan (trp, W).
- Exemplary substitutions in Neu2 that increase hydrophobic interactions and/or hydrogen bonding between the N- and C-termini include L4N, L4K, V6Y, L7N, L4N and L7N, L4N and V6Y and L7N, V12N, V12Y, V12L, V6Y, V6F, or V6W.
- the sialidase comprises the V6Y substitution.
- the recombinant mutant human sialidase comprises a combination of the above substitutions.
- a recombinant mutant human Neu2 sialidase can comprise the additional amino acids MEDLRP (SEQ ID NO: 4), EDLRP (SEQ ID NO: 3), or TVEKSVVF (SEQ ID NO: 14) at the N-terminus and, in combination, can comprise at least one L4N, L4K, V6Y, L7N, L4N and L7N, L4N and V6Y and L7N, V12N, V12Y, V12L, V6Y, V6F, or V6W substitution.
- the amino acids MASLP (SEQ ID NO: 12), ASLP (SEQ ID NO: 13) or M of a recombinant mutant human Neu2 sialidase are replaced with MEDLRP (SEQ ID NO: 4), EDLRP (SEQ ID NO: 3) or TVEKSVVF (SEQ ID NO: 14) and the recombinant mutant human Neu2 sialidase also comprises at least one L4N, L4K, V6Y, L7N, L4N and L7N, L4N and V6Y and L7N, V12N, VI 2 Y, V12L, V6Y, V6F, or V6W substitution.
- the recombinant mutant human sialidase comprises a mutation or combination of mutations corresponding to a mutation or combination of mutations listed in TABLE 3 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)).
- the sialidase comprises a substitution or deletion of an N-terminal methionine at the N-terminus of the sialidase.
- the sialidase comprises a substitution of a methionine residue at a position corresponding to position 1 of wild-type human Neu2 (SEQ ID NO: 1), e.g. , the methionine at a position corresponding to position 1 of wild-type human Neu2 is substituted by alanine (MIA) or aspartic acid (MID).
- MIA alanine
- MID aspartic acid
- the sialidase comprises a deletion of a methionine residue at a position corresponding to position 1 (DM1) of wild-type human Neu2 (SEQ ID NO: 1).
- the recombinant mutant human sialidase comprises a substitution or combination of substitutions corresponding to a substitution or combination of substitutions listed in TABLE 4 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)).
- sialidases e.g ., human Neu2
- a protease e.g., trypsin
- proteolytic cleavage of the sialidase may occur during recombinant protein production, harvesting, purification, or formulation, during administration to a subject, or after administration to a subject.
- the recombinant mutant human sialidase comprises a substitution of at least one wild-type amino acid residue, wherein the substitution decreases cleavage of the sialidase by a protease (e.g, trypsin) relative to a sialidase without the substitution.
- incubation of the recombinant mutant human sialidase with a protease results in from about 1% to about 50%, from about 1% to about 40%, from about 1%, to about 30%, from about 1% to about 20%, from about 1% to about 10%, from about 1% to about 5%, from about 5% to about 50%, from about 5% to about 40%, from about 5% to about 30%, from about 5% to about 20%, from about 5% to about 10%, from about 10% to about 50%, from about 10% to about 40%, from about 10% to about 30%, from about 10% to about 20%, from about 20% to about 50%, from about 20% to about 40%, from about 20% to about 30%, from about 30% to about 50%, from about 30% to about 40%, or from about 40% to about 50% of the proteolytic cleavage of a corresponding wild-type sialidase when incubated with the protease under the same conditions.
- a protease e.g, trypsin
- incubation of the recombinant mutant human sialidase with a protease results in less than 50%, less than 40%, less than 30%, less than 10%, less than 5%, less than 3%, less than 1%, or less than 0.5% of the proteolytic cleavage of a corresponding wild-type sialidase when incubated with the protease under the same conditions.
- protease e.g trypsin
- Proteolytic cleavage can be assayed by any method known in the art, including for example, by SDS- PAGE as described in Example 5 herein.
- Exemplary substitutions that increase resistance to proteolytic cleavage include: (i) a substitution of an alanine residue at a position corresponding to position 242 of wild-type human Neu2 (SEQ ID NO: 1), e.g., a substitution by cysteine (A242C), phenylalanine (A242F), glycine (A242G), histidine (A242H), isoleucine (A242I), lysine (A242K), leucine (A242L), methionine (A242M), asparagine (A242N), glutamine (A242Q), arginine (A242R), serine (A242S), valine (A242V), tryptophan (A242W), or tyrosine (A242Y); (ii) a substitution of an arginine residue at a position corresponding to position 243 of wild-type human Neu2 (SEQ ID NO: 1),
- the recombinant mutant human sialidase comprises a substitution selected from A242C, A242F, A242Y, and A242W. In certain embodiments, the recombinant mutant human sialidase comprises a substitution or combination of substitutions corresponding to a substitution or combination of substitutions listed in TABLE 5 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)).
- Additional exemplary substitutions that increase resistance to proteolytic cleavage (and/or increase expression yield and/or enzymatic activity) include: (i) a substitution of a leucine residue at a position corresponding to position 240 of wild-type human Neu2 (SEQ ID NO: 1), e.g. , a substitution by aspartic acid (L240D), asparagine (L240N), or tyrosine (L240Y); (ii) a substitution of an alanine residue at a position corresponding to position 213 of wild-type human Neu2 (SEQ ID NO: 1), e.g.
- a substitution or a combination of substitutions at these positions may improve hydrophobic and/or aromatic interaction between secondary structure elements in the sialidase (e.g, between an a-helix and the nearest b-sheet) thereby stabilizing the structure and improving resistance to proteolytic cleavage.
- the recombinant mutant sialidase comprises a mutation at position L240.
- the recombinant mutant sialidase comprises a combination of mutations at positions (i) A213 and A242, (ii) A213, A242, and S258, (iii) L240 and L260, (iv) R241 and A242, (v) A242 and L260, (vi) A242 and V265, or (vii) L240 and A242.
- the recombinant mutant human sialidase comprises a combination of substitutions selected from (i) A213C, A242F, and S258C, (ii) A213C and A242F, (iii) A213T and A242F, (iv) R241Y and A242F, and (v) L240Y and A242F.
- the recombinant mutant human sialidase comprises a substitution or combination of substitutions corresponding to a substitution or combination of substitutions listed in TABLE 6 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)).
- the invention further provides a recombinant mutant human sialidase comprising at least one of the following substitutions: I187K, A328E, K370N, or H210N.
- a recombinant mutant human Neu2 comprises the substitution of the amino acids GDYDAPTHQVQW (SEQ ID NO: 15) with the amino acids SMDQGSTW (SEQ ID NO: 16) or STDGGKTW (SEQ ID NO: 17).
- a recombinant mutant human Neu2 comprises the substitution of the amino acids GDYDAPTHQVQW (SEQ ID NO: 15) with the amino acids SMDQGSTW (SEQ ID NO: 16) or STDGGKTW (SEQ ID NO: 17).
- recombinant mutant human Neu2 comprises the substitution of the amino acids PRPPAPEA (SEQ ID NO: 18) with the amino acids QTPLEAAC (SEQ ID NO: 19).
- a recombinant mutant human Neu2 comprises the substitution of the amino acids NPRPPAPEA (SEQ ID NO: 20) with the amino acids SQNDGES (SEQ ID NO: 21).
- the invention further provides a recombinant mutant human sialidase comprising at least one substitution at a position corresponding to V212, A213, Q214, D215, T216, L217, E218, C219, Q220, V221, A222, E223, V224, E225, or T225.
- the invention further provides a recombinant mutant human sialidase comprising an amino acid substitution at a position identified in TABLE 7 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1).
- the sialidase comprises an amino acid substitution identified in TABLE 7.
- the sialidase comprises a combination of any amino acid substitutions identified in TABLE 7.
- the recombinant mutant human sialidase comprises: (a) a substitution of a proline residue at a position corresponding to position 5 of wild-type human Neu2 (P5); (b) a substitution of a lysine residue at a position corresponding to position 9 of wild-type human Neu2 (K9); (c) a substitution of a lysine residue at a position corresponding to position 44 of wild-type human Neu2 (K44); (d) a substitution of a lysine residue at a position corresponding to position 45 of wild-type human Neu2 (K45); (e) a substitution of a leucine residue at a position corresponding to position 54 of wild-type human Neu2 (L54); (f) a substitution of a proline residue at a position corresponding to position 62 of wild-type human Neu2 (P62); (g) a substitution of a glutamine residue at a position corresponding to position 69 of wild-type human Neu2
- the proline residue at a position corresponding to position 5 of wild-type human Neu2 is substituted by histidine (P5H);
- the lysine residue at a position corresponding to position 9 of wild-type human Neu2 is substituted by aspartic acid (K9D);
- the lysine residue at a position corresponding to position 44 of wild-type human Neu2 is substituted by arginine (K44R) or glutamic acid (K44E);
- the lysine residue at a position corresponding to position 45 of wild-type human Neu2 is substituted by alanine (K45A), arginine (K45R), or glutamic acid (K45E);
- the leucine residue at a position corresponding to position 54 of wild-type human Neu2 is substituted by methionine (L54M);
- the proline residue at a position corresponding to position 62 of wild-type human Neu2 is substituted by methionine (L54M);
- tyrosine (R241 Y) the alanine residue at a position corresponding to position 242 of wild-type human Neu2 is substituted by cysteine (A242C), phenylalanine (A242F), glycine (A242G), histidine (A242H), isoleucine (A242I), lysine (A242K), leucine (A242L), methionine (A242M), asparagine (A242N), glutamine (A242Q), arginine (A242R), serine (A242S), valine (A242V), tryptophan (A242W), or tyrosine (A242Y); (ee) the valine residue at a position corresponding to position 244 of wild-type human Neu2 is substituted by isoleucine (V244I), lysine (V244K), or proline (V244P); (ff) the glutaline residue at
- the sialidase may comprise a substitution selected from K9D, P62G, P62N, P62S, P62T, D80P, A93E, Q126H, Q126Y, R189P, H239P, A242T, Q270A, Q270S, Q270T,
- the recombinant mutant human sialidase comprises a deletion of a leucine residue at a position corresponding to position 184 of wild-type human Neu2 (AL l 84), a deletion of a histidine residue at a position corresponding to position 185 of wild-type human Neu2 (DH185), a deletion of a proline residue at a position corresponding to position 186 of wild-type human Neu2 (DR186), a deletion of an isoleucine residue at a position corresponding to position 187 of wild-type human Neu2 (DI187), and a deletion of a glutamine residue at a position corresponding to position 184 of wild-type human Neu2 (AQ188), or a combination of any of the foregoing deletions.
- the recombinant mutant human sialidase comprises an insertion between a threonine residue at a position corresponding to position 216 of wild- type human Neu2 and a leucine residue at a position corresponding to position 217 of wild- type human Neu2, for example, an insertion of an amino acid selected from S, T, Y, L, F, A, P, V, I, N, D, and H.
- the invention further provides a recombinant mutant human sialidase comprising a combination of any of the mutations contemplated herein.
- the recombinant mutant sialidase enzyme may comprise a combination of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more of the mutations contemplated herein. It is contemplated that the recombinant mutant sialidase enzyme may comprise 1-15, 1-10, 1-7, 1-6, 1-5, 1-4, 1-3, 1-2, 2-15, 2-10, 2-7, 2-6, 2-5, 2-4, 2-3, 3-15, 3-10, 3-7, 3-6, 3-5, or 3-4 of the mutations contemplated herein.
- the recombinant mutant sialidase enzyme may comprise a Ml deletion (DM1), MIA substitution, MID substitution, V6Y substitution, K9D substitution, P62G substitution, P62N substitution, P62S substitution, P62T substitution, A93E
- the recombinant mutant sialidase enzyme comprises a Ml deletion (DM1), MIA substitution, MID substitution, V6Y substitution, I187K substitution, C332A substitution, or a combination of any of the foregoing.
- the recombinant mutant sialidase enzyme may comprise a combination of mutations selected from: MIA and V6Y; MIA and I187K; MIA and C332A; MID and V6Y; MID and I187K; MID and C332A; DM1 and V6Y; DM1 and I187K; DM1 and C332A; V6Y and I187K; V6Y and C332A; I187K and C332A; MIA, V6Y, and I187K; MIA, V6Y, and C332A; MIA, I187K, and C332A; MID, V6Y, and I187K; MID, V6Y, and C332A; MID, I187K, and C332A; DM1, V6Y, and I187K; DM1, V6Y, and C332A; DM1, 1187K, and C332A; V6Y, I187K, and C332A; MIA, V6Y; MI
- the recombinant mutant sialidase enzyme comprises (i) an amino acid substitution identified in TABLE 7, or a combination of any amino acid substitutions identified in TABLE 7, and (ii) an Ml deletion (AMI), MIA substitution, MID substitution, V6Y substitution, I187K substitution, C332A substitution, or a combination of any of the foregoing.
- AMI Ml deletion
- the recombinant mutant sialidase enzyme may comprise (i) an amino acid substitution identified in TABLE 7, or a combination of any amino acid substitutions identified in TABLE 7, and (ii) a combination of mutations selected from: MIA and V6Y; MIA and I187K; MIA and C332A; MID and V6Y; MID and I187K; MID and C332A; DM1 and V6Y; DM1 and I187K; DM1 and C332A; V6Y and I187K; V6Y and C332A; I187K and C332A; MIA, V6Y, and I187K; MIA, V6Y, and C332A; MIA, I187K, and C332A; MID, V6Y, and I187K; MID, V6Y, and C332A; MID, I187K, and C332A; DM1, V6Y, and I187K; DM1, V6Y, and C332A; DM1,
- the recombinant mutant sialidase enzyme comprises: (a) the MID, V6Y, P62G, A93E, I187K, and C332A substitutions; (b) the MID, V6Y, K9D, A93E, I187K, C332A, V363R, and L365I substitutions; (c) the MID, V6Y, P62N, I187K, and C332A substitutions; (d) the MID, V6Y, I187K, Q270A, S301R, W302K, and C332A substitutions; (e) the MID, V6Y, P62S, I187K, Q270A, S301R, W302K, and C332A substitutions; (f) the MID, V6Y, P62T, I187K, Q270A, S301R, W302K, and C332A substitutions; (g) the MID, V6Y, P62N, I187K
- the recombinant mutant human sialidase comprises a substitution of a serine residue at a position corresponding to position 301 of wild-type human Neu2 (S301) in combination with a substitution of a tryptophan residue at a position corresponding to position 302 of wild-type human Neu2 (W302).
- the recombinant mutant human sialidase may comprise a combination of substitutions corresponding to a combination of substitutions listed in a row of TABLE 8 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)).
- the recombinant mutant human sialidase may comprise: the S301K and W302R substitutions; the S301K and W302K substitutions; or the S301 A and W302S substitutions.
- the recombinant mutant human sialidase comprises a combination of substitutions corresponding to a combination of substitutions listed in a row of TABLE 9 (amino acid positions corresponding to wild-type human Neu2 (SEQ ID NO: 1)) ⁇
- the recombinant mutant human sialidase comprises the amino acid sequence of any one of SEQ ID NOs: 48-54, 149, 154, 159, or 191, or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOs: 48-54, 149, 154, 159, or 191.
- the recombinant mutant human sialidase comprises the amino acid sequence of
- X 2 is Ala or Lys
- X 3 is Asn or Leu
- X 4 is Pro or His
- X 5 is Phe
- Trp, Tyr or Val is Lys or Asp
- X 7 is Lys, Arg, or Glu
- Xx is Lys, Ala, Arg, or Glu
- X 9 is
- X 10 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, Xu is Gin or His, X 12 is Arg or
- Lys, Xi 3 is Ala, Glu or Lys, X 14 is Gly or Asp, X 15 is Gin or His, X1 ⁇ 2 is Gin, Arg, or Lys, X 17 is Ala, Cys, lie, Ser, Val, or Leu, Xis is Gin or Leu, X 19 is Ala or Val, X 20 is Cys or Gly, X 21 is Ala or Gly, X 22 is Arg, lie, or Lys, X 23 is Ala, Cys, Leu, or Val, X 24 is Leu, Ala, or Val, X 25 is Thr or Ala, X 26 is Asp or Gly, X 27 is Glu or Lys, X 28 is Gin, Ala, His, Phe, or Pro, X 29 is
- X 30 is Trp or Arg
- X 31 is Ser or Arg
- X 32 is Trp or Lys
- X 33 is Lys or Val
- X 34 is
- X 35 is Cys, Leu, or Val
- X 36 is Val or Arg
- X 37 is Leu, Gin, His, He
- sialidase comprises at least one mutation relative to wild-type human
- the recombinant mutant human sialidase comprises the amino acid sequence of
- X 2 is Phe, Trp, Tyr or Val
- X 3 is Lys or Asp
- X 4 is Pro, Asn
- X 5 is Ala, Glu, or Lys
- X 7 is Gin, Ala, His, Phe, or Pro
- Xs is Ser or Arg
- X 9 is Trp or Lys
- X 10 is Ala, Cys, Ser, or Val
- Xu is Val or Arg
- Xn is Leu, Gin, His, He, Lys, or Ser
- the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
- Xi is Ala, Asp, Met, or not present
- X 2 is Tyr or Val
- X 3 is Lys or Asp
- X 4 is Pro
- Asn Gly
- X 5 is Ala or Glu
- C ⁇ He or Lys
- X 7 is Gin or Ala
- Xs is Ser or Arg
- X 9 is Trp or Lys
- X 10 is Ala or Cys
- Xu is Val or Arg
- X 12 is Leu or He.
- the recombinant mutant human sialidase comprises the amino acid sequence of X1X2SX3X4X5LQX6ESVFQSGAHAYRI PALLYLPGQQSLLAFAEQRASX7X8DEHAEL IVX9RR
- Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Val, or not present
- X2 is Ala or Lys
- X3 is Asn or Leu
- X4 is Pro or His
- X5 is Phe, Trp, Tyr or Val
- Xr is Lys or Asp
- X7 is Lys, Arg, or Glu
- Xx is Lys, Ala, Arg, or Glu
- X9 is Leu or Met
- X10 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr
- Xu is Gin or His
- X12 is Arg or Lys
- Xi3 is Asp or Pro
- X14 is Ala
- X15 is Gly or Asp
- X1 ⁇ 2 is Gin or His
- X17 is Gin, Arg, or Lys
- X47 is Lys or Val
- X48 is Ala
- X49 is Cys, Leu, or Val
- X50 is Val or Arg
- X51 is Leu, Gin, His, He, Lys, or Ser
- the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
- the recombinant mutant human sialidase comprises the amino acid sequence of
- FX 14 MFTLKQAFPAEYLPQ (SEQ ID NO: 183), wherein Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Val, or not present, X2 is Phe, Trp, Tyr or Val, X3 is Lys or Asp, X4 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, X5 is Ala, Glu, or Lys, C ⁇ is Gin, Leu, Glu, Phe, His, He, Leu, or Tyr, X7 IS Arg, He, or Lys, Xs is Ala, Cys, Phe, Gly, His, lie, Lys, Leu, Met, Asn, Gin,
- X9 is Gin, Ala, His, Phe, Pro, Ser, or Thr
- X10 is Ser, Arg, Ala, Asp, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Gin, Thr, Val, Trp, or Tyr
- Xu is Trp, Lys, Ala, Asp, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Gin, Arg, Ser, Thr, Val, or Tyr
- X12 is Ala, Cys, Ser, or Val
- X13 is Val or Arg
- X14 is Leu, Gin, His, He, Lys, or Ser
- the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
- Xi is Ala, Asp, Met, or not present, X2 is Tyr or Val, X3 is Lys or Asp, X4 is Pro, Asn, Gly, Ser or Thr, X5 is Ala or Glu, C ⁇ is Gin or Tyr, X7 is He or Lys, X 8 is Ala or Thr, X9 is Gin, Ala, or Thr, X10 is Ser, Arg, or Ala, Xu is Trp, Lys, or Arg, X12 is Ala or Cys, X13 is Val or Arg, and X14 is Leu or He.
- the recombinant mutant human sialidase comprises a conservative substitution relative to a recombinant mutant human sialidase sequence disclosed herein.
- conservative substitution refers to a substitution with a structurally similar amino acid.
- conservative substitutions may include those within the following groups: Ser and Cys; Leu, He, and Val; Glu and Asp; Lys and Arg; Phe, Tyr, and Trp; and Gin, Asn, Glu, Asp, and His.
- Conservative substitutions may also be defined by the BLAST (Basic Local Alignment Search Tool) algorithm, the
- BLOSUM substitution matrix e.g., BLOSUM 62 matrix
- PAM substitution ⁇ matrix e.g., the PAM 250 matrix
- Sequence identity may be determined in various ways that are within the skill of a person skilled in the art, e.g. , using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software.
- BLAST Basic Local Alignment Search Tool
- analysis using the algorithm employed by the programs blastp, blastn, blastx, tblastn and tblastx (Karlin et al ., (1990) PROC. NATL. ACAD. SCI. USA 87:2264-2268;
- Altschul, (1993) J. MOL. EVOL. 36:290-300; Altschul et al. , (1997) NUCLEIC ACIDS RES. 25:3389-3402, incorporated by reference herein) are tailored for sequence similarity searching.
- Altschul et al. (1994) NATURE GENETICS 6: 119-129, which is fully incorporated by reference herein.
- Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- the search parameters for histogram, descriptions, alignments, expect i.e., the statistical significance threshold for reporting matches against database sequences
- cutoff, matrix and filter are at the default settings.
- the default scoring matrix used by blastp, blastx, tblastn, and tblastx is the BLOSUM62 matrix (Henikoff et al ., (1992) PROC. NATL. ACAD. SCI. USA 89: 10915-10919, fully incorporated by reference herein).
- sialidase As described herein to such a cell or to such a tumor microenvironment, it may be helpful to extend the plasma half-life of the sialidase in the subject. These can be achieved by including the sialidase in a fusion protein and/or antibody conjugate (e.g, a chemically conjugated conjugate).
- the invention further provides fusion proteins comprising a sialidase enzyme, or a functional fragment thereof, and a portion or fragment of an antibody, such as an immunoglobulin Fc domain (also referred to herein as an Fc domain), or an
- immunoglobulin antigen-binding domain also referred to herein as an antigen-binding domain.
- the sialidase and antibody or portion thereof e.g ., immunoglobulin Fc domain or antigen-binding domain
- fusion protein is understood to refer to a single polypeptide chain comprising amino acid sequences based upon two or more separate proteins or polypeptide chains, where the two amino acid sequences may be fused together directly or via an intervening linker sequence, e.g., via an intervening amino acid linker.
- a nucleotide sequence encoding a fusion protein can, for example, be created using conventional recombinant DNA technologies.
- the fusion protein comprises a tag, such as a Strep tag (e.g, a Strep II tag), a His tag (e.g, a lOx His tag), a myc tag, or a FLAG tag.
- the tag can be located on the C-terminus or the N-terminus of the fusion protein.
- a fusion protein comprises a sialidase portion joined to a polypeptide comprising an
- the sialidase portion comprises an N-terminal addition of MEDLRP (SEQ ID NO: 4), and a Strep II Tag is located on the C-terminus of the immunoglobulin heavy chain or the N-terminus of the sialidase portion.
- the sialidase portion of the fusion protein described herein can be any sialidase, e.g, a fungal, bacterial, non-human mammalian or human sialidase.
- the sialidase portion is a recombinant human sialidase comprising at least one mutation relative to a wild-type human sialidase, e.g, a substitution, deletion, or addition of at least one amino acid, as described above.
- the sialidase is any recombinant mutant human sialidase disclosed herein, or a functional fragment thereof.
- the sialidase portion comprises a C332A and C352L mutation.
- the sialidase comprises an N-terminal addition of MEDLRP (SEQ ID NO: 4) or EDLRP (SEQ ID NO: 3).
- the sialidase portion comprises a LSHSLST (SEQ ID NO: 22) peptide on the N-terminus.
- the sialidase portion comprises an N-terminal addition of MEDLRP (SEQ ID NO: 4) and an A2K substitution.
- the sialidase portion comprises an N-terminal addition of MEDLRP (SEQ ID NO: 4) and a C332A substitution.
- the sialidase portion comprises an N-terminal addition of MEDLRP (SEQ ID NO: 4), a C332A substitution, and a C352L substitution.
- the sialidase portion comprises an Ml deletion (DM1), MIA substitution, MID substitution, V6Y substitution, K9D substitution, P62G substitution, P62N substitution, P62S substitution, P62T substitution, A93E substitution, Q126Y substitution, I187K substitution, A242T substitution, Q270A substitution, Q270T
- the sialidase portion comprises the amino acid sequence of any one of SEQ ID NOs: 48-54, 149, 154, 159, or 191, or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOs: 48-54, 149, 154, 159, or 191.
- the term“antibody” is understood to mean an intact antibody (e.g ., an intact monoclonal antibody), or a fragment thereof, such as a Fc fragment of an antibody (e.g., an Fc fragment of a monoclonal antibody), or an antigen binding fragment of an antibody (e.g, an antigen-binding fragment of a monoclonal antibody), including an intact antibody, antigen-binding fragment, or Fc fragment that has been modified, engineered, or chemically conjugated.
- antigen-binding fragments include Fab, Fab’, (Fab’)2, Fv, single chain antibodies (e.g, scFv), minibodies, and diabodies.
- antibodies that have been modified or engineered include chimeric antibodies, humanized antibodies, and multispecific antibodies (e.g, bispecific antibodies).
- An example of a chemically conjugated antibody is an antibody conjugated to a toxin moiety.
- the fusion protein comprises an immunoglobulin Fc domain.
- immunoglobulin Fc domain refers to a fragment of an immunoglobulin heavy chain constant region which, either alone or in combination with a second immunoglobulin Fc domain, is capable of binding to an Fc receptor.
- An immunoglobulin Fc domain may include, e.g ., immunoglobulin CH2 and CH3 domains.
- An immunoglobulin Fc domain may include, e.g. , immunoglobulin CH2 and CH3 domains and an immunoglobulin hinge region. Boundaries between immunoglobulin hinge regions, CH2, and CH3 domains are well known in the art, and can be found, e.g. , in the PROSITE database (available on the world wide web at prosite.expasy.org).
- the immunoglobulin Fc domain is derived from a human IgGl, IgG2, IgG3, IgG4, IgAl, IgA2, IgD, IgE, and IgM Fc domain.
- a single amino acid substitution (S228P according to Rabat numbering; designated IgG4Pro) may be introduced to abolish the heterogeneity observed in recombinant IgG4 antibody. See Angal, S. el al. (1993) MOL. IMMUNOL. 30: 105-108.
- the immunoglobulin Fc domain is derived from a human IgGl isotype or another isotype that elicits antibody-dependent cell-mediated cytotoxicity (ADCC) and/or complement mediated cytotoxicity (CDC).
- the immunoglobulin Fc domain is derived from a human IgGl isotype (e.g, SEQ ID NO: 31 or SEQ ID NO: 5).
- the immunoglobulin Fc domain is derived from a human IgG4 isotype or another isotype that elicits little or no antibody-dependent cell-mediated cytotoxicity (ADCC) and/or complement mediated cytotoxicity (CDC). In certain embodiments, the immunoglobulin Fc domain is derived from a human IgG4 isotype.
- the immunoglobulin Fc domain comprises either a“knob” mutation, e.g, T366Y, or a“hole” mutation, e.g, Y407T, for heterodimerization with a second polypeptide (residue numbers according to EU numbering, Rabat, E.A., et al. (1991) SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST, FIFTH EDITION, U. S. Department of Health and Human Services, NIH Publication No. 91-3242).
- the fusion protein comprises an immunoglobulin antigen binding domain.
- the inclusion of such a domain may improve targeting of a fusion protein to a sialylated cancer cell and/or to the tumor microenvironment.
- immunoglobulin antigen-binding domain refers to a polypeptide that, alone or in combination with another immunoglobulin antigen-binding domain, defines an antigen-binding site.
- immunoglobulin antigen-binding domains include, for example, immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region, where the variable regions together define an antigen binding site.
- the immunoglobulin antigen-binding domain and/or antigen binding site can be derived from an antibody selected from, for example, adecatumumab, ascrinvacumab, cixutumumab, conatumumab, daratumumab, drozitumab, duligotumab, durvalumab, dusigitumab, enfortumab, enoticumab, epratuxumab, figitumumab, ganitumab,
- glembatumumab intetumumab, ipilimumab, iratumumab, icrucumab, lexatumumab, lucatumumab, mapatumumab, namatumab, necitumumab, nesvacumab, ofatumumab, olaratumab, panitumumab, patritumab, pritumumab, radretumab, ramucirumab,
- rilotumumab robatumumab, seribantumab, tarextumab, teprotumumab, tovetumab, vantictumab, vesencumab, votumumab, zalutumumab, flanvotumab, altumomab,
- anatumomab anatumomab, arcitumomab, bectumomab, blinatumomab, detumomab, ibritumomab, minretumomab, mitumomab, moxetumomab, naptumomab, nofetumomab, pemtumomab, pintumomab, racotumomab, satumomab, solitomab, taplitumomab, tenatumomab, tositumomab, tremelimumab, abagovomab, atezolizumab, durvalumab, avelumab, igovomab, oregovomab, capromab, edrecolomab, nacolomab, amatuximab, ba
- moxetumomab moxetumomab, nimotuzumab, obinutuzumab, ocaratuzumab, otlertuzumab, onartuzumab, oportuzumab, parsatuzumab, pertuzumab, pidilizumab, pinatuzumab, polatuzumab, sibrotuzumab, pumpuzumab, tacatuzumab, tigatuzumab, trastuzumab, tucotuzumab, urelumab, vandortuzumab, vanucizumab, veltuzumab, vorsetuzumab, sofituzumab, catumaxomab, ertumaxomab, depatuxizumab, ontuxizumab, blontuvetmab, tamtuvetmab, ni
- the immunoglobulin anti gen -binding domain can be derived from an antibody selected from trastuzumab, daratumumab, girentuximab, ofatumumab, and rituximab.
- the immunoglobulin antigen-binding domain is derived from trastuzumab.
- the trastuzumab heavy chain amino acid sequence is depicted in SEQ ID NO: 63
- the trastuzumab light chain amino acid sequence is depicted in SEQ ID NO: 64.
- the amino acid sequence of an exemplary scFv derived from trastuzumab is depicted in SEQ ID NO: 65.
- the immunoglobulin antigen-binding domain and/or antigen binding site can be derived from an antibody that binds a cancer antigen selected from, for example, adenosine A2a receptor (A2aR), A kinase anchor protein 4 (AKAP4), B melanoma antigen (BAGE), brother of the regulator of imprinted sites (BORIS), breakpoint cluster region Abelson tyrosine kinase (BCR/ABL), CA125, CAIX, CD19, CD20, CD22, CD30, CD33, CD52, CD73, CD137, carcinoembryonic antigen (CEA), CS1, cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4), estrogen receptor binding site associated antigen 9 (EB AG9), epidermal growth factor (EGF), epidermal growth factor receptor (EGFR), EGF-like module receptor 2 (EMR2), epithelial cell adhesion molecule (EpCAM) (17-1A), FR-alpha,
- Neurogen GcGM3 indoleamine-2, 3 -di oxygenase 1 (IDOl), IGF-1, IGF1R, IGG1K, killer cell immunoglobulin-like receptor (KIR), lymphocyte activation gene 3 (LAG-3), lymphocyte antigen 6 complex K (LY6K), Matrix-metalloproteinase- 16 (MMP16), melanotransferrin (MFI2), melanoma antigen 3 (MAGE-A3), melanoma antigen C2 (MAGE-C2), melanoma antigen D4 (MAGE-D4), melanoma antigen recognized by T-cells 1 (Mel an- A/MART- 1), N- m ethyl -N’-nitroso-guani dine human osteosarcoma transforming gene (MET), mucin 1 (MUC1), mucin 4 (MUC4), mucin 16 (MUC16), New York esophageal squam
- melanoma preferentially expressed antigen of melanoma
- PSA prostate specific antigen
- PTK7 protein tyrosine kinase 7
- CCK4 colon carcinoma kinase 4
- ROR1 receptor tyrosine kinase orphan receptor 1
- SX1 synovial sarcoma X-chromosome breakpoint 1
- TIM-3 vascular endothelial growth factor (VEGF) (e.g., VEGF-A), vascular endothelial growth factor Receptor 2 (VEGFR2), V-domain immunoglobulin-containing suppressor of T-cell activation (VISTA), Wilms’ Tumor-1 (WT1), X chromosome antigen lb (XAGE-lb), 5T4, Mesethelial growth factor (WT1), X chromosome antigen lb (XAGE-lb), 5T4, Mesethelial growth factor (WT1), X chromosome antigen
- cancer antigens include those found on cancer stem cells, e.g, SSEA3, SSEA4, TRA-1-60, TRA-1-81, SSEA1, CD133 (AC133), CD90 (Thy-1), CD326 (EpCAM), Cripto-1 (TDGF1), PODXL-1 (Podocalyxin-like protein 1), ABCG2, CD24, CD49f (Integrin a6), Notch2, CD146 (MCAM), CD10
- CD117 c-KIT
- CD26 DPP-4
- CXCR4 CD34
- CD271, CD13 Alanine aminopeptidase
- CD56 NCAM
- CD105 Endoglin
- LGR5 CD114
- CD54 ICM-1
- CXCR1, 2, TIM-3 HAVCR2
- DLL4 Delta-like ligand 4
- CD20 MS4A1
- CD96 CD96.
- the invention further provides antibody conjugates containing one or more of the fusion proteins disclosed herein.
- antibody conjugate is understood to refer to an antibody, or a functional fragment thereof, that comprises antigen-binding activity and/or Fc receptor-binding activity, conjugated (e.g, covalently coupled) to an additional functional moiety.
- the antibody or functional antibody fragment is conjugated to a sialidase enzyme, e.g, a recombinant mutant human sialidase enzyme disclosed herein.
- an antibody conjugate comprises a single polypeptide chain.
- an antibody conjugate comprises two, three, four, or more polypeptide chains that are covalently or non- covalently associated together to produce a multimeric complex, e.g, a dimeric, trimeric or tetrameric complex.
- TABLE 10 shows antibodies and antibody-drug conjugates suitable for use in accordance with the present invention, the antigen bound by the antibody or antibody-drug conjugate, and for certain antibodies, the type of cancer targeted by the antibody or antibody- drug conjugate.
- the sialidase portion of the fusion protein can be linked or fused directly to the antibody portion (e.g immunoglobulin Fc domain and/or
- the sialidase portion can be covalently bound to the antibody portion by a linker.
- the linker may couple, with one or more natural amino acids, the sialidase, or functional fragment thereof, and the antibody portions or fragments, where the amino acid (for example, a cysteine amino acid) may be introduced by site-directed mutagenesis.
- the linker may include one or more unnatural amino acids. It is contemplated that, in certain circumstances, a linker containing for example, one or more sulfhydryl reactive groups (e.g., a maleimide) may covalently link a cysteine in the sialidase portion or the antibody portion that is a naturally occurring cysteine residue or is the product of site-specific mutagenesis.
- the linker may be a cleavable linker or a non-cleavable linker.
- the linker may be a flexible linker or an inflexible linker.
- the linker should be a length sufficiently long to allow the sialidase and the antibody portions to be linked without steric hindrance from one another and sufficiently short to retain the intended activity of the fusion protein.
- the linker preferably is sufficiently hydrophilic to avoid or minimize instability of the fusion protein.
- the linker preferably is sufficiently hydrophilic to avoid or minimize insolubility of the fusion protein.
- the linker should be sufficiently stable in vivo (e.g, it is not cleaved by serum, enzymes, etc.) to permit the fusion protein to be operative in vivo.
- the linker may be from about 1 angstroms (A) to about 150 A in length, or from about 1 A to about 120 A in length, or from about 5 A to about 110 A in length, or from about 10 A to about 100 A in length.
- the linker may be greater than about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 27, 30 or greater angstroms in length and/or less than about 110, 100, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, or fewer A in length.
- the linker may be about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, and 120 A in length.
- the linker comprises a polypeptide linker that connects or fuses the sialidase portion of the fusion protein to the antibody portion (e.g, immunoglobulin Fc domain and/or immunoglobulin antigen-binding domain) of the fusion protein.
- the antibody portion e.g, immunoglobulin Fc domain and/or immunoglobulin antigen-binding domain
- a gene encoding a sialidase portion linked directly or indirectly (for example, via an amino acid containing linker) to an antibody portion can be created and expressed using conventional recombinant DNA technologies.
- the amino terminus of a sialidase portion can be linked to the carboxy terminus of either the light or the heavy chain of an antibody portion.
- the amino terminus or carboxy terminus of the sialidase can be linked to the first constant domain of the heavy antibody chain (CHI).
- the linker may comprise hydrophilic amino acid residues, such as Gin, Ser, Gly, Glu, Pro, His and Arg.
- the linker is a peptide containing 1-25 amino acid residues, 1-20 amino acid residues, 2-15 amino acid residues, 3-10 amino acid residues, 3-7 amino acid residues, 4-25 amino acid residues, 4-20 amino acid residues, 4-15 amino acid residues, 4-10 amino acid residues, 5-25 amino acid residues, 5-20 amino acid residues, 5-15 amino acid residues, or 5- 10 amino acid residues.
- Exemplary linkers include glycine and serine-rich linkers, e.g. , (GlyGlyPro)n, or (GlyGlyGlyGlySer)n, where n is 1-5.
- the linker comprises, consists, or consists essentially of GGGGS (SEQ ID NO: 184).
- the linker comprises, consists, or consists essentially of GGGGSGGGGS (SEQ ID NO: 145).
- the linker comprises, consists, or consists essentially of EPKSS (SEQ ID NO: 146). Additional exemplary linker sequences are disclosed, e.g., in George et al. (2003) PROTEIN ENGINEERING 15 :871-879, and U.S. Patent Nos. 5,482,858 and 5,525,491.
- the fusion protein comprises the amino acid sequence of any one of SEQ ID NOs: 66-85, 98-142, 150-153, 155-158, 160-163, 166-178, 185, 187,
- the invention further provides antibody conjugates comprising a fusion protein disclosed herein.
- the antibody conjugate may comprise a single polypeptide chain (i.e., a fusion protein disclosed herein) or, the antibody conjugate may comprise additional polypeptide chains (e.g, one, two, or three additional polypeptide chains).
- an antibody conjugate may comprise a first polypeptide (fusion protein) comprising a recombinant mutant human sialidase enzyme and an immunoglobulin heavy chain, and a second polypeptide comprising an immunoglobulin light chain, where, for example, the immunoglobulin heavy and light chains together define a single antigen-binding site.
- the antibody conjugate can include a single sialidase. In other embodiments, the antibody conjugate can include more than one (e.g, two) sialidases. If more than one sialidase is included, the sialidases can be the same or different. In certain embodiments, the antibody conjugate can include a single antigen-binding site. In other embodiments, the antibody conjugate can include more than one (e.g, two) antigen-binding sites. If two antigen-binding sites are used, they can be the same or different. In certain embodiments, the antibody conjugate comprises an immunoglobulin Fc fragment.
- the antibody conjugate comprises one or two
- the antibody conjugate comprises one or two immunoglobulin light chains, or a functional fragment thereof. In certain embodiments, the antibody conjugate comprises a sialidase fused to the N- or C-terminus of an immunoglobulin heavy chain or an immunoglobulin light chain.
- FIGURE 9 depicts exemplary antibody conjugate constructs containing one or more sialidase enzymes.
- a first antigen-binding site is depicted as 10
- a second antigen-binding site is depicted as 20
- a sialidase is depicted as 30, and a Fab is depicted as 40.
- the Fc may optionally be modified in some manner, e.g. using Knobs-into- Holes type technology, e.g, as depicted by 50 in FIGURE 9B.
- similar structures are depicted by similar schematic representations.
- FIGURE 9A depicts antibody conjugate constructs comprising a first polypeptide comprising a first immunoglobulin light chain; a second polypeptide comprising a first immunoglobulin heavy chain; a third polypeptide comprising a second immunoglobulin heavy chain; and a fourth polypeptide comprising a second immunoglobulin light chain.
- the first and second polypeptides can be covalently linked together, the third and fourth polypeptides can be covalently linked together, and the second and third polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- first polypeptide and the second polypeptide together define a first antigen binding site as depicted as 10
- the third polypeptide and the fourth polypeptide together define a second antigen-binding site as depicted as 20.
- a sialidase enzyme as depicted as 30 can be conjugated to the N- or C-terminus of the first and second immunoglobulin light chain or the first and second immunoglobulin heavy chain.
- FIGURE 9B depicts antibody conjugate constructs comprising a first polypeptide comprising a first immunoglobulin light chain; a second polypeptide comprising a first immunoglobulin heavy chain; a third polypeptide comprising a second immunoglobulin heavy chain; and a fourth polypeptide comprising a second immunoglobulin light chain.
- the first and second polypeptides can be covalently linked together, the third and fourth polypeptides can be covalently linked together, and the second and third polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- first polypeptide and the second polypeptide together define a first antigen binding site
- third polypeptide and the fourth polypeptide together define a second antigen-binding site
- a sialidase enzyme can be conjugated to the N- or C-terminus of the first immunoglobulin light chain or the first immunoglobulin heavy chain.
- FIGURE 9C depicts antibody conjugate constructs comprising a first polypeptide comprising an immunoglobulin light chain; a second polypeptide comprising an immunoglobulin light chain
- first and second polypeptides can be covalently linked together and the second and third polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- the first polypeptide and the second polypeptide together define an antigen-binding site.
- a sialidase enzyme can be conjugated to the N- or C-terminus of the first immunoglobulin light chain or the first immunoglobulin heavy chain.
- FIGURE 9D depicts antibody conjugate constructs comprising a first polypeptide comprising an immunoglobulin light chain; a second polypeptide comprising an immunoglobulin light chain;
- the immunoglobulin heavy chain and a third polypeptide comprising an immunoglobulin Fc domain and a first sialidase enzyme.
- the first and second polypeptides can be covalently linked together and the second and third polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- the third polypeptide comprises the sialidase and the immunoglobulin Fc domain in an N- to C-terminal orientation.
- the first polypeptide and the second polypeptide together define an antigen-binding site.
- An optional second sialidase enzyme can be conjugated to the N- or C-terminus of the first immunoglobulin light chain or the first immunoglobulin heavy chain.
- FIGURE 9E depicts antibody conjugate constructs comprising a first polypeptide comprising an immunoglobulin light chain; a second polypeptide comprising an immunoglobulin light chain;
- the third polypeptide comprises the
- first polypeptide and the second polypeptide together define an antigen binding site.
- An optional second sialidase enzyme can be conjugated to the N- or C-terminus of the first immunoglobulin light chain or the first immunoglobulin heavy chain.
- FIGURE 9F depicts antibody conjugate constructs comprising a first polypeptide comprising a first immunoglobulin Fc domain, and a second polypeptide comprising a second immunoglobulin Fc domain.
- the first and second polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- a sialidase enzyme can be conjugated to the N- or C-terminus of the first immunoglobulin Fc domain or to the N- or C- terminus of the second immunoglobulin Fc domain.
- An optional second sialidase enzyme can be conjugated to the N- or C-terminus of the first immunoglobulin Fc domain or to the N- or C-terminus of the second immunoglobulin Fc domain.
- FIGURE 9G depicts antibody conjugate constructs comprising a first polypeptide comprising an immunoglobulin light chain; and a second polypeptide comprising an immunoglobulin heavy chain variable region.
- the first and second polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- the first polypeptide and the second polypeptide together define an antigen binding site.
- the sialidase enzyme can be conjugated to the N- or C-terminus of the immunoglobulin light chain or the immunoglobulin heavy chain variable region.
- FIGURE 9H depicts antibody conjugate constructs comprising a first polypeptide comprising a first immunoglobulin Fc domain, and a second polypeptide comprising a second immunoglobulin Fc domain.
- the first and second polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- a sialidase enzyme can be conjugated to the N-terminus of the first immunoglobulin Fc domain or the second immunoglobulin Fc domain.
- An optional second sialidase enzyme can be conjugated to the N-terminus of the second immunoglobulin Fc domain or the first immunoglobulin Fc domain, respectively.
- a single chain variable fragment can be conjugated to the C- terminus of the first immunoglobulin Fc domain or the second immunoglobulin Fc domain.
- An optional second single chain variable fragment can be conjugated to the C- terminus of the first immunoglobulin Fc domain or the second immunoglobulin Fc domain, respectively.
- FIGURE 91 depicts antibody conjugate constructs similar to those depicted in FIGURE 9H except that each scFv is replaced with an immunoglobulin antigen binding fragment, e.g ., an Fab.
- FIGURE 91 depicts antibody conjugate constructs comprising a first polypeptide comprising a first immunoglobulin Fc domain, and a second polypeptide comprising a second immunoglobulin Fc domain.
- the first and second polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- a sialidase enzyme can be conjugated to the N-terminus of the first immunoglobulin Fc domain or the second immunoglobulin Fc domain.
- An optional second sialidase enzyme can be conjugated to the N-terminus of the second immunoglobulin Fc domain or the first immunoglobulin Fc domain, respectively.
- An antibody fragment (Fab) can be conjugated or fused to the C-terminus of the first immunoglobulin Fc domain or the second
- an optional second antibody fragment can be conjugated or fused to the C-terminus of the second immunoglobulin Fc domain or the first immunoglobulin Fc domain, respectively.
- Fab second antibody fragment
- the C terminus of the Fc domain is linked (either by a bond or an amino acid linker) to a first polypeptide chain defining an immunoglobulin antigen binding fragment.
- antibodies that have an antigen binding site defined by a single variable region then this may be sufficient to impart binding affinity to a target antigen.
- the first polypeptide chain defining an immunoglobulin antigen binding fragment can be conjugated (e.g, covalently conjugated, e.g, via a disulfide bond) to a second polypeptide chain defining an immunoglobulin antigen binding fragment, there the two antigen binding fragments together define an antigen binding site for binding the target antigen.
- FIGURE 10 depicts additional antibody conjugate constructs.
- FIGURE 10 depicts an antibody conjugate construct comprising a first polypeptide comprising an immunoglobulin light chain; a second polypeptide comprising an immunoglobulin light chain;
- immunoglobulin heavy chain and an scFv immunoglobulin heavy chain and an scFv; and a third polypeptide comprising an
- the immunoglobulin Fc domain and a first sialidase enzyme can be covalently linked together and the second and third polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- the second polypeptide comprises the heavy chain and the scFv in an N- to C-terminal orientation.
- the third polypeptide comprises the sialidase and the immunoglobulin Fc domain in an N- to C- terminal orientation.
- the first polypeptide and the second polypeptide together define a first antigen-binding site.
- the scFv defines a second antigen-binding site.
- FIGURE 10 depicts an additional antibody construct comprising a first polypeptide comprising an immunoglobulin light chain; a second polypeptide comprising an immunoglobulin heavy chain; and a third polypeptide comprising an immunoglobulin Fc domain and a first sialidase enzyme, wherein a Fab fragment is conjugated to the N-terminus of the immunoglobulin heavy chain.
- the first and second polypeptides can be covalently linked together and the second and third polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- the third polypeptide comprises the sialidase and the immunoglobulin Fc domain in an N- to C- terminal orientation.
- the first polypeptide and the second polypeptide together define a first anti gen -binding site.
- the Fab fragment defines a second antigen-binding site.
- FIGURE 10 it is understood that an scFv, when present, may be replaced with a Fab fragment, or a Fab fragment, when present, may be replaced with an scFv.
- the Fc may optionally be modified in some manner.
- the antibody conjugate comprises a first polypeptide comprising a first immunoglobulin light chain; a second polypeptide comprising a first immunoglobulin heavy chain and a first sialidase; a third polypeptide comprising a second immunoglobulin heavy chain and a second sialidase; and a fourth polypeptide comprising a second immunoglobulin light chain.
- a first polypeptide comprising a first immunoglobulin light chain a second polypeptide comprising a first immunoglobulin heavy chain and a first sialidase
- a third polypeptide comprising a second immunoglobulin heavy chain and a second sialidase
- a fourth polypeptide comprising a second immunoglobulin light chain.
- the first and second polypeptides can be covalently linked together
- the third and fourth polypeptides can be covalently linked together
- the second and third polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- first polypeptide and the second polypeptide together define a first antigen binding site
- third polypeptide and the fourth polypeptide together define a second antigen-binding site
- the second and third polypeptides comprise the first and second immunoglobulin heavy chain and the first and second sialidase, respectively, in an N- to C-terminal orientation.
- the second and third polypeptides comprise the first and second immunoglobulin heavy chain and the first and second sialidase, respectively, in an N- to C-terminal orientation.
- polypeptides comprise the first and second sialidase and the first and second immunoglobulin heavy chain, respectively, in an N- to C-terminal orientation.
- the antibody conjugate comprises a first polypeptide comprising an immunoglobulin light chain; a second polypeptide comprising an
- the immunoglobulin heavy chain and a third polypeptide comprising an immunoglobulin Fc domain and a sialidase.
- FIGURE 11B An example of this embodiment is shown in FIGURE 11B.
- the first and second polypeptides can be covalently linked together and the second and third polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- the first polypeptide and the second polypeptide together define an antigen-binding site.
- the third polypeptide comprises the sialidase and the immunoglobulin Fc domain in an N- to C-terminal orientation, or the immunoglobulin Fc domain and the sialidase in an N- to C-terminal orientation.
- the first polypeptide comprises the amino acid sequence of SEQ ID NO: 66, or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO: 66.
- the second polypeptide comprises the amino acid sequence of SEQ ID NO: 67 or 189 or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO: 67 or 189.
- the third polypeptide comprises the amino acid sequence of any one of SEQ ID NOs: 68-74, 98-112, 150, 151, 155, 156, 160, 161, 185, 187, 192, or 195, or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOs: 68-74, 98-112, 150, 151, 155,
- the third polypeptide comprises the amino acid sequence of
- X2 is Ala or Lys
- X3 is Asn or Leu
- X4 is Pro or His
- X5 is Phe, Trp, Tyr or Val
- Xr is Lys or Asp
- X7 is Lys, Arg, or Glu.
- Xx is Lys, Ala, Arg, or Glu
- X9 is Leu or Met
- X10 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr
- Xu is Gin or His
- X12 is Arg or Lys
- Xi 3 is Ala
- X14 is Gly or Asp
- X15 is Gin or His
- X1 ⁇ 2 is Gin, Arg, or Lys
- X17 is Ala, Cys, He, Ser, Val, or Leu
- Xis is Gin or Leu
- X19 is Ala or Val
- X20 is Cys or Gly
- X21 is Ala or Gly
- X22 is Arg, lie, or Lys
- X23 is Ala, Cys, Leu, or Val
- X24 is Leu, Ala, or Val
- X25 is Thr or Ala
- X26 is Asp or Gly
- the third polypeptide comprises the amino acid sequence of
- Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Val, or not present
- X 2 is Phe, Trp, Tyr or Val
- X 3 is Lys or Asp
- X 4 is Pro, Asn, Asp
- X 5 is Ala, Glu, or Lys, Xr, is Arg, He, or Lys, X 7 is Gin, Ala, His, Phe, or Pro, Xs is Ser or Arg, X 9 is Trp or Lys, X 10 is Ala, Cys, Ser, or Val, Xu is Val or Arg, and X 12 is Leu, Gin, His, lie, Lys, or Ser, and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
- Xi is Ala, Asp, Met, or not present
- X 2 is Tyr or Val
- X 3 is Lys or Asp
- X 4 is Pro
- Asn Gly
- X 5 is Ala or Glu
- X 7 is Gin or Ala
- Xx is Ser or Arg
- X 9 is Trp or Lys
- X 10 is Ala or Cys
- X 11 is Val or Arg
- X 12 is Leu or He.
- the third polypeptide comprises the amino acid sequence of
- Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Val, or not present
- X 2 is Ala or Lys
- X 3 is Asn or Leu
- X 4 is Pro or His
- X 5 is Phe, Trp, Tyr or Val
- X 7 is Lys, Arg, or Glu.
- Xx is Lys, Ala, Arg, or Glu
- X 9 is Leu or Met
- X 10 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr
- Xu is Gin or His
- X 12 is Arg or Lys
- Xi 3 is Ala
- X 14 is Gly or Asp
- X 15 is Gin or His
- X1 ⁇ 2 is Gin, Arg, or Lys
- X 17 is Ala, Cys, He, Ser, Val, or Leu
- Xis is Gin or Leu
- X 19 is Ala or Val
- X 20 is Cys or Gly
- X 21 is Ala or Gly
- X 22 is Arg, He, or Lys
- X 23 is Ala, Cys, Leu, or Val
- X 24 is Leu, Ala, or Val
- X 25 is Thr or Ala
- X 26 is Asp or Gly
- X 2 is Phe, Trp, Tyr or Val
- X 3 is Lys or Asp
- X 4 is Pro, Asn
- X 5 is Ala, Glu, or Lys, Xr, is Arg, He, or Lys, X 7 is Gin, Ala,
- Xs is Ser or Arg
- X 9 is Trp or Lys
- X 10 is Ala
- Xu is Val or
- Arg is Leu, Gin, His, lie, Lys, or Ser
- X 13 is GGGGSGGGGS (SEQ ID NO: 145) or
- EPKSS (SEQ ID NO: 146), and the sialidase comprises at least one mutation relative to wild- type human Neu2 (SEQ ID NO: 1).
- Xi is Ala, Asp, Met, or not present
- X 2 is Tyr or Val
- X 3 is Lys or Asp
- X 4 is Pro
- X 5 is Ala or Glu
- C ⁇ is He or Lys
- X 7 is Gin or Ala
- Xs is Ser or Arg
- X 9 is Trp or Lys
- X 10 is Ala or Cys
- Xu is
- Val or Arg Val or Arg
- X 12 is Leu or He.
- the third polypeptide comprises the amino acid sequence of
- X 2 is Ala or Lys
- X 3 is Asn or Leu
- X 4 is Pro or His
- X 5 is Phe
- Trp Tyr or Val
- X 10 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, Xu is Gin or His, X 12 is Arg or
- Lys, Xi 3 is Asp or Pro
- X 14 is Ala, Glu or Lys
- X 15 is Gly or Asp
- X1 ⁇ 2 is Gin or His
- X 17 is Gin, Arg, or Lys
- Xis is Ala, Cys, lie, Ser, Val, or Leu
- X 19 is Gin, Leu, Glu, Phe, His, lie, Leu, or Tyr
- X 20 is Ala or Val
- X 21 is Cys or Gly
- X 22 is Arg or Pro
- X 23 is Ala or Gly
- X 24 is Arg, He, or Lys
- X 25 is Gin or Pro
- X 26 is Arg or Pro
- X 27 is Ala, Cys, Leu, or Val
- X 28 is Ala, Cys, Asn, Ser, or Thr
- X 29 is Leu, Ala, or Val
- X 30 is Glu or Pro
- X 31 is His or Pro
- X47 is Lys or Val
- X48 is Ala
- X49 is Cys, Leu, or Val
- X50 is Val or Arg
- X51 is Leu, Gin, His, He, Lys, or Ser
- X52 is GGGGS (SEQ ID NO: 184), GGGGSGGGGS (SEQ ID NO: 145), or EPKSS (SEQ ID NO: 146)
- the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
- the third polypeptide comprises the amino acid sequence of
- X 2 is Phe, Trp, Tyr or Val
- X 3 is Lys or Asp
- X 4 is Pro, Asn
- X5 is Ala, Glu, or Lys
- C ⁇ is Gin, Leu, Glu, Phe, His, He, Leu, or Tyr
- X7 IS Arg, He, or Lys
- Xs is Ala, Cys, Phe, Gly, His, He, Lys, Leu, Met, Asn, Gin,
- X 9 is Gin, Ala, His, Phe, Pro, Ser, or Thr
- X 10 is Ser, Arg, Ala
- Xu is Trp, Lys, Ala, Asp, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Gin, Thr, Val, Trp, or Tyr
- X 12 is Ala, Cys, Ser, or Val
- X 13 is Val or Arg
- X 14 is Leu, Gin, His, He, Lys, or Ser
- X 15 is GGGGS (SEQ ID NO: 184), GGGGSGGGGS (SEQ ID NO: 145), or EPKSS (SEQ ID NO: 146), and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
- Xi is Ala, Asp, Met, or not present
- X2 is Tyr or Val
- X3 is Lys or Asp
- X4 is Pro
- Asn Gly
- X5 is Ala or Glu
- C ⁇ is Gin or Tyr
- X7 is lie or Lys
- Xx is Ala or Thr
- X9 is Gin, Ala, or Thr
- X10 is Ser, Arg, or Ala
- Xu is Trp, Lys, or Arg
- X12 is Ala or Cys
- X13 is Val or Arg
- X14 is Leu or He.
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO: 68.
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO: 69.
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO: 70.
- the first polypeptide comprises SEQ ID NO: 66, the second polypeptide comprises SEQ ID NO: 67, and the third polypeptide comprises SEQ ID NO: 71. In certain embodiments, the first polypeptide comprises SEQ ID NO: 66, the second polypeptide comprises SEQ ID NO: 67, and the third polypeptide comprises SEQ ID NO: 72. In certain embodiments, the first polypeptide comprises SEQ ID NO: 66, the second polypeptide comprises SEQ ID NO: 67, and the third polypeptide comprises SEQ ID NO: 73. In certain embodiments, the first polypeptide comprises SEQ ID NO: 66, the second polypeptide comprises SEQ ID NO: 67, and the third polypeptide comprises SEQ ID NO: 74.
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO: 98.
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO: 99.
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO: 104.
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO: 104.
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66
- the second polypeptide comprises SEQ ID NO: 67
- the third polypeptide comprises SEQ ID NO:
- the first polypeptide comprises SEQ ID NO: 66, the second polypeptide comprises SEQ ID NO: 67, and the third polypeptide comprises SEQ ID NO: 192. In certain embodiments, the first polypeptide comprises SEQ ID NO: 66, the second polypeptide comprises SEQ ID NO: 67, and the third polypeptide comprises SEQ ID NO: 195. In certain embodiments, the first polypeptide comprises SEQ ID NO: 66, the second polypeptide comprises SEQ ID NO: 189, and the third polypeptide comprises SEQ ID NO: 185. In certain embodiments, the first polypeptide comprises SEQ ID NO: 66, the second polypeptide comprises SEQ ID NO: 189, and the third polypeptide comprises SEQ ID NO: 187.
- the antibody conjugate comprises a first polypeptide comprising a first sialidase, a first immunoglobulin Fc domain, and a first single chain variable fragment (scFv) (it is also understood that the scFv may be replaced by a first polypeptide chain of an immunoglobulin antigen binding fragment, e.g ., Fab fragment); and a second polypeptide comprising a second sialidase, a second immunoglobulin Fc domain, and a second single chain variable fragment (scFv) (it is also understood that the scFv may be replaced by a second polypeptide chain of an immunoglobulin antigen binding fragment, e.g. , Fab fragment).
- scFv single chain variable fragment
- the first and second polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- the first scFv defines a first antigen-binding site
- the second scFv defines a second antigen-binding site.
- the first polypeptide comprises the first sialidase, the first immunoglobulin Fc domain, and the first scFv in an N- to C-terminal orientation.
- the first polypeptide comprises the first scFv, the first immunoglobulin Fc domain, and the first sialidase in an N- to C-terminal orientation.
- the second polypeptide comprises the second sialidase, the second immunoglobulin Fc domain, and the second scFv in an N- to C- terminal orientation. In certain embodiments, the second polypeptide comprises the second scFv, the second immunoglobulin Fc domain, and the second sialidase in an N- to C-terminal orientation.
- the first polypeptide comprises the amino acid sequence of any one of SEQ ID NOs: 77-83, 166-178, 194, or 197, or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOs: 77-83, 166-178, 194, or 197.
- the second polypeptide comprises the amino acid sequence of any one of SEQ ID NOs: 77-83, 166-178, 194, or 197, or an amino acid sequence that has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOs: 77-83, 166-178, 194, or 197.
- the first and/or second polypeptide comprises the amino acid sequence of X1X2SX3X4X5LQX6ESVFQSGAHAYRI PALLYLPGQQSLLAFAEQRASX7X8DEHAEL IVX9RR GDYDAX 10 THQVQWX 11 AQEWAQAX 12 LDGHRSMNPCPLYDX 13 QTGTLFLFFIAI PX 14 X 15 VT EX 16 QQLQTRANVTRLX 17 X 18 VTSTDHGRTWS S PRDLTDAAI GPX 19 YREWS T FAVGPGHX 20 L QLHDRX 21 RSLWPAYAYRKLHPX 22 QRP I PSAFX 23 FLSHDHGRTWARGHFVAQDTX 24 ECQVA EVETGEQRWTLNARSHLRARVQAQSX 25 NX 26 GLDFQX 27 SQLVKKLVEPPPX 28 GX 29 QGSVI S FPS PRSGPGS PAQX30LLY
- X 2 is Ala or Lys
- X 3 is Asn or Leu
- X 4 is Pro or His
- X 5 is Phe, Trp
- C ⁇ is Lys or Asp
- X 7 is Lys, Arg, or Glu
- Xs is Lys, Ala, Arg, or Glu
- X 9 is Leu or
- X 10 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, Xu is Gin or His, X 12 is Arg or Lys, X 13 is Ala, Glu or Lys, X 14 is Gly or Asp, X 15 is Gin or His, X1 ⁇ 2 is Gin, Arg, or Lys, X 17 is Ala,
- Cys lie, Ser, Val, or Leu
- Xis is Gin or Leu
- X 19 is Ala or Val
- X 20 is Cys or Gly
- X 21 is Ala or
- X 22 is Arg, lie, or Lys
- X 23 is Ala, Cys, Leu, or Val
- X 24 is Leu, Ala, or Val
- X 25 is Thr or
- X 26 is Asp or Gly
- X 27 is Glu or Lys
- X 28 is Gin, Ala, His, Phe, or Pro
- X 29 is Cys or Val
- X 30 is Trp or Arg
- X 31 is Ser or Arg
- X 32 is Trp or Lys
- X 33 is Lys or Val
- X 34 is Ala, Cys, Ser, or Val
- X 35 is Cys, Leu, or Val
- X 36 is Val or Arg
- X 37 is Leu, Gin, His, He, Lys, or Ser
- the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID
- the first and/or second polypeptide comprises the amino acid sequence of
- Xi is Ala, Arg, Asn, Asp, Gin, Glu, Gly, His, Leu, Lys, Met, Phe, Thr, Val, or not present
- X 2 is Phe, Trp, Tyr or Val
- X 3 is Lys or Asp
- X 4 is Pro, Asn, Asp
- X 5 is Ala, Glu, or Lys, C ⁇ is Arg, He, or Lys, X 7 is Gin, Ala, His, Phe, or Pro, Xs is Ser or Arg, X 9 is Trp or Lys, X 10 is Ala, Cys, Ser, or Val, Xu is Val or Arg, and X 12 is Leu, Gin, His, lie, Lys, or Ser, and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
- Xi is Ala, Asp, Met, or not present
- X 2 is Tyr or Val
- X 3 is Lys or Asp
- X 4 is Pro
- Asn Gly
- X 5 is Ala or Glu
- C ⁇ He or Lys
- X 7 is Gin or Ala
- Xs is Ser or Arg
- X 9 is Trp or Lys
- X 10 is Ala or Cys
- X 11 is Val or Arg
- X 12 is Leu or He.
- the first and/or second polypeptide comprises the amino acid sequence of
- X 2 is Ala or Lys
- X 3 is Asn or Leu
- X 4 is Pro or His
- X 5 is Phe
- Trp, Tyr or Val is Lys or Asp
- X 7 is Lys, Arg, or Glu
- Xx is Lys, Ala, Arg, or Glu
- X 9 is
- X 10 is Pro, Asn, Asp, His, Glu, Gly, Ser or Thr, Xu is Gin or His, X 12 is Arg or
- Lys Xi 3 is Asp or Pro
- X 14 is Ala
- Glu or Lys X 15 is Gly or Asp
- X1 ⁇ 2 is Gin or His
- X 17 is Gin, Arg, or Lys
- Xis is Ala
- X 19 is Gin, Leu, Glu, Phe, His, He, Leu, or
- X 20 is Ala or Val
- X 21 is Cys or Gly
- X 22 is Arg or Pro
- X 23 is Ala or Gly
- X 24 is Arg, He, or Lys
- X 25 is Gin or Pro
- X 26 is Arg or Pro
- X 27 is Ala, Cys, Leu, or Val
- X 28 is Ala, Cys, Asn
- X 29 is Leu, Ala, or Val
- X 30 is Glu or Pro
- X 31 is His or Pro
- X 32 is Leu, Asp, Asn, or Tyr
- X33 is Arg, Ala, Asp, Leu, Gin, or Tyr
- X34 is Ala
- X35 is Val, He, or Lys
- X36 is Thr or Ala
- X37 is Asp or Gly
- X38 is Glu, Lys, or Pro
- X39 is Ser or Cys
- X40 is Leu, Asp, Phe, Gin, or Thr
- X41 is Val or Phe
- X42 is Gin, Ala, His, Phe, Pro, Ser, or Thr
- X43 is Cys or Val
- X44 is Trp or Arg
- X47 is Lys or Val
- X48 is Ala
- X49 is Cys, Leu, or Val
- X50 is Val or Arg
- X51 is Leu, Gin, His, He, Lys, or Ser
- X52 is GGGGS (SEQ ID NO: 184), GGGGSGGGGS (SEQ ID NO: 145), or EPKSS (SEQ ID NO: 146)
- the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
- the first and/or second polypeptide comprises the amino acid sequence of
- X2 is Phe, Trp, Tyr or Val
- X3 is Lys or Asp
- X4 is Pro, Asn
- X5 is Ala, Glu, or Lys
- C ⁇ is Gin, Leu, Glu, Phe, His, He, Leu, or Tyr
- X7 IS Arg, He, or Lys
- Xs is Ala, Cys, Phe, Gly, His, He, Lys, Leu, Met, Asn, Gin,
- X9 is Gin, Ala, His, Phe, Pro, Ser, or Thr
- X10 is Ser, Arg, Ala
- Xu is Trp, Lys, Ala, Asp, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Gin, Thr, Val, Trp, or Tyr
- X12 is Ala, Cys, Ser, or Val
- X13 is Val or Arg
- X14 is Leu, Gin, His, He, Lys, or Ser
- X15 is GGGGS (SEQ ID NO: 184), GGGGSGGGGS (SEQ ID NO: 145), or EPKSS (SEQ ID NO: 146), and the sialidase comprises at least one mutation relative to wild-type human Neu2 (SEQ ID NO: 1).
- Xi is Ala, Asp, Met, or not present
- X2 is Tyr or Val
- X3 is Lys or Asp
- X4 is Pro
- Asn Gly
- X5 is Ala or Glu
- C ⁇ is Gin or Tyr
- X7 is lie or Lys
- Xx is Ala or Thr
- X9 is Gin, Ala, or Thr
- X10 is Ser, Arg, or Ala
- Xu is Trp, Lys, or Arg
- X12 is Ala or Cys
- X13 is Val or Arg
- X14 is Leu or He.
- the first and second polypeptide comprise SEQ ID NO: 77. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 78. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 79. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 80. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 81. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 82. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 83. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 166. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 167.
- the first and second polypeptide comprise SEQ ID NO: 168. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 169. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 170. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 171. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 172. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 173. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 174. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 175. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 176.
- the first and second polypeptide comprise SEQ ID NO: 177. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 178. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 194. In certain embodiments, the first and second polypeptide comprise SEQ ID NO: 197.
- the antibody conjugate comprises: a first polypeptide comprising an immunoglobulin light chain; a second polypeptide comprising an
- immunoglobulin heavy chain and a single chain variable fragment (scFv) (it is also understood that the scFv may be replaced by a first polypeptide chain of an immunoglobulin antigen binding fragment, e.g ., Fab fragment); and a third polypeptide comprising an immunoglobulin Fc domain and a sialidase.
- scFv single chain variable fragment
- FIGURE 11D An example of this embodiment is shown in FIGURE 11D.
- the first and second polypeptides can be covalently linked together and the second and third polypeptides can be covalently linked together.
- the covalent linkages can be disulfide bonds.
- the first polypeptide and the second polypeptide together define a first antigen-binding site (i.e., the immunoglobulin light chain and immunoglobulin heavy chain together define a first antigen-binding site).
- the scFv defines a second antigen-binding site.
- the second polypeptide comprises the immunoglobulin heavy chain and the scFv in an N- to C- terminal orientation, or the scFv and the immunoglobulin heavy chain in an N- to C-terminal orientation.
- the third polypeptide comprises the sialidase and the immunoglobulin Fc domain in an N- to C-terminal orientation, or the sialidase and the immunoglobulin Fc domain in an N- to C-terminal orientation.
- the antibody conjugate has a molecular weight from about 135 kDa to about 165 kDa, e.g., about 140 kDa. In other embodiments, the antibody conjugate has a molecular weight from about 215 kDa to about 245 kDa, e.g, about 230 kDa.
- the antibody conjugate comprises two polypeptides that each comprise an immunoglobulin Fc domain, and the first polypeptide has either a“knob” mutation, e.g., T366Y, or a“hole” mutation, e.g., Y407T, for heterodimerization with the second polypeptide, and the second polypeptide has either a respective“knob” mutation, e.g, T366Y, or a“hole” mutation, e.g, Y407T, for heterodimerization with the first polypeptide (residue numbers according to EU numbering, Kabat, E.A., et al. (1991) supra).
- a“knob” mutation e.g., T366Y
- a“hole” mutation e.g., Y407T
- the antibody comprises two polypeptides that each comprise an immunoglobulin Fc domain derived from human IgGl Fc domain, and the first polypeptide comprises a Y407T mutation (e.g, the first polypeptide comprises SEQ ID NO: 32 or SEQ ID NO: 147), and the second polypeptide comprises a T366Y mutation (e.g, the second polypeptide comprises SEQ ID NO: 33 or SEQ ID NO: 148).
- the term“multispecific antibody” is understood to mean an antibody that specifically binds to at least two different antigens, i.e., an antibody that comprises at least two antigen-binding sites that bind to at least two different antigens.
- the term“bispecific antibody” is understood to mean an antibody that specifically binds to two different antigens, i.e., an antibody that comprises two antigen binding sites each of which bind to separate and distinct antigens. In other words, a first binding site binds a first antigen and a second binding site binds a second, different antigen.
- a multispecific or bispecific antibody may, for example, be a human or humanized antibody, and/or be a full length antibody or an antibody fragment ( e.g ., a F(ab’) 2 bispecific antibody).
- the present invention encompasses antibody conjugates comprising antibody fragments, which may be generated by traditional means, such as enzymatic digestion, or by recombinant techniques.
- traditional means such as enzymatic digestion, or by recombinant techniques.
- recombinant techniques For a review of certain antibody fragments, see Hudson et al.
- the antibody conjugate or fusion protein can be covalently or non-covalently associated with a biological modifier, wherein the biological modifier can be used to enhance the solubility of the antibody, increase binding specificity, decrease immunogenicity or toxicity or modify the pharmacokinetic profile of the antibody.
- the biological modifier can be used to increase the molecular weight of the antibody to increase its circulating half-life.
- the antibody conjugate or fusion protein may be covalently bound to one or more (for example, 2, 3, 4, 5, 6, 8, 9, 10 or more) biological modifiers that may comprise linear or branched polymers.
- biological modifiers may include, for example, a variety of polymers, such as those described in U.S. Patent No. 7,842,789.
- polyalkylene ethers such as polyethylene glycol (PEG) and derivatives thereof (for example, alkoxy polyethylene glycol, for example, methoxypolyethylene glycol, ethoxypolyethylene glycol and the like); block copolymers of polyoxyethylene and polyoxypropylene (Pluronics); polymethacrylates; carbomers; and branched or unbranched polysaccharides which comprise the saccharide monomers such as D-mannose, D- and L- galactose, fucose, fructose, D-xylose, L-arabinose, and D-glucuronic acid.
- PEG polyethylene glycol
- derivatives thereof for example, alkoxy polyethylene glycol, for example, methoxypolyethylene glycol, ethoxypolyethylene glycol and the like
- polymethacrylates such as D-mannose, D- and L- galactose
- the biological modifier can be a hydrophilic polyvinyl polymer such as polyvinyl alcohol and polyvinylpyrrolidone (PVP)-type polymers.
- the biological modifier can be a functionalized polyvinylpyrrolidone, for example, carboxy or amine functionalized on one (or both) ends of the polymer (as available from
- the biological modifier can include Poly N-(2- hydroxypropyl)methacrylamide (HPMA), or functionalized HPMA (amine, carboxy, etc.), Poly(N-isopropylacrylamide) or functionalized poly(N-isopropylacrylamide).
- the biological modifier can include Poly N-(2-hydroxypropyl)methacrylamide (HPMA), or functionalized HPMA (amine, carboxy, etc.), Poly(N-isopropylacrylamide) or functionalized poly(N-isopropylacrylamide).
- the modifier prior to conjugation need not be, but preferably is, water soluble, but the final conjugate should be water soluble.
- the biological modifier may have a molecular weight from about 2 kDa to about 5 kDa, from about 2 kDa to about 10 kDa, from about 2 kDa to about 20 kDa, from about 2 kDa to about 30 kDa, from about 2 kDa to about 40 kDa, from about 2 kDa to about 50 kDa, from about 2 kDa to about 60 kDa, from about 2 kDa to about 70 kDa, from about 2 kDa to about 80 kDa, from about 2 kDa to about 90 kDa, from about 2 kDa to about 100 kDa, from about 2 kDa to about 150 kDa, from about 5 kDa to about 10 kDa, from about 5 kDa to about 20 kDa, from about 5 kDa to about 30 kDa, from about 5 kDa to about 40 k
- the antibody conjugate or fusion protein is attached to about 10 or fewer polymer molecules ( e.g ., 9, 8, 7, 6, 5, 4, 3, 2, or 1), each polymer molecule having a molecular weight of at least about 20,000 D, or at least about 30,000 D, or at least about 40,000 D.
- the antibody conjugates or fusion proteins described herein may be attached to polyethylene glycol (PEG) polymers.
- PEG polyethylene glycol
- the antibody conjugate or fusion protein described herein is covalently attached to at least one PEG having an actual MW of at least about 20,000 D.
- the antibody conjugate or fusion protein described herein is covalently attached to at least one PEG having an actual MW of at least about 30,000 D.
- the antibody conjugate or fusion protein described herein is covalently attached to at least one PEG having an actual MW of at least about 40,000 D.
- the PEG is methoxyPEG(5000)- succinimidylpropionate (mPEG-SPA), methoxyPEG(5000)-succinimidylsuccinate (mPEG- SS).
- mPEG-SPA methoxyPEG(5000)- succinimidylpropionate
- mPEG-SS methoxyPEG(5000)-succinimidylsuccinate
- PEGS are commercially available from Nektar Therapeutics or SunBiowest.
- Attachment sites on an antibody conjugate or fusion protein for a biological modifier include the N-terminal amino group and epsilon amino groups found on lysine residues, as well as other amino, imino, carboxyl, sulfhydryl, hydroxyl or other hydrophilic groups.
- the polymer may be covalently bonded directly to the antibody conjugate or fusion protein with or without the known use of a multifunctional (ordinarily bifunctional) crosslinking agent using chemistries and used in the art.
- sulfhydryl groups can be derivatized by coupling to maleimido-substituted PEG (e.g.
- sequences of the antibodies can be cloned from
- variable regions of interest can be ligated to other appropriate nucleotide sequences, including, for example, constant region coding sequences, and expression control sequences, to produce conventional gene expression constructs (i.e., expression vectors) encoding the desired antibodies. Production of defined gene constructs is within routine skill in the art.
- Nucleic acids encoding desired recombinant human sialidases, fusion proteins, and/or antibody conjugates can be incorporated (ligated) into expression vectors, which can be introduced into host cells through conventional transfection or transformation techniques.
- Exemplary host cells are E. coli cells, Chinese hamster ovary (CHO) cells, human embryonic kidney 293 (HEK 293) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g ., Hep G2), and myeloma cells that do not otherwise produce IgG protein.
- Transformed host cells can be grown under conditions that permit the host cells to express the genes that encode the immunoglobulin light and/or heavy chain variable regions.
- a gene is to be expressed in E. coli , it is first cloned into an expression vector by positioning the engineered gene downstream from a suitable bacterial promoter, e.g., Trp or Tac, and a prokaryotic signal sequence.
- the expressed protein may be secreted.
- the expressed protein may accumulate in refractile or inclusion bodies, which can be harvested after disruption of the cells by French press or sonication.
- the refractile bodies then are solubilized, and the protein may be refolded and/or cleaved by methods known in the art.
- the engineered gene is to be expressed in eukaryotic host cells, e.g, CHO cells, it is first inserted into an expression vector containing a suitable eukaryotic promoter, a secretion signal, a poly A sequence, and a stop codon.
- the vector or gene construct may contain enhancers and introns.
- the expression vector optionally contains sequences encoding all or part of a constant region, enabling an entire, or a part of, a heavy or light chain to be expressed.
- the gene construct can be introduced into eukaryotic host cells using conventional techniques.
- the host cells express a recombinant human sialidase or a fusion protein and/or antibody conjugate comprising a sialidase and VL or VH fragments, VL-VH heterodimers, VH- VL or VL-VH single chain polypeptides, complete heavy or light immunoglobulin chains, or portions thereof, each of which may be attached to a moiety having another function (e.g ., cytotoxicity).
- a recombinant human sialidase or a fusion protein and/or antibody conjugate comprising a sialidase and VL or VH fragments, VL-VH heterodimers, VH- VL or VL-VH single chain polypeptides, complete heavy or light immunoglobulin chains, or portions thereof, each of which may be attached to a moiety having another function (e.g ., cytotoxicity).
- a host cell is transfected with a single vector expressing a polypeptide expressing a sialidase and an entire, or part of, a heavy chain (e.g., a heavy chain variable region) or a sialidase and a light chain (e.g, a light chain variable region), or a polypeptide expressing an entire, or part of, a heavy chain (e.g, a heavy chain variable region) or a light chain (e.g, a light chain variable region).
- a heavy chain e.g., a heavy chain variable region
- a light chain e.g., a light chain variable region
- a host cell is transfected with a single vector encoding (a) a polypeptide comprising a heavy chain variable region and a polypeptide comprising a light chain variable region, or (b) an entire immunoglobulin heavy chain and an entire immunoglobulin light chain, wherein in (a) or in (b), the polypeptide may also comprise a sialidase.
- a host cell is co-transfected with more than one expression vector (e.g, one expression vector expressing a polypeptide comprising an entire, or part of, a heavy chain or heavy chain variable region, optionally comprising a sialidase fused thereto, and another expression vector expressing a polypeptide comprising an entire, or part of, a light chain or light chain variable region, optionally comprising a sialidase fused thereto).
- more than one expression vector e.g, one expression vector expressing a polypeptide comprising an entire, or part of, a heavy chain or heavy chain variable region, optionally comprising a sialidase fused thereto, and another expression vector expressing a polypeptide comprising an entire, or part of, a light chain or light chain variable region, optionally comprising a sialidase fused thereto.
- a polypeptide comprising a sialidase or a fusion protein e.g, a fusion protein comprising an immunoglobulin heavy chain variable region or light chain variable region
- a polypeptide can be produced by growing (culturing) a host cell transfected with an expression vector encoding such a variable region, under conditions that permit expression of the polypeptide.
- the polypeptide can be harvested and purified or isolated using techniques known in the art, e.g, affinity tags such as glutathione-S-transferase (GST) or histidine tags.
- GST glutathione-S-transferase
- a sialidase fused to a monoclonal antibody, Fc domain, or an antigen-binding domain of the antibody can be produced by growing (culturing) a host cell transfected with: (a) an expression vector that encodes a complete or partial immunoglobulin heavy chain, and a separate expression vector that encodes a complete or partial immunoglobulin light chain; or (b) a single expression vector that encodes both chains ( e.g ., complete or partial heavy and light chains), under conditions that permit expression of both chains.
- the sialidase will be fused to one or more of the chains.
- the intact fusion protein and/or antibody conjugate can be harvested and purified or isolated using techniques known in the art, e.g., Protein A, Protein G, affinity tags such as glutathione-S-transferase (GST) or histidine tags. It is within ordinary skill in the art to express the heavy chain and the light chain from a single expression vector or from two separate expression vectors.
- a native N-terminal signal sequence of the protein is replaced, e.g, with MDMRVPAQLLGLLLLWLPGARC (SEQ ID NO: 28).
- an N-terminal signal sequence e.g, MDMRVPAQLLGLLLLWLPGARC (SEQ ID NO: 28)
- Additional exemplary N-terminal signal sequences include signal sequences from
- a protein e.g, a recombinant human sialidase, as a secreted protein, a C terminal lysosomal signal motif, e.g, YGTL (SEQ ID NO: 29) is removed.
- the antibodies are to be administered to a human, the antibodies preferably are“humanized” to reduce or eliminate antigenicity in humans.
- each humanized antibody has the same or substantially the same affinity for the antigen as the non-humanized mouse antibody from which it was derived.
- chimeric proteins are created in which mouse immunoglobulin constant regions are replaced with human immunoglobulin constant regions. See, e.g., Morrison et al, 1984, PROC. NAT. ACAD. SCI. 81 :6851-6855, Neuberger et al, 1984, NATURE 312:604-608; U.S. Patent Nos. 6,893,625 (Robinson); 5,500,362 (Robinson); and 4,816,567 (Cabilly).
- the CDRs of the light and heavy chain variable regions are grafted into frameworks from another species.
- murine CDRs can be grafted into human FRs.
- the CDRs of the light and heavy chain variable regions of an antibody are grafted into human FRs or consensus human FRs.
- consensus human FRs FRs from several human heavy chain or light chain amino acid sequences are aligned to identify a consensus amino acid sequence. CDR grafting is described in U.S. Patent Nos.
- human CDR sequences are chosen from human germline genes, based on the structural similarity of the human CDRs to those of the mouse antibody to be humanized. See, e.g ., U.S. Patent No. 6,881,557 (Foote); and Tan et al. , 2002, J. IMMUNOL. 169: 1 1 19-1 125.
- ACTIVMAB TM technology
- Vaccinex, Inc., Rochester, NY which involves a vaccinia virus-based vector to express antibodies in mammalian cells.
- High levels of combinatorial diversity of IgG heavy and light chains can be produced. See, e.g. , U.S. Patent Nos. 6,706,477 (Zauderer); 6,800,442 (Zauderer); and 6,872,518 (Zauderer).
- Another approach for converting a mouse antibody into a form suitable for use in humans is technology practiced commercially by KaloBios Pharmaceuticals, Inc. (Palo Alto, CA).
- This technology involves the use of a proprietary human“acceptor” library to produce an“epitope focused” library for antibody selection.
- Another approach for modifying a mouse antibody into a form suitable for medical use in humans is HUMAN ENGINEERING TM technology, which is practiced commercially by XOMA (US) LLC. See, e.g. , International (PCT) Publication No. WO 93/11794 and U.S. Patent Nos. 5,766,886 (Studnicka); 5,770,196 (Studnicka); 5,821,123 (Studnicka); and 5,869,619 (Studnicka).
- Any suitable approach including any of the above approaches, can be used to reduce or eliminate human immunogenicity of an antibody.
- Fully human mAbs lacking any non-human sequences can be prepared from human immunoglobulin transgenic mice by techniques referenced in, e.g., Lonberg et al., NATURE 368:856-859,
- Fully human monoclonal antibodies can also be prepared and optimized from phage display libraries by techniques referenced in, e.g. , Knappik et al. , J. MOL. BIOL. 296:57-86, 2000; and Krebs et al., J. IMMUNOL. METH. 254:67- 84 2001).
- the present invention encompasses fusion proteins comprising antibody fragments, which may be generated by traditional means, such as enzymatic digestion, or by
- F(ab’) 2 fragments can be isolated directly from recombinant host cell culture.
- Fab and F(ab’) 2 fragments with increased in vivo half-life comprising salvage receptor binding epitope residues are described in U.S. Patent No. 5,869,046.
- Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
- an antibody is a single chain Fv fragment (scFv). See U.S. Patent Nos. 5,571,894 and 5,587,458.
- Methods for making bispecific antibodies are known in the art. See Milstein and Cuello (1983) NATURE 305:537, International (PCT) Publication No.
- Bispecific antibodies include cross-linked or“heteroconjugate” or“heterodimer” antibodies.
- one of the antibodies in the heterodimer can be coupled to avidin, the other to biotin.
- Heterodimer antibodies may be made using any convenient cross-linking method. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Patent No. 4,676,980, along with a number of cross-linking techniques.
- heterodimeric or asymmetric IgG-like molecules include but are not limited to those obtained with the following technologies or using the following formats: Triomab/Quadroma, Knobs-into-Holes, CrossMabs, electrostatically-matched antibodies, LUZ-Y, Strand Exchange Engineered Domain body, Biclonic and DuoBody.
- Advantages of using antibody fragments include the elimination of non-specific binding between Fc portions of antibodies and Fc receptors on cells (such as macrophages, dendritic cells, neutrophils, NK cells and B cells). In addition, they may be able to penetrate tissues more efficiently due to their smaller size.
- Heterodimeric antibodies, or asymmetric antibodies allow for greater flexibility and new formats for attaching a variety of drugs to the antibody arms.
- One of the general formats for creating a heterodimeric antibody is the“knobs-into-holes” format. This format is specific to the heavy chain part of the constant region in antibodies. The“knobs” part is engineered by replacing a small amino acid with a larger one, which fits into a“hole”, which is engineered by replacing a large amino acid with a smaller one. What connects the“knobs” to the“holes” are the disulfide bonds between each chain. The“knobs-into-holes” shape facilitates antibody dependent cell mediated cytotoxicity.
- Single chain variable fragments are connected to the variable domain of the heavy and light chain via a short linker peptide.
- the linker is rich in glycine, which gives it more flexibility, and serine/threonine, which gives it specificity.
- Two different scFv fragments can be connected together, via a hinge region, to the constant domain of the heavy chain or the constant domain of the light chain. This gives the antibody bispecificity, allowing for the binding specificities of two different antigens.
- The“knobs-into-holes” format enhances heterodimer formation but doesn’t suppress homodimer formation. [00216]
- PCT International
- the CEE domain of the first heavy chain and the CEE domain of the second heavy chain are both engineered in a complementary manner so that the heavy chain comprising one engineered CEE domain can no longer homodimerize with another heavy chain of the same structure (e.g.
- a CEE-engineered first heavy chain can no longer homodimerize with another CEE-engineered first heavy chain; and a CEE-engineered second heavy chain can no longer homodimerize with another CEE-engineered second heavy chain).
- the heavy chain comprising one engineered CEE domain is forced to heterodimerize with another heavy chain comprising the CEE domain, which is engineered in a complementary manner.
- the CEE domain of the first heavy chain and the CEE domain of the second heavy chain are engineered in a complementary manner by amino acid substitutions, such that the first heavy chain and the second heavy chain are forced to heterodimerize, whereas the first heavy chain and the second heavy chain can no longer homodimerize (e.g, for steric reasons).
- a recombinant human sialidase or a fusion protein and/or antibody conjugate thereof preferably is combined with a pharmaceutically acceptable carrier.
- pharmaceutically acceptable refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- compositions also can include stabilizers and preservatives.
- carriers, stabilizers and adjuvants see, e.g, Martin,
- Pharmaceutically acceptable carriers include buffers, solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, that are compatible with
- a pharmaceutical composition may contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
- suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin); fillers;
- amino acids such as glycine, glutamine, asparagine, arginine or lysine
- antimicrobials such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite
- buffers such as borate, bicarbon
- polyvinylpyrrolidone low molecular weight polypeptides
- salt-forming counterions such as sodium
- preservatives such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide
- solvents such as glycerin, propylene glycol or polyethylene glycol
- sugar alcohols such as mannitol or sorbitol
- suspending agents such as pluronics, PEG, sorbitan esters, polysorbates such as polysorbate 20, polysorbate, triton, tromethamine, lecithin, cholesterol, tyloxapal
- stability enhancing agents such as sucrose or sorbitol
- tonicity enhancing agents such as alkali metal halides, preferably sodium or potassium chloride, mannitol sorbitol
- a pharmaceutical composition may contain nanoparticles, e.g., polymeric nanoparticles, liposomes, or micelles (See Anselmo et al. (2016) BIOENG. TRANSL. MED. 1 : 10-29).
- a pharmaceutical composition may contain a sustained- or controlled-delivery formulation.
- sustained- or controlled-delivery formulation Techniques for formulating sustained- or controlled- delivery means, such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art.
- Sustained-release preparations may include, e.g. , porous polymeric microparticles or semipermeable polymer matrices in the form of shaped articles, e.g, films, or microcapsules.
- Sustained release matrices may include polyesters, hydrogels, polylactides, copolymers of L-glutamic acid and gamma ethyl -L- glutamate, poly (2-hydroxyethyl-inethacrylate), ethylene vinyl acetate, or poly-D(-)-3- hydroxybutyric acid.
- Sustained release compositions may also include liposomes that can be prepared by any of several methods known in the art.
- compositions containing a recombinant human sialidase, a recombinant human sialidase fusion protein, or an antibody conjugate disclosed herein can be presented in a dosage unit form and can be prepared by any suitable method.
- compositions should be formulated to be compatible with its intended route of administration.
- routes of administration are intravenous (IV), intradermal, inhalation, transdermal, topical, transmucosal, intrathecal and rectal administration.
- IV intravenous
- a recombinant human sialidase, a recombinant human sialidase fusion protein, or an antibody conjugate disclosed herein is administered by IV infusion.
- a recombinant human sialidase, a recombinant human sialidase fusion protein, or an antibody conjugate disclosed herein is administered by intratumoral injection.
- Useful formulations can be prepared by methods known in the pharmaceutical art. For example, see Remington’s Pharmaceutical Sciences, 18th ed. (Mack Publishing Company, 1990).
- Formulation components suitable for parenteral administration include a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as EDTA; buffers such as acetates, citrates or phosphates; and agents for the adjustment of tonicity such as sodium chloride or dextrose.
- a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents
- antibacterial agents such as benzyl alcohol or methyl parabens
- antioxidants such as ascorbic acid or sodium bisulfite
- chelating agents such as EDTA
- buffers such as acetates, citrates or phosphates
- suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, NJ) or phosphate buffered saline (PBS).
- the carrier should be stable under the conditions of manufacture and storage, and should be preserved against microorganisms.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol), and suitable mixtures thereof.
- a pharmaceutical composition may contain a stabilizing agent.
- the stabilizing agent is a cation, such as a divalent cation.
- the cation is calcium or magnesium.
- the cation can be in the form of a salt, such as calcium chloride (CaCh) or magnesium chloride (MgCh).
- the stabilizing agent is present in an amount from about 0.05 mM to about 5 mM.
- the stabilizing agent may be present in an amount of from about 0.05 mM to about 4 mM, from about 0.05 mM to about 3 mM, from about 0.05 mM to about 2 mM, from about 0.05 mM to about 1 mM, from about 0.05 mM to about 0.5 mM, from about 0.5 mM to about 4 mM, from about 0.5 mM to about 3 mM, from about 0.5 mM to about 2 mM, from about 0.5 mM to about 1 mM, from about 1 mM to about 4 mM, from about 1 mM to about 3 mM, of from about 1 mM to about 2 mM.
- compositions preferably are sterile. Sterilization can be
- composition is lyophilized
- filter sterilization can be conducted prior to or following lyophilization and reconstitution.
- compositions described herein may be administered locally or systemically. Administration will generally be parenteral administration. In a preferred embodiment, the pharmaceutical composition is administered subcutaneously and in an even more preferred embodiment intravenously. Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
- a therapeutically effective amount of active component for example, a recombinant human sialidase or fusion protein and/or antibody conjugate thereof, is in the range of 0.1 mg/kg to 100 mg/kg, e.g. , 1 mg/kg to 100 mg/kg, 1 mg/kg to 10 mg/kg.
- the amount administered will depend on variables such as the type and extent of disease or indication to be treated, the overall health of the patient, the in vivo potency of the antibody, the pharmaceutical formulation, and the route of administration.
- the initial dosage can be increased beyond the upper level in order to rapidly achieve the desired blood-level or tissue- level. Alternatively, the initial dosage can be smaller than the optimum, and the daily dosage may be progressively increased during the course of treatment.
- Human dosage can be optimized, e.g ., in a conventional Phase I dose escalation study designed to run from 0.5 mg/kg to 20 mg/kg.
- Dosing frequency can vary, depending on factors such as route of administration, dosage amount, serum half-life of the recombinant human sialidase or fusion protein and/or antibody conjugate thereof, and the disease being treated. Exemplary dosing frequencies are once per day, once per week and once every two weeks.
- a preferred route of administration is parenteral, e.g. , intravenous infusion.
- a recombinant human sialidase or a fusion protein and/or antibody conjugate thereof is lyophilized, and then reconstituted in buffered saline, at the time of administration.
- compositions and methods disclosed herein can be used to treat various forms of cancer in a subject or inhibit cancer growth in a subject.
- the invention provides a method of treating a cancer in a subject.
- the method comprises administering to the subject an effective amount of a recombinant human sialidase or a fusion protein and/or antibody conjugate thereof, e.g, a recombinant human sialidase, fusion protein, or antibody conjugate disclosed herein, either alone or in a combination with another therapeutic agent to treat the cancer in the subject.
- the term“effective amount” as used herein refers to the amount of an active agent (e.g, recombinant human sialidase or fusion protein thereof according to the present invention) sufficient to effect beneficial or desired results.
- An effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.
- “treat”,“treating” and“treatment” mean the treatment of a disease in a subject, e.g, in a human. This includes: (a) inhibiting the disease, i.e., arresting its development; and (b) relieving the disease, i.e., causing regression of the disease state.
- the terms“subject” and“patient” refer to an organism to be treated by the methods and compositions described herein. Such organisms preferably include, but are not limited to, mammals (e.g, murines, simians, equines, bovines, porcines, canines, felines, and the like), and more preferably includes humans.
- Examples of cancers include solid tumors, soft tissue tumors, hematopoietic tumors and metastatic lesions.
- hematopoietic tumors include, leukemia, acute leukemia, acute lymphoblastic leukemia (ALL), B-cell, T-cell or FAB ALL, acute myeloid leukemia (AML), chronic myelocytic leukemia (CML), chronic lymphocytic leukemia (CLL), e.g ., transformed CLL, diffuse large B-cell lymphomas (DLBCL), follicular lymphoma, hairy cell leukemia, myelodyplastic syndrome (MDS), a lymphoma, Hodgkin’s disease, a malignant lymphoma, non-Hodgkin’s lymphoma, Burkitt’s lymphoma, multiple myeloma, or Richter’s Syndrome (Richter’s Transformation).
- solid tumors include malignancies, e.g., sarcomas, adenocarcinomas, and carcinomas, of the various organ systems, such as those affecting head and neck (including pharynx), thyroid, lung (small cell or non-small cell lung carcinoma (NSCLC)), breast, lymphoid, gastrointestinal (e.g, oral, esophageal, stomach, liver, pancreas, small intestine, colon and rectum, anal canal), genitals and genitourinary tract (e.g, renal, urothelial, bladder, ovarian, uterine, cervical, endometrial, prostate, testicular), CNS (e.g, neural or glial cells, e.g, neuroblastoma or glioma), or skin (e.g, melanoma).
- malignancies e.g., sarcomas, adenocarcinomas, and carcinomas
- various organ systems such as those affecting head and
- the cancer is an epithelial cancer, e.g, an epithelial cancer that upregulates the expression of sialylated glycans.
- epithelial cancers include, but are not limited to, endometrial cancer, colon cancer, ovarian cancer, cervical cancer, vulvar cancer, uterine cancer or fallopian tube cancer, breast cancer, prostate cancer, lung cancer, pancreatic cancer, urinary cancer, bladder cancer, head and neck cancer, oral cancer and liver cancer.
- Epithelial cancers also include carcinomas, for example, acinar carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, carcinoma
- adenomatosum carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma, basal cell carcinoma, carcinoma basocellulare, basaloid carcinoma, baso squamous cell carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma, chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid carcinoma, epiermoid carcinoma, carcinoma epitheliale adenoides, exophytic carcinoma, carcinoma ex ulcere, carcinoma fibrosum, gelatinifomi carcinoma, gelatinous carcinoma, giant cell carcinoma, carcinoma gigantocellulare, glandular carcinoma, granulosa cell carcinoma, hair-matrix carcinoma, hematoid carcinoma, hepatocellular carcinoma, Hurthle cell carcinoma, hyaline carcinoma, hypemephroid carcinoma,
- the cancer is breast cancer. In certain embodiments, the cancer is an adenocarcinoma. In certain embodiments, the cancer is a metastatic cancer. In certain embodiments, the cancer is a refractory cancer.
- the cancer is resistant to or non-responsive to treatment with an antibody, e.g., an antibody with ADCC activity, e.g, trastuzumab.
- an antibody with ADCC activity e.g, trastuzumab.
- the term administered“in combination,” as used herein, is understood to mean that two (or more) different treatments are delivered to the subject during the course of the subject’s affliction with the disorder, such that the effects of the treatments on the patient overlap at a point in time.
- the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as“simultaneous” or“concurrent delivery.”
- the delivery of one treatment ends before the delivery of the other treatment begins.
- the treatment is more effective because of combined administration.
- the second treatment is more effective, e.g.
- delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other.
- the effect of the two treatments can be partially additive, wholly additive, or greater than additive.
- the delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
- a method or composition described herein is administered in combination with one or more additional therapies, e.g ., surgery, radiation therapy, or administration of another therapeutic preparation.
- the additional therapy may include chemotherapy, e.g. , a cytotoxic agent.
- the additional therapy may include a targeted therapy, e.g. a tyrosine kinase inhibitor, a proteasome inhibitor, or a protease inhibitor.
- the additional therapy may include an anti-inflammatory, anti-angiogenic, anti-fibrotic, or anti-proliferative compound, e.g.
- the additional therapy may include a combination of therapeutics of different classes.
- a method or composition described herein is administered in combination with a checkpoint inhibitor.
- the checkpoint inhibitor may, for example, be selected from a PD-1 antagonist, PD-L1 antagonist, CTLA-4 antagonist, adenosine A2A receptor antagonist, B7-H3 antagonist, B7-H4 antagonist, BTLA antagonist, KIR antagonist, LAG3 antagonist, TIM-3 antagonist, VISTA antagonist or TIGIT antagonist.
- the checkpoint inhibitor is a PD-1 or PD-L1 inhibitor.
- PD- 1 is a receptor present on the surface of T-cells that serves as an immune system checkpoint that inhibits or otherwise modulates T-cell activity at the appropriate time to prevent an overactive immune response. Cancer cells, however, can take advantage of this checkpoint by expressing ligands, for example, PD-L1, that interact with PD-1 on the surface of T-cells to shut down or modulate T-cell activity.
- Exemplary PD-1/PD-L1 based immune checkpoint inhibitors include antibody based therapeutics. Exemplary treatment methods that employ PD-1/PD-L1 based immune checkpoint inhibition are described in U.S. Patent Nos.
- anti-PD-1 antibodies include, for example, nivolumab (Opdivo®, Bristol-Myers Squibb Co.), pembrolizumab (Keytruda®, Merck Sharp & Dohme Corp.), PDR001 (Novartis
- Exemplary anti-PD-Ll antibodies are described, for example, in U.S. Patent Nos. 9,273,135, 7,943,743, 9,175,082, 8,741,295, 8,552,154, and 8,217,149.
- Exemplary anti-PD-Ll antibodies include, for example, atezolizumab (Tecentriq®, Genentech), durvalumab (AstraZeneca), MEDI4736, avelumab, and BMS 936559 (Bristol Myers Squibb Co.).
- a method or composition described herein is administered in combination with a CTLA-4 inhibitor.
- CTLA-4 the interaction of CTLA-4 on a T-cell with its ligands (e.g ., CD80, also known as B7-1, and CD86) on the surface of an antigen presenting cells (rather than cancer cells) leads to T-cell inhibition.
- ligands e.g ., CD80, also known as B7-1, and CD86
- antigen presenting cells leads to T-cell inhibition.
- Exemplary CTLA-4 based immune checkpoint inhibition methods are described in U.S. Patent Nos. 5,811,097, 5,855,887, 6,051,227.
- Exemplary anti-CTLA-4 antibodies are described in U.S. Patent Nos. 6,984,720, 6,682,736, 7,311,910; 7,307,064, 7,109,003, 7,132,281, 6,207,156,
- CTLA-4 antibodies include ipilimumab or tremelimumab.
- a method or composition described herein is administered in combination with (i) a PD-1 or PD-L1 inhibitor, e.g., a PD-1 or PD-L1 inhibitor disclosed herein, and (ii) CTLA-4 inhibitor, e.g., a CTLA-4 inhibitor disclosed herein.
- a method or composition described herein is administered in combination with an IDO inhibitor.
- IDO inhibitors include 1 -methyl -D- tryptophan (known as indoximod), epacadostat (INCB24360), navoximod (GDC-0919), and BMS-986205.
- cytotoxic agents that can be administered in combination with a method or composition described herein include, for example, antimicrotubule agents, topoisomerase inhibitors, antimetabolites, protein synthesis and degradation inhibitors, mitotic inhibitors, alkylating agents, platinating agents, inhibitors of nucleic acid synthesis, histone deacetylase inhibitors (HDAC inhibitors, e.g., vorinostat (SAHA, MK0683), entinostat (MS-275), panobinostat (LBH589), trichostatin A (TSA), mocetinostat (MGCD0103), belinostat (PXD101), romidepsin (FK228, depsipeptide)), DNA methyltransferase inhibitors, nitrogen mustards, nitrosoureas, ethylenimines, alkyl sulfonates, triazenes, folate analogs, nucleoside analogs, ribonucleot
- HDAC inhibitors
- the cytotoxic agent that can be administered with a method or composition described herein is a platinum-based agent (such as cisplatin), cyclophosphamide, dacarbazine, methotrexate, fluorouracil, gemcitabine, capecitabine, hydroxyurea, topotecan, irinotecan, azacytidine, vorinostat, ixabepilone, bortezomib, taxanes (e.g, paclitaxel or docetaxel), cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, vinorelbine, colchicin, anthracyclines (e.g, doxorubicin or epirubicin) daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin,
- the invention also provides a method of increasing the expression of HLA-DR, CD86, CD83, IKNg, IL-lb, IL-6, TNFa, IL-17A, IL-2, or IL-6 in a cell, tissue, or subject.
- the method comprises contacting the cell, tissue, or subject with an effective amount of a sialidase, fusion protein and/or antibody conjugate, e.g, a sialidase, a fusion protein or antibody conjugate disclosed herein.
- the cell is selected from a dendritic cell and a peripheral blood mononuclear cell (PBMC).
- PBMC peripheral blood mononuclear cell
- expression of HLA-DR, CD86, CD83, IFNy, IL-lb, IL-6, TNFa, IL-17A, IL-2, or IL-6 in the cell, tissue, or subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical cell or tissue that has not been contacted with the sialidase, fusion protein, or antibody conjugate.
- Gene expression may be measured by any suitable method known in the art, for example, by ELISA, or by Luminex multiplex assays.
- the invention also provides a method of promoting infiltration of immune cells into a tumor in a subject in need thereof.
- the method comprises administering to the subject an effective amount of a sialidase, fusion protein, and/or antibody conjugate, e.g., a sialidase, fusion protein, or antibody conjugate disclosed herein.
- the immune cells are T-cells, e.g, CD4+ and/or CD8+ T-cells, e.g, CD69 + CD8 + and/or GzmB + CD8 + T- cells.
- the immune cells are natural killer (NK) cells.
- the infiltration of immune cells into the tumor in the subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical tumor and/or subject that has not been administered the sialidase, fusion protein, or antibody conjugate.
- Infiltration of immune cells into a tumor may be measured by any suitable method known in the art, for example, antibody staining.
- the invention also provides a method of increasing the number of circulating natural killer (NK) cells in a subject in need thereof.
- the method comprises administering to the subject an effective amount of a sialidase, fusion protein, and/or antibody conjugate, e.g, a sialidase, fusion protein, or antibody conjugate disclosed herein, so as to increase the number of circulating NK cells relative to prior to administration of the sialidase, fusion protein, or antibody conjugate.
- the number of circulating NK cells in the subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical subject that has not been administered the sialidase, fusion protein, or antibody conjugate.
- Circulating NK cells in a subject may be measured by any suitable method known in the art, for example, antibody staining.
- the invention also provides a method of increasing the number of T-cells in the draining lymph node in a subject in need thereof.
- the method comprises administering to the subject an effective amount of a sialidase, fusion protein, and/or antibody conjugate, e.g., a sialidase, fusion protein, or antibody conjugate disclosed herein, so as to increase the number of T-cells in the draining lymph node relative to prior to administration of the fusion protein, antibody conjugate or pharmaceutical composition.
- the immune cells are T-cells, e.g, CD4+ and/or CD8+ T-cells.
- the number of T-cells in the draining lymph node in the subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical subject that has not been administered the sialidase, fusion protein, or antibody conjugate.
- T-cells in the draining lymph node in a subject may be measured by any suitable method known in the art, for example, antibody.
- the invention also provides a method of increasing expression of Cd3, Cd4, Cd8, Cd274, Ctla4, Icos, Pdcdl, Lag3, 116, II lb, 112, Ifng, Ifnal, Mxl, Gzmb, Cxcl9, Cxcll2, and/or Ccl5 in a cell, tissue, or subject.
- the method comprises contacting the cell, tissue, or subject with an effective amount of a sialidase, fusion protein, and/or antibody conjugate, e.g, a sialidase, fusion protein, or antibody conjugate disclosed herein, so as to increase the expression of Cd3, Cd4, Cd8, Cd274, Ctla4, Icos, Pdcdl, Lag3, 116, II lb, 112, Ifng, Ifnal, Mxl, Gzmb, Cxcl9, Cxcll2, and/or Ccl5 relative to the cell, tissue or subject prior to contact with the sialidase, fusion protein, or antibody conjugate.
- a sialidase, fusion protein, and/or antibody conjugate e.g, a sialidase, fusion protein, or antibody conjugate disclosed herein
- expression of Cd3, Cd4, Cd8, Cd274, Ctla4, Icos, Pdcdl, Lag3, 116, II lb, 112, Ifng, Ifnal, Mxl, Gzmb, Cxcl9, Cxcll2, and/or Ccl5 in the cell, tissue, or subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical cell, tissue, or subject that has not been contacted with the sialidase, fusion protein, or antibody conjugate.
- Gene expression may be measured by any suitable method known in the art, for example, by ELISA, Luminex multiplex assay
- the invention also provides a method of removing sialic acid from a cell or tissue.
- the method comprises contacting the cell or tissue with an effective amount of a sialidase, fusion protein, and/or antibody conjugate, e.g., a sialidase, fusion protein, or antibody conjugate disclosed herein.
- the invention also provides a method of removing sialic acid from a cell in a subject, the method comprising administering to the subject an effective amount of a pharmaceutical composition comprising a sialidase, fusion protein, and/or antibody conjugate, e.g, a sialidase, fusion protein, or antibody conjugate disclosed herein, thereby to remove sialic acid from the cell.
- the cell is tumor cell, dendritic cell (DC) or monocyte.
- the cell is a monocyte, and the method results in increased expression of an MHC-II molecule (e.g., HLA-DR) on the monocyte.
- an MHC-II molecule e.g., HLA-DR
- expression of an MHC-II molecule in the cell or tissue is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical cell or tissue that has not been contacted with the sialidase, fusion protein, and/or antibody conjugate.
- Gene expression may be measured by any suitable method known in the art, for example, by ELISA, by Luminex multiplex assays, or by flow cytometry.
- the invention also provides a method of enhancing phagocytosis of a tumor cell.
- the method comprises contacting the tumor cell with a sialidase, fusion protein, and/or antibody conjugate, e.g, a sialidase, fusion protein, or antibody conjugate disclosed herein, in an amount effective to remove sialic acid from the tumor cell, thereby enhancing
- the disclosure relates to a method of increasing phagocytosis of a tumor cell in a subject, the method comprising administering to the subject an effective amount of a pharmaceutical composition a sialidase, fusion protein, and/or antibody conjugate, e.g, a sialidase, fusion protein or antibody conjugate disclosed herein, in an amount effective to remove sialic acid from the tumor cell, thereby to increase phagocytosis of the tumor cell.
- a sialidase, fusion protein, and/or antibody conjugate e.g, a sialidase, fusion protein or antibody conjugate disclosed herein
- phagocytosis is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical tumor cell or population of tumor cells that has not or have not been contacted with the sialidase, fusion protein, and/or antibody conjugate.
- Phagocytosis may be measured by any suitable method known in the art.
- the invention also provides a method of activating a dendritic cell (DC).
- the method comprises contacting the DC with a tumor cell that has been treated with a sialidase, fusion protein, and/or antibody conjugate, e.g., a sialidase, fusion protein, or antibody conjugate disclosed herein.
- the disclosure relates to a method of activating a dendritic cell (DC) or a population of DCs in a subject, the method comprising administering to the subject an amount of a pharmaceutical composition comprising a sialidase, fusion protein, and/or antibody conjugate, e.g., a sialidase, fusion protein, or antibody conjugate disclosed herein, effective to remove sialic acid from a tumor cell in the subject, thereby to activate the DC or the population of DCs in the subject.
- a pharmaceutical composition comprising a sialidase, fusion protein, and/or antibody conjugate, e.g., a sialidase, fusion protein, or antibody conjugate disclosed herein, effective to remove sialic acid from a tumor cell in the subject, thereby to activate the DC or the population of DCs in the subject.
- activation of the DC or a population of DCs is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical DC or population of DCs that has not or have not been contacted with a tumor cell that has been treated with the sialidase, fusion protein, and/or antibody conjugate.
- Activation may be measured by any suitable method known in the art.
- the invention also provides a method of reducing Siglec-15 binding activity, thereby to increase anti-tumor activity in a tumor microenvironment, the method comprising contacting a T cell with a sialidase, fusion protein, and/or antibody conjugate, e.g, a sialidase, fusion protein, or antibody conjugate disclosed herein.
- the disclosure relates to a method of reducing Siglec-15 binding activity, thereby to increase anti tumor activity in a tumor microenvironment of a patient, the method comprising
- a pharmaceutical composition comprising a sialidase, fusion protein, and/or antibody conjugate, e.g., a sialidase, fusion protein, or antibody conjugate disclosed herein, thereby to increase anti-tumor activity (e.g., T cell activity) in the subject.
- a pharmaceutical composition comprising a sialidase, fusion protein, and/or antibody conjugate, e.g., a sialidase, fusion protein, or antibody conjugate disclosed herein, thereby to increase anti-tumor activity (e.g., T cell activity) in the subject.
- Siglec-15 binding activity is reduced by at least about 10%, at least about 20%, at least about 50%, at least about 75%, or about 100%, relative to Siglec-15 that has not or have not been contacted with the sialidase, fusion protein, and/or antibody conjugate. Binding may be measured by any suitable method known in the art.
- compositions are described as having, including, or comprising specific components, or where processes and methods are described as having, including, or comprising specific steps, it is contemplated that, additionally, there are compositions of the present invention that consist essentially of, or consist of, the recited components, and that there are processes and methods according to the present invention that consist essentially of, or consist of, the recited processing steps.
- This example describes the construction of recombinant human sialidases (Neul, Neu2, and Neu3).
- the human sialidases Neul, Neu2, Neu3 (isoform 1), and Neu4 (isoform 1) were expressed as secreted proteins with a lOxHis tag.
- Neul As a secreted protein, the native N terminal signal peptide
- MDMRVPAQLLGLLLLWLPGARC (SEQ ID NO: 28) was added to each.
- Sialidases were expressed in a 200 mL transfection of HEK293F human cells in 24- well plates using the pCEP4 mammalian expression vector with an N-terminal 6xHis tag. Sialidases were purified using Ni-NTA columns, quantified with a UV-Vis
- This example describes the construction of recombinant human sialidases with mutations that increase expression and/or activity of the sialidase.
- Structural and sequence analysis identified residues A93 and P62 of Neu2 as candidates for substitutions to increase solubility and/or expression.
- a comparison of homologous sialidase sequences showed a preference for D or E amino acid residues at positions corresponding to position 93 of Neu2, and a preference for G amino acid residues at positions corresponding to position 62 of Neu2.
- the beta-propeller family of proteins are usually stabilized by extensive hydrogen bonding interactions at the N- and C-termini of the protein.
- sialidases from Salmonella typhimurium and Micromonospora viridifaciens (the bacterial sialidase most homologous to human Neu2) have extensive hydrogen bonding interactions at their N- and C-termini. Accordingly, residues K9, V363, and L365 of Neu2 were mutated to promote hydrogen bonding between the N- and C-termini of Neu2.
- Neu2 was expressed in a phage display system allowing for screening of Neu2 variants for both expression level and resistance to heat denaturation.
- Neu2 with V6Y and I187K substitutions was used as a template for library preparation.
- Designed phage display libraries 1, 2, and 3 are depicted in TABLES 11-13, respectively. Each library included all of the possible combinations of the mutations depicted.
- a fourth library included random mutations generated by error prone PCR. TABLE 11 - Phage Library 1
- the codon usage columns in TABLES 11-13 represent degenerate codon codes used in the design of the library, where the first, second, and third positions of a given codon encoding an amino acid are as shown in TABLE 14 and as described in Mena et al. (2005) PROTEIN ENG DES SEL. 18(12): 559-61.
- the phage display libraries were screened for binding to a conformation-specific antibody and/or a sialic acid biotinylated probe after heating to enrich for thermal stability and expression.
- the sialic acid biotinylated probe and its synthesis is depicted in FIGURE 4.
- An exemplary phage display screening procedure is depicted in FIGURE 5. Briefly, phage libraries expressing the desired Neu2 variants were generated. Phage were screened for binding to immobilized anti-Neu2 antibody and/or sialic acid biotinylated probe.
- binding phage were eluted from the antibody or probe and analyzed as appropriate.
- Neu2 was also expressed in a yeast display system allowing for screening of Neu2 variants for both expression level and resistance to heat denaturation.
- Neu2 with V6Y and I187K substitutions was used as a template for library preparation.
- Designed yeast display libraries la, lb, lc, Id, 2a, 2b, 2c, 3a, 3b, and 3c are depicted in TABLEs 15-24,
- Each library included all of the possible combinations of the mutations depicted. Five additional sublibraries were generated by error prone PCR, at an approximate average rate of 1, 2, 3, 4, and 5 substitutions per enzyme.
- the codon usage columns in TABLES 15-24 represent degenerate codon codes used in the design of the library, where the first, second, and third positions of a given codon encoding an amino acid are as shown herein above in TABLE 14 and as described in Mena et al. (2005) PROTEIN ENG DES SEL. 18(12):559-61.
- the yeast display libraries were screened for binding to a conformation-specific antibody and/or a sialic acid biotinylated probe after heating to enrich for thermal stability and expression. An exemplary yeast display screening procedure is depicted in FIGURE 6.
- a plasmid library encoding for the desired Neu2 variants, and yeast cells expressing the desired Neu2 variants on the surface were generated.
- yeast cells were heat shocked and then screened for binding to anti-Neu2 antibody and/or sialic acid biotinylated probe on magnetic beads.
- the magnetic beads were isolated to remove unbound cells, and bound cells were further analyzed for Neu2 affinity, activity, and stability as appropriate.
- Mutant sialidases including mutations identified using the rational design, phage display, and yeast display approaches described in this Example were expressed as secreted proteins with a C-terminal human Fc tag in Expi293F cells using the pCEP4 mammalian expression vector. Expression was assayed using a ForteBio Octet with anti-human Fc sensors and Western blot and enzymatic activity was assayed using the fluorogenic substrate 4MU-NeuAc as described above.
- FIGURE 7A is an image of an SDS-PAGE gel showing recombinant wildtype human Neu2 and Neu2 variant Ml 06 (each with a C-terminal human Fc tag) under non reducing and reducing conditions.
- FIGURE 7B is an SEC-HPLC trace for recombinant wildtype human Neu2 and Neu2 variant M106 (each with a C-terminal human Fc tag). While Neu2-Fc had a yield of 0.3 mg/liter following protein-A purification, and monomer content of 7% as determined by SEC, Neu2-M106 had a yield of 20 mg/liter, and a monomer content of 85%.
- the enzyme kinetics of Neu2-M106 were assayed by measuring the release of sialic acid from the fluorogenic substrate 4-methylumbelliferyl-N-acetylneuraminic acid (4MU- NeuAc) as described above. A fixed concentration of enzyme at 2 pg/well was incubated with fluorogenic substrate 4MU-NeuAc at concentrations ranging from 4mM to 0.03mM.
- FIGURE 8 depicts the enzyme activity of Neu2 variant M106. Enzymatic activity of Neu2- M106 was comparable to wildtype Neu2, with a KM determined to be 230mM.
- This Example describes the construction and expression of antibody-sialidase genetic fusion proteins, and antibody sialidase conjugates (ASCs) containing the fusion proteins, with mutated human sialidases.
- ASCs antibody sialidase conjugates
- FIGURE 11 A The architecture for four types of exemplary ASCs is depicted in FIGURE 11.
- the first type of ASC, referred to as“Raptor,” includes an antibody (with two heavy chains and two light chains) with a sialidase fused at the C-terminus of each heavy chain of the antibody (FIGURE 11 A).
- the second type of ASC contains one antibody arm (with one heavy chain and one light chain), and one sialidase-Fc fusion with a sialidase fused at the N-terminus of one arm of the Fc.
- Each Fc domain polypeptide in the Janus ASC contains either the“knob” (T366Y) or“hole” (Y407T) mutation for heterodimerization (residue numbers according to EU numbering, Rabat, E.A., et al. (1991) supra) (FIGURE 11B).
- the third type of ASC contains two Fc domain polypeptides each with a sialidase fused at the N-terminus of the Fc and a scFv fused at the C-terminus of the Fc (FIGURE 11C).
- the fourth type of ASC referred to as“Bunk,” contains one antibody arm (with one heavy chain and one light chain) with an scFv fused at the C- terminus of one arm of the Fc and one sialidase-Fc fusion with a sialidase fused at the N- terminus of the other arm of the Fc.
- Each Fc domain polypeptide in the Bunk ASC contains either the“knob” (T366Y) or“hole” (Y407T) mutation for heterodimerization (residue numbers according to EU numbering, Rabat, E.A., et al. (1991) supra ) (FIGURE 11D).
- Janus ASCs including Neu2 variants described in Example 2 and trastuzumab were made and tested for activity and expression. Expression was assayed using a ForteBio Octet with anti-human Fc sensors and Western blot and enzymatic activity was assayed using the fluorogenic substrate 4MU-NeuAc as described above. Expression and activity levels for the Janus ASCs are shown in TABLE 26.
- enzymatic activity is indicated as “+++,” which denotes activity >2 fold higher than wild-type Neu2,“++,” which denotes activity comparable to wild-type Neu2,“+,” which denotes activity lower than wild-type which denotes no detectable activity
- expression is indicated as“++++,” which denotes expression > 15 fold higher than wildtype-Neu2,“+++,” which denotes expression > 6 fold higher than wild-type Neu2,“++,” which denotes expression 2-5 fold higher than wild-type Neu2,“+,” which denotes expression comparable to wild-type Neu2, or“-’’which denotes no detectable expression.
- Janus ASCs including Neu2 variants described in Example 2 and trastuzumab were made and tested for activity and expression.
- Janus ASCs were expressed in Expi293F cells in 500 mL cultures and purified using protein A and ion exchange chromatography. Expression was assayed using a ForteBio Octet with anti-human Fc sensors and Western blot and enzymatic activity was assayed using the fluorogenic substrate 4MU- NeuAc as described above. Expression and activity levels for the Janus ASCs are shown in TABLE 27.
- enzymatic activity is indicated as“+++,” which denotes activity >2 fold higher than wild-type Neu2,“++,” which denotes activity comparable to wild-type Neu2,“+,” which denotes activity lower than wild-type Neu2, or which denotes no detectable activity
- expression is indicated as“++++,” which denotes expression > 15 fold higher than wildtype-Neu2,“+++,” which denotes expression > 6 fold higher than wild- type Neu2,“++,” which denotes expression 2-5 fold higher than wild-type Neu2,“+,” which denotes expression comparable to wild-type Neu2, or“-’’which denotes no detectable expression.
- This example describes the construction of recombinant human sialidases with mutations that increase expression and/or activity of the sialidase.
- mutant sialidases in this Example were expressed as secreted proteins with a C-terminal human Fc tag in Expi293F cells using the pCEP4 mammalian expression vector. Expression was assayed using a ForteBio Octet with anti human Fc sensors and Western blot and enzymatic activity was assayed using the fluorogenic substrate 4MU-NeuAc as described above.
- Additional mutant Neu2 sialidases were constructed including a substitution of an amino acid residue in a beta turn with a proline (for example D80P, R189P, and/or H239P substitutions). Substitution with a proline at these positions may, for example, stabilize the protein by influencing local protein folding.
- a proline for example D80P, R189P, and/or H239P substitutions.
- enzymatic activity is indicated as“++,” which denotes activity comparable to wild-type Neu2,“+,” which denotes activity lower than wild-type Neu2, or ,” which denotes no detectable activity
- expression is indicated as“+++++”, which denotes expression > 40 fold higher than wildtype-Neu2,“++++”, which denotes expression > 15 fold higher than wildtype-Neu2,“+++,” which denotes expression > 6 fold higher than wild-type Neu2,“++,” which denotes expression 2-5 fold higher than wild-type Neu2,“+,” which denotes expression comparable to wild-type Neu2, or ’’which denotes no detectable expression.
- FIGURE 22A is an image of an SDS-PAGE gel showing Neu2-M173-Fc (with a C-terminal human Fc tag) under non-reducing and reducing conditions.
- FIGURE 22B is an SEC-HPLC trace for Neu2-M173-Fc (with a C-terminal human Fc tag).
- Neu2-M173-Fc had a yield of 120 mg/liter, and a monomer content of 90%.
- the enzyme kinetics of Neu2-M173-Fc were assayed by measuring the release of sialic acid from the fluorogenic substrate 4-methylumbelliferyl-N-acetylneuraminic acid (4MU-NeuAc) as described above. A fixed concentration of enzyme at 2 pg/well was incubated with fluorogenic substrate 4MU-NeuAc at concentrations ranging from 4mM to 0.03mM.
- FIGURE 23 depicts the enzyme activity of Neu2-M173-Fc. Enzymatic activity of Neu2-M173-Fc was comparable to wildtype Neu2, with a KM determined to be 230mM.
- Additional mutant Neu2 sialidases were constructed including rationally designed substitutions at positions S301 and/or W302. Mutations of S301 and/or W302 may influence interactions with neighboring amino acid residues and/or substrate.
- enzymatic activity is indicated as“++,” which denotes activity comparable to wild-type Neu2,“+,” which denotes activity lower than wild-type Neu2, or which denotes no detectable activity
- expression is indicated as“+++++”, which denotes expression > 40 fold higher than wildtype-Neu2,“++++”, which denotes expression > 15 fold higher than wildtype-Neu2,“+++,” which denotes expression > 6 fold higher than wild- type Neu2,“++,” which denotes expression 2-5 fold higher than wild-type Neu2,“+,” which denotes expression comparable to wild-type Neu2, or“-’’which denotes no detectable expression.
- This example describes the construction of recombinant human sialidases with mutations that reduce proteolytic cleavage.
- trypsin digestion reactions were performed by incubation of trypsin (5 pL, 0.005% solution in PBS) with Neu2-M106 (25 pL, 0.25 mg/mL in PBS pH 8.0) for 5 minutes on ice. Reactions were stopped by addition of LDS gel loading buffer (5 pL) and run on a reducing SDS-PAGE gel to observe trypsin mediated cleavage.
- LDS-PAGE analysis showed that incubation of the uncleaved Neu2-M106 with trypsin resulted in the same cleavage pattern as that of the cleaved Neu2-M106. Additionally, incubation of the cleaved Neu2-M106 with trypsin resulted in increased intensity of the bands corresponding to the cleavage products.
- Neu2-M106 was also incubated with trypsin in the presence of various protease inhibitors. Briefly, trypsin digestion reactions were performed by incubation of trypsin (0.005%) with Neu2-M106 (0.5 mg/mL) and protease inhibitor for 5 minutes on ice. Reactions were stopped by addition of LDS gel loading buffer and run on a reducing SDS- PAGE gel to observe trypsin mediated cleavage.
- Inhibitors used included iron citrate (at 0.3 and 5 mM), aprotinin (at 5,000 and 20,000 U/mL), AEBSF (at 0.1 and 1 mM), leupeptin (at 1 and 10 pM) or E-64 (at 1 and 10 pM).
- iron citrate at 0.3 and 5 mM
- aprotinin at 5,000 and 20,000 U/mL
- AEBSF at 0.1 and 1 mM
- leupeptin at 1 and 10 pM
- E-64 at 1 and 10 pM
- sialidases were expressed as secreted proteins with a C-terminal human Fc tag in Expi293F cells (on a 50 mL scale) using the pCEP4 mammalian expression vector.
- the resulting protein was purified using a Protein A column.
- Expression was assayed using a ForteBio Octet with anti-human Fc sensors and Western blot and enzymatic activity was assayed using the fluorogenic substrate 4MU-NeuAc as described above.
- Protease cleavage was assayed by SDS-PAGE as described above.
- R243 was mutated to different polar/charged amino acids such as K, E, H, N and Q. However, these mutations of R243 resulted in complete loss of activity and reduction in expression yields (R243 is also a conserved amino acid among similar sialidases).
- FIGURE 27 All mutations were tested in a Neu2-M106 background (i.e., including MID, V6Y, P62G, A93E, I187K, and C332A substitutions).
- mutant sialidases depicted in FIGURE 27 expressed well, however only two of the mutant sialidases (including V244I or A242C mutations) were active.
- the A242C mutation resulted in greater than 10 fold improved trypsin resistance and slightly lower activity (both relative to Neu2-M106).
- having an unpaired cysteine could be a potential liability, so, A242 was mutated to all 19 other amino acids and assayed for activity and trypsin resistance.
- FIGURE 29 Select results are shown in FIGURE 29. As shown in FIGURE 29, the combination of R241 Y and A242F mutations (Neu2-M255) resulted in the most resistance to trypsin cleavage (a greater than 10 fold improved trypsin resistance relative to Neu2-M106).
- This Example describes the construction and expression of antibody-sialidase genetic fusion proteins, and antibody sialidase conjugates (ASCs) containing the fusion proteins, with mutated human sialidases.
- a Janus Antibody Sialidase Conjugate was made using Neu2 with MID, V6Y, P62G, A93E, I187K and C332A substitutions and Trastuzumab, referred to in this Example as“Janus Trastuzumab”.
- This Janus Trastuzumab (including a first polypeptide chain with amino acid sequence SEQ ID NO: 66, encoded by nucleotide sequence SEQ ID NO: 86, a second polypeptide chain with amino acid sequence SEQ ID NO: 67, encoded by nucleotide sequence SEQ ID NO: 87, and a third polypeptide chain with amino acid sequence SEQ ID NO: 68, encoded by nucleotide sequence SEQ ID NO: 88) was expressed and characterized for purity using SDS-PAGE and enzymatic activity using 4MU-NeuAc as described below.
- Janus Trastuzumab was expressed in a 1L transfection of Expi293 human cells using the pCEP4 mammalian expression vector. Janus Trastuzumab was purified using Protein A, followed by cation exchange chromatography (Hitrap SP-HP, GE Lifesciences). Purified proteins were analyzed by SDS-PAGE (FIGURE 12), and SEC-HPLC (FIGURE 13). Expression yield was 30mg/L, with 90% monomer purity as determined by SEC-HPLC.
- the enzymatic activity of the recombinantly expressed Janus Trastuzumab was assayed by measuring the release of sialic acid from the fluorogenic substrate 4- methylumbelliferyl-N-acetylneuraminic acid (4MU-NeuAc). Specifically, an enzyme kinetics assay was performed using a fixed concentration of enzyme at 2pg/well, which was incubated with fluorogenic substrate 4MU-NeuAc at concentrations ranging from 4000 mM to 7.8 mM. As shown in FIGURE 14, Janus Trastuzumab was enzymatically active, with a Km of 0.48 mM.
- Janus Trastuzumab was tested for antigen (Her2) binding by using ForteBio Octet with the ASC captured on anti-Fc sensors with dipping into serial dilutions of His-tagged Her2 (50 to 0.78 nM at 1 :2 dilutions). Janus Trastuzumab bound to Her2 with comparable binding affinity to trastuzumab (FIGURE 15).
- This Example describes the in vivo administration of antibody sialidase conjugates (ASCs) containing bacterial sialidases.
- ASCs were made and tested in this Example: (i) a Janus ASC including Salmonella typhimurium sialidase (St-sialidase) and trastuzumab (including a first polypeptide chain with amino acid sequence SEQ ID NO: 66, encoded by nucleotide sequence SEQ ID NO: 86, a second polypeptide chain with amino acid sequence SEQ ID NO: 67, encoded by nucleotide sequence SEQ ID NO: 87, and a third polypeptide chain with amino acid sequence SEQ ID NO: 90, encoded by nucleotide sequence SEQ ID NO: 91); (ii) a Raptor ASC including St-sialidase and trastuzumab (including first and fourth polypeptide chains with amino acid sequence SEQ ID NO: 66, encoded by nucleotide sequence SEQ ID NO: 86, and second and third polypeptide chains with amino acid sequence SEQ ID NO: 92, encoded by nucle
- ASCs were compared to trastuzumab in a mouse syngeneic tumor model injected with a murine breast cancer cell line expressing human Her2 (EMT6-hHer2 cells).
- EMT6-hHer2 cells human Her2
- Anti-mouse NK 1.1 (Clone: PK136; BioXcell, 621717N1), anti-mouse CD8a (Clone: 53-6.7; BioXcell, BE0004-1) and liposomal clodronate (FormuMax Scientific, Inc.) were included in treatment groups as indicated.
- FIGURES 16A, 16B, 16C and 16D The results from for treatment with trastuzumab, and Raptor, Janus and Lobster ASCs are shown in FIGURES 16A, 16B, 16C and 16D respectively.
- trastuzumab resulted in no complete responses in eight individual mice as treated (defined as regression below the limit of palpation at any point for the duration of the study, FIGURE 16A).
- Raptor which demonstrated 2 out of 8 animals with a complete response (FIGURE 16B), Janus which demonstrated 3 out of 8 animals with a complete response (FIGURE 16C) and Lobster which demonstrated 2 out of 8 animals with a complete response (FIGURE 16D).
- FIGURE 17 The results of administration of Janus with NK depletion (anti-mouse NK1.1), macrophage depletion (liposomal clodronate) and CD8 T cell depletion (anti-mouse CD8a) are shown in FIGURE 17.
- NK depletion reduced the number of complete responses to 1 out of 8 animals (FIGURE 17A).
- Macrophage depletion also reduced the number of complete responses to 1 out of 8 animals (FIGURE 17B).
- CD8 T cell depletion completely reversed the effects of Janus, with no animals showing a complete response (FIGURE 17C).
- FIGURE 17D shows the mean tumor volume for vehicle, Janus alone, trastuzumab alone and Janus with NK, macrophage and CD8 T cell depletions.
- This Example describes the in vivo administration of antibody sialidase conjugates (ASCs) with bacterial sialidases.
- ASCs were made and tested in this Example: (i) a Janus ASC including Salmonella typhimurium sialidase (St-sialidase) and trastuzumab (including a first polypeptide chain with amino acid sequence SEQ ID NO: 66, encoded by nucleotide sequence SEQ ID NO: 86, a second polypeptide chain with amino acid sequence SEQ ID NO: 67, encoded by nucleotide sequence SEQ ID NO: 87, and a third polypeptide chain with amino acid sequence SEQ ID NO: 90, encoded by nucleotide sequence SEQ ID NO: 91); and (ii) a Janus ASC including St-sialidase with two loss of function mutations, D100V and G231V, and trastuzumab (“Janus-LOF,” including a first polypeptide chain with amino acid sequence SEQ ID NO: 66, encoded by nucleotide sequence SEQ ID NO: 86,
- FIGURE 18A The results for Groups 1 through 4 (vehicle, trastuzumab, Janus and Janus LOF) are shown in FIGURE 18A. As can be seen, 3 out of 6 animals treated with Janus had a complete regression of tumor growth. Notably, Janus LOF and trastuzumab were both comparable to vehicle treated animals.
- mice with a complete regression were rechallenged with either the same EMT6-Her2 cells used originally or parental EMT6 cells (lacking engineered human Her2 expression).
- EMT6 cells and EMT6-Her2 cells were inoculated subcutaneously in the right or left lower flank region respectively (5 x 10 5 ) in 0.1 ml of PBS for tumor development of all three cured mice.
- EMT6-Her2 cells were also inoculated subcutaneously into naive mice as a control.
- FIGURE 18B neither EMT6-Her2 cells nor parental EMT6 cells resulted in tumor growth in the cured mice while EMT6-Her2 cells developed into tumors as expected in the naive mice.
- FIGURE 19A and FIGURE 19B The results for Groups 1, 5 and 6 (vehicle, anti-mouse PD1 and anti-mouse PD1 combined with Janus) are shown in FIGURE 19A and FIGURE 19B. While anti-mouse PD1 had good activity with 4 out of 6 mice demonstrating complete regressions (similar to Janus alone with 3 out of 6 mice demonstrating complete regression, see FIGURE 18A), the combination of anti-mouse PD1 with Janus demonstrated complete regression of tumor growth in all 6 mice (FIGURE 19B). There was no body weight loss in any of the animals given this combination.
- This Example describes the in vivo administration of antibody sialidase conjugates (ASCs) with bacterial sialidases.
- a Janus ASC including Salmonella typhimurium sialidase (St-sialidase) and trastuzumab including a first polypeptide chain with amino acid sequence SEQ ID NO: 66, encoded by nucleotide sequence SEQ ID NO: 86, a second polypeptide chain with amino acid sequence SEQ ID NO: 67, encoded by nucleotide sequence SEQ ID NO: 87, and a third polypeptide chain with amino acid sequence SEQ ID NO: 90, encoded by nucleotide sequence SEQ ID NO: 91) was made and tested in this Example.
- St-sialidase Salmonella typhimurium sialidase
- trastuzumab including a first polypeptide chain with amino acid sequence SEQ ID NO: 66, encoded by nucleotide sequence SEQ ID NO: 86, a second polypeptide chain with amino acid sequence SEQ ID NO: 67, encoded by nucleotide sequence SEQ ID NO: 87, and
- the ASC was tested in a mouse syngeneic tumor model inj ected with a B 16 melanoma cell line expressing human Her2 (B16D5-Her2, Surana el al. CANCER IMMUNOL RES, 2(11): 1103-1112).
- Anti-mouse PD1 obtained from BioXcell (RMPl-14, Cat. No. 665418F1)
- anti-mouse CTLA4 obtained from BioXcell (9D9, Cat. # BE0164
- the B 16 melanoma mouse model is considered a difficult tumor model to treat with immuno-oncology approaches.
- a comparison of Janus to a combination of anti-mouse PD1 and anti-mouse CTLA4 was carried out. The results are shown in FIGURE 20.
- Anti-mouse PD1 combined with anti -mouse CTLA4 had an impact on B16D5-Her2 tumor growth, but this combination also demonstrated significant weight loss in the treated animals.
- Janus demonstrated a more robust anti-tumor activity with no significant weight loss.
- Trastuzumab alone demonstrated marginal activity in this model.
- This Example describes the in vivo administration of an antibody sialidase conjugate (ASC) containing a human sialidase.
- ASC antibody sialidase conjugate
- Janus Trastuzumab as described in Example 3, including Neu2 with MID, V6Y, P62G, A93E, I187K and C332A substitutions and Trastuzumab (including a first polypeptide chain with amino acid sequence SEQ ID NO: 66, encoded by nucleotide sequence SEQ ID NO: 86, a second polypeptide chain with amino acid sequence SEQ ID NO: 67, encoded by nucleotide sequence SEQ ID NO: 87, and a third polypeptide chain with amino acid sequence SEQ ID NO: 68, encoded by nucleotide sequence SEQ ID NO: 88) was made and tested in this Example.
- Janus Trastuzumab was compared to isotype control antibody in a mouse syngeneic tumor model injected with a murine breast cancer cell line stably expressing human HER2 (EMT6-HER2).
- EMT6-HER2 murine breast cancer cell line stably expressing human HER2
- FIGURE 21 shows individual tumor growth for mice that received treatment with Janus Trastuzumab or control. Significant tumor growth delay was observed following treatment with Janus Trastuzumab in this experiment.
- PCT/US20/40814 filed July 3, 2020
- International (PCT) Patent Application No. PCT/US20/40816 filed July 3, 2020, are incorporated by reference for all purposes.
- MMSSAAFPRWLSMGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSH AHRLVLRRGTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEA VQIATGRNAARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLV PAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSF LYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSV GPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSW TLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDL ASIGPAPEGGLVFACLYESGARTS
- SEQ ID NO: 56 MASLPYLQKESVFQSGAHAYRIPALLYLPGQQQSLLAFAEQRASKKDEHAELIVLRRGDYDAP THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLHDRARSLWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
- SEQ ID NO: 59 [00400] SEQ ID NO: 59:
- SEQ ID NO: 61 MASLPYLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAP THQVQWQAQEWAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRL CQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLHDRARSLWPAYAYRKLHP KQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRWTLNARSHLRARVQAQS TNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAY LNPRPPAPEAWSEPVLLAKGSAAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQA FPAEYLPQ
- SEQ ID NO: 62 [00403] SEQ ID NO: 62:
- SEQ ID NO: 66 [00407] SEQ ID NO: 66:
- SEQ ID NO: 68 [00409] SEQ ID NO: 68:
- SEQ ID NO: 69 [00410] SEQ ID NO: 69:
- SEQ ID NO: 74 [00415] SEQ ID NO: 74:
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- General Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Oncology (AREA)
- Mycology (AREA)
- Biophysics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Physics & Mathematics (AREA)
- Gastroenterology & Hepatology (AREA)
- Plant Pathology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020227003418A KR20220032576A (ko) | 2019-07-03 | 2020-07-03 | 재조합 인간 시알리다제, 시알리다제 융합 단백질, 및 그를 사용하는 방법 |
| BR112021026789A BR112021026789A2 (pt) | 2019-07-03 | 2020-07-03 | Sialidases humanas recombinantes, proteínas de fusão de sialidase e métodos de uso das mesmas |
| CA3145676A CA3145676A1 (en) | 2019-07-03 | 2020-07-03 | Recombinant human sialidases, sialidase fusion proteins, and methods of using the same |
| CN202080058167.7A CN114258431A (zh) | 2019-07-03 | 2020-07-03 | 重组人唾液酸酶、唾液酸酶融合蛋白及其使用方法 |
| JP2021578065A JP7777988B2 (ja) | 2019-07-03 | 2020-07-03 | 組換えヒトシアリダーゼ、シアリダーゼ融合タンパク質およびその使用方法 |
| US17/624,121 US20220356457A1 (en) | 2019-07-03 | 2020-07-03 | Recombinant human sialidases, sialidase fusion proteins, and methods of using the same |
| AU2020301037A AU2020301037A1 (en) | 2019-07-03 | 2020-07-03 | Recombinant human sialidases, sialidase fusion proteins, and methods of using the same |
| EP20834151.1A EP3994275A4 (en) | 2019-07-03 | 2020-07-03 | RECOMBINANT HUMAN SIALIDASES, SIALIDASE FUSION PROTEINS AND METHOD FOR USE THEREOF |
| JP2025197401A JP2026032063A (ja) | 2019-07-03 | 2025-11-18 | 組換えヒトシアリダーゼ、シアリダーゼ融合タンパク質およびその使用方法 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962870403P | 2019-07-03 | 2019-07-03 | |
| US62/870,403 | 2019-07-03 | ||
| US202062957011P | 2020-01-03 | 2020-01-03 | |
| US62/957,011 | 2020-01-03 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2021003469A2 true WO2021003469A2 (en) | 2021-01-07 |
| WO2021003469A3 WO2021003469A3 (en) | 2021-04-08 |
Family
ID=74101301
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/040828 Ceased WO2021003469A2 (en) | 2019-07-03 | 2020-07-03 | Recombinant human sialidases, sialidase fusion proteins, and methods of using the same |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20220356457A1 (https=) |
| EP (1) | EP3994275A4 (https=) |
| JP (2) | JP7777988B2 (https=) |
| KR (1) | KR20220032576A (https=) |
| CN (1) | CN114258431A (https=) |
| AU (1) | AU2020301037A1 (https=) |
| BR (1) | BR112021026789A2 (https=) |
| CA (1) | CA3145676A1 (https=) |
| WO (1) | WO2021003469A2 (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3994271A4 (en) * | 2019-07-03 | 2023-07-19 | Palleon Pharmaceuticals Inc. | Recombinant sialidases and methods of using the same |
| EP3994180A4 (en) * | 2019-07-03 | 2023-08-02 | Palleon Pharmaceuticals Inc. | ANTIBODY-HER2-SIALIDASE FUSION PROTEINS AND METHODS OF USE THEREOF |
| EP3994275A4 (en) * | 2019-07-03 | 2023-11-29 | Palleon Pharmaceuticals Inc. | RECOMBINANT HUMAN SIALIDASES, SIALIDASE FUSION PROTEINS AND METHOD FOR USE THEREOF |
| US11965188B2 (en) | 2018-01-03 | 2024-04-23 | Palleon Pharmaceuticals Inc. | Recombinant human sialidases, sialidase fusion proteins, and methods of using the same |
| WO2025217138A1 (en) * | 2024-04-09 | 2025-10-16 | Palleon Pharmaceuticals Inc. | Recombinant human sialidases, sialidase fusion proteins, and methods of using the same |
| WO2026037175A1 (zh) | 2024-08-16 | 2026-02-19 | 上海宝济药业股份有限公司 | 靶向靶细胞的复合物及其应用 |
Family Cites Families (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE69415669T2 (de) * | 1993-05-17 | 1999-07-01 | Genentech, Inc., South San Francisco, Calif. | Sialidase defiziente zellen |
| US8512710B2 (en) * | 2002-11-22 | 2013-08-20 | Ansun Biopharma, Inc. | Class of therapeutic protein based molecules |
| WO2007108464A1 (ja) | 2006-03-20 | 2007-09-27 | Kyowa Hakko Kogyo Co., Ltd. | 哺乳動物由来細胞質シアリダーゼに対する抗体 |
| CN100376689C (zh) * | 2006-03-28 | 2008-03-26 | 北京大学 | 一种预测达菲类药物用药安全性的方法 |
| EP2930245B1 (en) * | 2007-10-12 | 2017-11-22 | Sigma-Aldrich Co. LLC | Cell line and methods for improved glycoprotein sialylation |
| EP2711018A1 (en) * | 2009-06-22 | 2014-03-26 | MedImmune, LLC | Engineered Fc regions for site-specific conjugation |
| AU2010315024B2 (en) * | 2009-11-06 | 2015-02-12 | Nexbio, Inc. | Methods, compounds and compositions for treatment and prophylaxis in the respiratory tract |
| WO2014167112A1 (en) * | 2013-04-12 | 2014-10-16 | Danmarks Tekniske Universitet | A mutant sialidase having trans-sialidase activity for use in production of sialylated glycans |
| WO2018006066A1 (en) * | 2016-07-01 | 2018-01-04 | The Board Of Trustees Of The Leland Stanford Junior University | Inhibitory immune receptor inhibition methods and compositions |
| CN109641038A (zh) * | 2016-07-01 | 2019-04-16 | 小利兰·斯坦福大学理事会 | 靶向细胞表面编辑的共轭物 |
| CN111183220B (zh) | 2017-05-26 | 2024-03-22 | 杰诺维斯公司 | 用于聚糖分析的工具 |
| EP3735458A4 (en) * | 2018-01-03 | 2022-04-27 | Palleon Pharmaceuticals Inc. | RECOMBINANT HUMAN SIALIDASES, SIALIDASE FUSION PROTEINS AND METHODS OF USE THEREOF |
| US20250049846A1 (en) * | 2019-01-03 | 2025-02-13 | Palleon Pharmaceuticals Inc. | Methods and compositions for treating cancer with immune cells |
| CN114258431A (zh) * | 2019-07-03 | 2022-03-29 | 帕利昂制药有限公司 | 重组人唾液酸酶、唾液酸酶融合蛋白及其使用方法 |
-
2020
- 2020-07-03 CN CN202080058167.7A patent/CN114258431A/zh active Pending
- 2020-07-03 WO PCT/US2020/040828 patent/WO2021003469A2/en not_active Ceased
- 2020-07-03 BR BR112021026789A patent/BR112021026789A2/pt unknown
- 2020-07-03 JP JP2021578065A patent/JP7777988B2/ja active Active
- 2020-07-03 US US17/624,121 patent/US20220356457A1/en active Pending
- 2020-07-03 AU AU2020301037A patent/AU2020301037A1/en active Pending
- 2020-07-03 KR KR1020227003418A patent/KR20220032576A/ko active Pending
- 2020-07-03 CA CA3145676A patent/CA3145676A1/en active Pending
- 2020-07-03 EP EP20834151.1A patent/EP3994275A4/en active Pending
-
2025
- 2025-11-18 JP JP2025197401A patent/JP2026032063A/ja active Pending
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11965188B2 (en) | 2018-01-03 | 2024-04-23 | Palleon Pharmaceuticals Inc. | Recombinant human sialidases, sialidase fusion proteins, and methods of using the same |
| EP3994271A4 (en) * | 2019-07-03 | 2023-07-19 | Palleon Pharmaceuticals Inc. | Recombinant sialidases and methods of using the same |
| EP3994180A4 (en) * | 2019-07-03 | 2023-08-02 | Palleon Pharmaceuticals Inc. | ANTIBODY-HER2-SIALIDASE FUSION PROTEINS AND METHODS OF USE THEREOF |
| EP3994275A4 (en) * | 2019-07-03 | 2023-11-29 | Palleon Pharmaceuticals Inc. | RECOMBINANT HUMAN SIALIDASES, SIALIDASE FUSION PROTEINS AND METHOD FOR USE THEREOF |
| WO2025217138A1 (en) * | 2024-04-09 | 2025-10-16 | Palleon Pharmaceuticals Inc. | Recombinant human sialidases, sialidase fusion proteins, and methods of using the same |
| WO2026037175A1 (zh) | 2024-08-16 | 2026-02-19 | 上海宝济药业股份有限公司 | 靶向靶细胞的复合物及其应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| BR112021026789A2 (pt) | 2022-05-10 |
| CN114258431A (zh) | 2022-03-29 |
| EP3994275A4 (en) | 2023-11-29 |
| AU2020301037A1 (en) | 2022-02-03 |
| KR20220032576A (ko) | 2022-03-15 |
| JP2022538894A (ja) | 2022-09-06 |
| EP3994275A2 (en) | 2022-05-11 |
| US20220356457A1 (en) | 2022-11-10 |
| CA3145676A1 (en) | 2021-01-07 |
| JP7777988B2 (ja) | 2025-12-01 |
| JP2026032063A (ja) | 2026-02-25 |
| WO2021003469A3 (en) | 2021-04-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240344046A1 (en) | Recombinant human sialidases, sialidase fusion proteins, and methods of using the same | |
| JP7777988B2 (ja) | 組換えヒトシアリダーゼ、シアリダーゼ融合タンパク質およびその使用方法 | |
| US20230265406A1 (en) | Recombinant sialidases with reduced protease sensitivity, sialidase fusion proteins, and methods of using the same | |
| EP4274614A1 (en) | Anti-pd-l1 antibodies and fusion proteins thereof | |
| EP3999549A1 (en) | Sialidase-pd-l1-antibody fusion proteins and methods of use thereof | |
| US20240059792A1 (en) | Sialidase-her2-antibody fusion proteins and methods of use thereof | |
| WO2021003463A1 (en) | Sialidase-cd20-antibody fusion proteins and methods of use thereof | |
| WO2021003465A1 (en) | Sialidase-her2-antibody fusion proteins and methods of use thereof | |
| WO2022150507A1 (en) | Sialidase-pd-1-antibody fusion proteins and methods of use thereof | |
| WO2025217138A1 (en) | Recombinant human sialidases, sialidase fusion proteins, and methods of using the same |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20834151 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2021578065 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3145676 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112021026789 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20227003418 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020301037 Country of ref document: AU Date of ref document: 20200703 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020834151 Country of ref document: EP Effective date: 20220203 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112021026789 Country of ref document: BR Free format text: APRESENTAR A TRADUCAO SIMPLES DA FOLHA DE ROSTO DA CERTIDAO DE DEPOSITO E DA CESSAO DAS PRIORIDADES US 62/870,403 E US 62/957,011 OU DECLARACAO CONTENDO, OBRIGATORIAMENTE, TODOS OS DADOS IDENTIFICADORES DESTAS CONFORME O ART. 15 DA PORTARIA 39/2021. O DOCUMENTO APRESENTADO NAO ESTA TRADUZIDO. |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20834151 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 112021026789 Country of ref document: BR Kind code of ref document: A2 Effective date: 20211229 |