WO2020257514A1 - Methods and compositions for allele specific gene editing - Google Patents

Methods and compositions for allele specific gene editing Download PDF

Info

Publication number
WO2020257514A1
WO2020257514A1 PCT/US2020/038516 US2020038516W WO2020257514A1 WO 2020257514 A1 WO2020257514 A1 WO 2020257514A1 US 2020038516 W US2020038516 W US 2020038516W WO 2020257514 A1 WO2020257514 A1 WO 2020257514A1
Authority
WO
WIPO (PCT)
Prior art keywords
allele
tmcl
bth
cell
sacas9
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/038516
Other languages
French (fr)
Inventor
Jeffrey R. HOLT
Bence GYORGY
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Boston Childrens Hospital
Original Assignee
Boston Childrens Hospital
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Boston Childrens Hospital filed Critical Boston Childrens Hospital
Publication of WO2020257514A1 publication Critical patent/WO2020257514A1/en
Priority to US17/556,463 priority Critical patent/US20220112504A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/102Mutagenizing nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1138Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/16Otologicals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/0306Animal model for genetic diseases
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/0306Animal model for genetic diseases
    • A01K2267/0318Animal model for neurodegenerative disease, e.g. non- Alzheimer's
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00Applications; Uses
    • C12N2320/10Applications; Uses in screening processes
    • C12N2320/11Applications; Uses in screening processes for the determination of target sites, i.e. of active nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00Applications; Uses
    • C12N2320/30Special therapeutic applications
    • C12N2320/34Allele or polymorphism specific uses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2330/00Production
    • C12N2330/50Biochemical production, i.e. in a transformed host cell
    • C12N2330/51Specially adapted vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • Another aspect of the invention provides a method for the allele-specific disruption of a dominant mutation, the method comprising contacting a double stranded polynucleotide comprising a mutant allele with a guide RNA that binds the mutant allele and a Cas9 nuclease with a PAM site selective for the mutant allele, such that indels are selectively induced in the mutant allele.
  • Another aspect provides a method of treating progressive hearing loss in a subject, the method includes contacting a cell of a subject heterozygous for a p.M418K mutation in TMC1 with a SaCas9-KKH and a guide RNA that targets TMC1 and inducing indels in the TMC1 allele having the p.M418K mutation, thereby treating hearing loss in the subject
  • the contacting includes transfecting cells in the subject with a guide RNA and a polynucleotide encoding a Cas9 protein.
  • the guide RNA and the Cas9 polypeptide are administered simultaneously.
  • AAV9-php.b vector is meant a viral vector comprising an AAV9-php.b polynucleotide or fragment thereof that transfects a cell of the inner ear.
  • the AAV9-php.b vector transfects at least 70% of inner hair cells and 70% of outer hair cells following administration to the inner ear of a subject or contact with a cell derived from an inner ear in vitro.
  • at least 85%, 90%, 95% or virtually 100% of inner hair cells and/or 85%, 90%, 95% or virtually 100% of outer hair cells are transfected.
  • the transfection efficiency may be assessed using a gene encoding GFP in a mouse model.
  • the sequence of an exemplary AAV9-php.b vector is provided below.
  • Cas9 CRISPR associated protein 9
  • RNA binding activity DNA binding activity
  • DNA cleavage activity e.g., endonuclease or nickase activity.
  • An exemplary Cas9 polypeptide sequence is provided below.
  • fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, preferably, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide.
  • a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
  • Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
  • Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
  • a BLAST program may be used, with a probability score between e and e 100 indicating a closely related sequence.
  • sequence identity is meant the amino acid or nucleic acid sequence identity between a sequence of interest and a reference sequence. Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
  • sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs.
  • isolated refers to material that is free to varying degrees from components which normally accompany it as found in its native state.
  • Isolate denotes a degree of separation from original source or surroundings.
  • Purify denotes a degree of separation that is higher than isolation.
  • A“purified” or“biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
  • Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high-performance liquid chromatography.
  • the term “purified” can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel.
  • modifications for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
  • an“isolated polypeptide” is meant a polypeptide of the invention that has been separated from components that naturally accompany it.
  • the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
  • the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention.
  • An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
  • marker is meant any protein or polynucleotide having an alteration in expression level or activity that is associated with a disease or disorder.
  • mechanosensation is meant a response to a mechanical stimulus. Touch, hearing, and balance of examples of the conversion of a mechanical stimulus into a neuronal signal. Mechanosensory input is converted into a response to a mechanical stimulus through a process termed“mechanotransduction.”
  • PTPRQ protein tyrosine phosphatase, receptor type Q
  • PTPRQ protein tyrosine phosphatase, receptor type Q
  • the PTPRQ promoter comprises at least about 350, 500, 1000, 2000, 3000, 4000, 5000, or more base pairs upstream of an PTPRQ coding sequence.
  • the PTPRQ promoter comprises or consists of a nucleic acid sequence having at least about 85% sequence identity to the following nucleotide sequence:
  • wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
  • stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
  • Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C.
  • subject is meant a mammal, including, but not limited to, a human or non human mammal, such as a bovine, equine, canine, ovine, or feline.
  • the terms“treat,”“treating,”“treatment,” and the like refer to reducing or ameliorating a disorder and/or symptoms associated therewith. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
  • 1G is output from a GUIDE-Seq analysis on SaCas9-KKH + gRNA 4.2 transfected Tmcl Bth/WT fibroblasts. Genomic DNA was pooled from three biological replicates for sequencing on one occasion. The number next to read is read count in the GUIDE-Seq assay.
  • FIG. 1 GACTATCATATGCTTACCGT-3’; and AAV-Anc80 denotes the vector backbone.
  • FIG. 3C shows families of ABR waveforms recorded at eight weeks from an uninjected Tmcl Bth/WT mouse (left) and a Tmcl Bth/WT mouse injected with AAV-SaCas9-KKH- gRNA-4.2 at PI (right). Arrows denote indicate threshold traces. Scale bar applies to all traces.
  • FIG. 3D includes three graphs showing ABR thresholds plotted as a function of frequency for ten injected Tmcl Bth/WT mice (plot lines without error bars).
  • FIG. 3E is a graph showing DPOAE thresholds verses stimulus frequency at 12 weeks for eight injected Tmcl Bth/WT mice (plot lines without error bars).
  • FIGs. 4A-4D illustrate human dominant mutations targetable with SaCas9 and SaCas9-KKH, and allele-specific targeting of human DFNA36.
  • FIG. 4A. is a sequence alignment illustrating gRNA design targeting a human DFNA36 allele. Mutation site is enclosed. PAM sites are marked by underlined nucleotides. Mismatching nucleotides are encircled.
  • FIG. 4B is a graph showing genome editing efficiency (indel formation percentage) in haploid TMC1 DFNA36 and TMd tt r cells after transfection with SaCas9-KKH and HI, H2, H3 gRNA (mean ⁇ SD, 3 biological replicates sequenced independently).
  • FIG. 5B includes Sanger sequencing traces from Tmcl Bth/WT or Tmcl WT/WT mouse fibroblasts transfected with SpCas9-2A-GFP with or without gRNA 1.1.
  • GFP expressing cells were sorted by FACS 4 days after transfection.
  • the mutation site is marked by red arrow. Additional peaks appearing downstream (marked by black arrowheads) of the mutation site demonstrate sequence heterogeneity and thus, indel formation. Similar results were obtained by all gRNAs from two technical replicates (forward and reverse sequencing). Genome editing is apparent both in Tmcl Bth/WT or Tmcl WT/WT cells with SpCas9 + gRNA 1.1.
  • FIG. 5B includes Sanger sequencing traces from Tmcl Bth/WT or Tmcl WT/WT mouse fibroblasts transfected with SpCas9-2A-GFP with or without gRNA 1.1.
  • FIG. 5B includes Sanger sequencing traces
  • 5E provides pie charts summarizing the targeted deep sequencing of control cells transfected with SpCas9-2A-GFP only cells, and cells transfected with SpCas9-2A-GFP and WT gRNA or SpCas9-2A-GFP and one of the three most specific gRNAs (1.1, 2.1 and 2.4) in Tmcl Bth/WT (top) Tmcl WT/WT (bottom) cells. Indels were quantified after segregating Tmcl Bth and Tmcl ⁇ reads by CRISPResso (only insertions and deletions were quantified, substitutions were ignored).
  • FIG. 6 is a graph of the number of indels based on targeted deep sequencing data from Tmcl Bth/WT and Tmcl WT/WT cell lines treated with different Cas9+gRNA combinations (from FIG. IB). Note that data points show non-normalized read counts. Cells were transfected on two different occasions (SpCas9 only and SpCas9 + gRNA 1.1 on four occasions) and genomic DNA from two independent biological samples on each transfection day were pooled for sequencing. Indels in the SaCas9-KKH treated Tmcl WT/WT lines are not different from the background (i.e. untreated samples).
  • FIG. 10A-10C illustrates ABR amplitude, latencies, and correlation of thresholds with surviving hair cells.
  • FIG. 10A is a graph of Peak 1 amplitudes measured from 8 kHz ABR waveforms at the 8-week time point (from examples shown in FIGs. 9A and 9C) for all Tmcl Bth/WT mice injected with AAV-SaCas9-KKH-gRNA-4.2 (all traces except trace denoted by arrow) and an example of an uninjected Tmcl Bth/WT (arrow).
  • FIG. 10B is a graph of Peak 1 latencies measured from 8 kHz ABR waveforms at the 8-week time point (from examples shown in FIGs.
  • FIG. IOC is a graph of the mean ABR thresholds measured at 24 weeks, evoked by 8 and 16 kHz tone bursts (from FIG. 9E) plotted as function of the mean percentage of surviving inner and outer hair cells from the 8 and 16 kHz regions (from FIG. 3H). The data were fit with a linear equation that had a slope of -2.1 dB/% and a correlation coefficient of -0.82 (line, Pearson’s r).
  • FIG. 11 is a graph illustrating the results of qPCR specific for the inverted terminal repeat (ITR) region in the transfected plasmid (AAV-CMV-SaCas9-KKH-U6-gRNA) normalized to albumin gene in HAP-1DFNA36 and HAP1WT cells. Bars show mean ⁇ S.D. Data points are from three independent biological replicates. Data for Tmcl Bth/WT is presented to the left of data for TMd tt r 111 for each condition.
  • ITR inverted terminal repeat
  • FIG. 12 is a graph showing the number of targeted deep sequencing reads with indels from TMC1 DFNA36 and TMd l cells treated with different Cas9+gRNA combinations (from FIG. 4C). Data points show non-normalized read counts. Bars show mean ⁇ S.D. Data points are from three independent biological replicates. Data for Tmcl Bth/WT is presented to the left of data for TMC1 WT/WT for each condition.
  • FIG. 13A illustrates targeted deep sequencing and CRISPResso analysis.
  • FIG. 13A is a schematic illustrating PCR and sequencing of the Tmcl gene.
  • FIG. 13B is a schematic illustrating global indel analysis by CRISPREsso, wherein reads are not segregated.
  • FIG. 13C provides a strategy to segregate Tmcl Bth reads and Tmcl wl reads. The region for splitting partly overlaps with indels, thus some reads cannot be assigned as mutant or WT.
  • FIG. 13D is a schematic illustrating allele specific indel analysis by CRISPResso.
  • the present invention features a Cas9 variant capable of selectively targeting a mutant allele without disrupting the wildtype allele, and methods of using such variants for gene editing.
  • the invention provides for the editing of dominant mutations associated with single nucleotide substitutions.
  • the invention further provides methods and compositions for treating a disease or condition or symptoms thereof associated with a dominant mutation.
  • Cas9 is a nuclease, an enzyme specialized for cutting DNA, with two active cutting sites, one for each strand of the double helix.
  • synthetic gRNAs are about 18, 19, 20, 21, 22, 25, 30, 40, 50, 60, 70, 80, 90, 100, over 100 bp and comprise a nucleic acid sequence complementary to protospacer nucleotides near the PAM sequence
  • about 10 8 to about 10 12 viral particles can be administered to a subject, and the virus can be suspended within a suitable volume (e.g., 10 pL, 50 pL, 100 pL, 500 pL, or 1000 pL) of, for example, artificial perilymph solution.
  • a suitable volume e.g. 10 pL, 50 pL, 100 pL, 500 pL, or 1000 pL
  • a virus containing a promoter e.g., an Espin promoter, a PCDH15 promoter, a PTPRQ promoter, a Myo6 promoter, a KCNQ4 promoter, a Myo7a promoter, a synapsin promoter, a GFAP promoter, a CMV promoter, a CAG promoter, a CBH promoter, a CBA promoter, a U6 promoter, and a TMHS (LHFPL5) promoter) and a polynucleotide encoding a Cas9 protein (e.g., SaCas9-KKH), and in some embodiments, a guide RNA, as described herein can be delivered to inner ear cells (e.g., cells in the cochlea) using any number of means.
  • a promoter e.g., an Espin promoter, a PCDH15 promoter, a PTPRQ promoter, a Myo6 promoter, a K
  • Retroviral vectors are particularly well developed and have been used in clinical settings.
  • a viral vector is used to administer a Cas9 polynucleotide systemically.
  • a viral vector is used to administer a Cas9 polynucleotide to a particular region of the body.
  • compositions and methods described herein enable the delivery to, and expression of, a KKH-Cas9 polynucleotide in at least 65% (e.g., at least 65, 70, 75, 80,
  • KKH-Cas9 polynucleotide delivered using an AAV-vector can result in improved structure and function of inner and outer hair cells such that hearing is restored for an extended period of time (e.g., months, years, decades, a life time).
  • an adeno-associated virus are particularly efficient at delivering nucleic acids (e.g., polynucleotides encoding a Cas9 polypeptide and, in some embodiments, a gRNA) to inner ear cells.
  • the Anc80 vector is an example of an Inner Ear Hair Cell Targeting AAV that advantageously transduced greater than about 60%, 70%, 80%, 90%, 95%, or even 100% of inner or outer hair cells.
  • One particular ancestral capsid protein that falls within the class of Anc80 ancestral capsid protein is Anc80-0065 (SEQ ID NO:2) described in International Application No. PCT/US2018/017104, which is incorporated herein by reference in its entirety.
  • WO 2015/054653 which is also incorporated herein by reference in its entirety, describes a number of additional ancestral capsid proteins that fall within the class of Anc80 ancestral capsid proteins.
  • the adeno-associated virus contains an ancestral AAV capsid protein that has a natural or engineered tropism for hair cells.
  • the virus is an Inner Ear Hair Cell Targeting AAV, which delivers a transgene (e.g., a polynucleotide encoding a Cas9 polypeptide and, in some embodiments, a gRNA) to the inner ear in a subject.
  • the virus is an AAV that comprises purified capsid polypeptides.
  • the virus is artificial.
  • the virus is an AAV that has lower seroprevalence than AAV2.
  • the virus is an exome-associated AAV.
  • the virus is an exome-associated AAVl.
  • the virus comprises a capsid protein with at least 95% amino acid sequence identity or homology to Anc80 capsid proteins.
  • Expression of a Cas9 polynucleotide may be directed by a heterologous promoter (e.g., CMV promoter, Espin promoter, a PCDH15 promoter, a PTPRQ promoter and a TMHS (LHFPL5) promoter).
  • a“heterologous promoter” refers to a promoter that does not naturally direct expression of that sequence (i.e., is not found with that sequence in nature).
  • a construct that includes a nucleic acid sequence encoding an Anc80 capsid protein and a construct carrying the polynucleotide encoding a Cas9 (and in some cases a Cas9 and a gRNA) flanked by suitable Inverted Terminal Repeats (ITRs) are provided, which allows for the transgene to be packaged within the Anc80 capsid protein.
  • the Cas9 polynucleotide (and in some embodiments, a Cas9 and a gRNA) can be packaged into an AAV containing an Anc80 capsid protein using, for example, a packaging host cell.
  • the components of a virus particle e.g., rep sequences, cap sequences, inverted terminal repeat (ITR) sequences
  • ITR inverted terminal repeat
  • a AAVs containing a AAV9-php.b vector is used to efficiently target inner ear cells.
  • AAV9-php.b is described in International Application No.
  • AAV-PHP.B encodes the 7-mer sequence TLAVPFK and efficiently delivers transgenes to the cochlea, where it showed remarkably specific and robust expression in the inner and outer hair cells.
  • An AAV-PHP.B vector can comprise, but is not limited to, any of the promoters described herein.
  • Non-viral approaches can also be employed for the introduction of therapeutic to a cell of a patient requiring inactivation of an allele carrying a mutation associated with a disease or condition or symptom thereof.
  • a nucleic acid molecule can be introduced into a cell by administering the nucleic acid in the presence of lipofection.
  • Gene transfer can also be achieved using non-viral means involving transfection in vitro. Such methods include the use of calcium phosphate, DEAE dextran, electroporation, and protoplast fusion. Liposomes can also be potentially beneficial for delivery of DNA into a cell. Transplantation of normal genes into the affected tissues of a patient can also be accomplished by transferring a normal nucleic acid into a cultivatable cell type ex vivo (e.g., an autologous or heterologous primary cell or progeny thereol), after which the cell (or its descendants) are injected into a targeted tissue.
  • a cultivatable cell type ex vivo e.g., an autologous or heterologous primary cell or progeny thereol
  • cDNA expression for use in polynucleotide therapy methods can be directed from any suitable promoter (e.g., the human cytomegalovirus (CMV), simian virus 40 (SV40), or metallothionein promoters), and regulated by any appropriate mammalian regulatory element.
  • CMV human cytomegalovirus
  • SV40 simian virus 40
  • metallothionein promoters e.g., the human cytomegalovirus (CMV), simian virus 40 (SV40), or metallothionein promoters
  • enhancers known to preferentially direct gene expression in specific cell types can be used to direct the expression of a nucleic acid.
  • the enhancers used can include, without limitation, those that are characterized as tissue- or cell-specific enhancers.
  • a recombinant therapeutic such as a recombinant a Cas9 protein, variant, or fragment thereof
  • administration of a recombinant therapeutic such as a recombinant a Cas9 protein, variant, or fragment thereof
  • the dosage of the administered protein depends on a number of factors, including the size and health of the individual patient. For any particular subject, the specific dosage regimes should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions.
  • compositions and methods are provided herein for altering a cell to inactivate a mutant allele associated with a disease or condition using a CRISPR-Cas system.
  • a Cas9 e.g., SaCas9-KKH
  • a Cas protein is used that recognizes a PAM sequence present in the mutant allele but not in the wild type (or other non-mutant form) allele.
  • the present invention provides methods of treating disease and/or disorders or symptoms thereof which comprise administering a therapeutically effective amount of a pharmaceutical composition comprising a Cas9 nuclease and a guide RNA that specifically binds a nucleic acid sequence in the genome comprising a mutation and a PAM sequence recognized by the Cas9 to a subject (e.g., a mammal such as a human), wherein the PAM sequence is not present in the allele that does not carry the mutation.
  • a subject e.g., a mammal such as a human
  • the PAM sequence is not present in the allele that does not carry the mutation.
  • a subject e.g., a mammal such as a human
  • one embodiment is a method of treating a subject suffering from or susceptible to a disease or disorder or symptom thereof associated with a mutation.
  • the method includes administering to the mammal a therapeutic amount of an amount of a compound herein sufficient to treat the disease or disorder or symptom.
  • the therapeutic methods of the invention comprise administration of a therapeutically effective amount of the compounds herein, such as a compound of the formulae herein to a subject (e.g., animal, human) in need thereof, including a mammal, particularly a human.
  • a subject e.g., animal, human
  • Such treatment will be suitably administered to subjects, particularly humans, suffering from, having, susceptible to, or at risk for a disease, disorder, or symptom thereof. Determination of those subjects“at risk” can be made by any objective or subjective determination by a diagnostic test or opinion of a subject or health care provider (e.g., genetic test, enzyme or protein marker, Marker (as defined herein), family history, and the like).
  • compositions are contemplated herein for the treatment of diseases or conditions associated with a mutation.
  • compositions comprising a Cas9 polypeptide, or a polynucleotide encoding a Cas9 polypeptide and a guide RNA that specifically binds to a nucleic acid sequence in a genome that comprises a mutation that causes or contributes to a disease or condition (e.g., dominant progressive hearing loss) as described herein may be administered directly to a region of the body (e.g., cochlea) that is affected by the disease or condition.
  • the compositions are formulated in a pharmaceutically-acceptable buffer such as physiological saline.
  • Non-limiting methods of administration include injecting into the cochlear duct or the perilymph-filled spaces surrounding the cochlear duct (e.g., scala tympani and scala vestibuli). Injecting into the cochlear duct, which is filled with high potassium endolymph fluid, could provide direct access to hair cells. However, alterations to this delicate fluid environment may disrupt the endocochlear potential, heightening the risk for injection-related toxicity.
  • the perilymph- filled spaces surrounding the cochlear duct, scala tympani and scala vestibuli can be accessed from the middle ear, either through the oval or round window membrane.
  • Treatment of human patients or non-human animals are carried out using a therapeutically effective amount of a combination therapeutic in a physiologically-acceptable carrier.
  • pharmaceutically acceptable refers to those compounds of the invention, compositions containing such compounds, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • phrases“pharmaceutically-acceptable excipient” includes pharmaceutically- acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, carrier, solvent or encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
  • Each carrier must be“acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
  • materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as com starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, com oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum, such
  • alginic acid (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) phosphate buffer solutions; and (21) other non-toxic compatible substances employed in pharmaceutical formulations.
  • this amount will range from about 1 per cent to about ninety -nine percent of active ingredient, preferably from about 5 per cent to about 70 per cent, most preferably from about 10 per cent to about 30 per cent.
  • the amount of the therapeutic agent to be administered varies depending upon the manner and mode of administration, the age and disease status (e.g., the extent of hearing loss present prior to treatment).
  • compositions are administered at a dosage that controls the clinical or physiological symptoms of the disease or condition, as may in some cases be determined by a diagnostic method known to one skilled in the art.
  • Therapeutic compounds and therapeutic combinations are administered in an effective amount.
  • about 10 8 to about 10 12 viral particles can be administered to a subject, and the virus can be suspended within a suitable volume (e.g., 10 pL, 50 pL, 100 pL, 500 pL, or 1000 pL) of, for example, artificial perilymph solution.
  • a suitable volume e.g. 10 pL, 50 pL, 100 pL, 500 pL, or 1000 pL
  • compositions and methods for treating dominant progressive hearing loss e.g., Deafness, Autosomal Dominant 36, or dominant progressive deafness 36, (DFNA36) are provided.
  • dominant progressive hearing loss e.g., Deafness, Autosomal Dominant 36, or dominant progressive deafness 36, (DFNA36)
  • DFNA36 is associated with dominant mutations (acquired or inherited) in the TMC1 gene of affected individuals.
  • a SaCas9-KKH protein along with a guide RNA that recognizes the genomic locus containing the TMC1 dominant mutant, is administered to a subject as described above.
  • SaCas9 KKH protein that recognizes the RRT PAM sequence present in the TMC1 allele carrying the dominant mutation. Mutations within the TMC1 gene can cause Deafness, Autosomal Dominant 36 (DFNA36), a dominant progressive form of deafness.
  • the SaCas9- KKH protein binds to a cleaves the TMC1 allele carrying the dominant mutation (but not the wild type allele), which promotes indel formation at the break site during non-homologous end joining. Resulting premature stop codons generate truncated, non-functional TMC1 proteins that are not dominant to the expressed wild type protein.
  • the SaCas9-KKH nuclease is administered to a subject by directly injecting a vector (e.g., AAV or lentiviral vector) encoding the SaCas9-KKH protein and a guide RNA into the cochlea of the subject.
  • a vector e.g., AAV or lentiviral vector
  • the vector only encodes the SaCas9-KKH protein and the guide RNA is administered in the injection as RNA
  • compositions comprising a Cas9 polypeptide, or a polynucleotide encoding a Cas9 polypeptide and a guide RNA that specifically binds to a nucleic acid sequence in a genome that comprises a mutation that causes or contributes to dominant progressive hearing loss as described herein may be administered directly to a region of the body (e.g., cochlea) that is affected by the disease or condition.
  • Non-limiting methods of administration include injecting into the cochlear duct or the perilymph-filled spaces surrounding the cochlear duct (e.g., scala tympani and scala vestibuli). Injecting into the cochlear duct, which is filled with high potassium endolymph fluid, could provide direct access to hair cells. However, alterations to this delicate fluid environment may disrupt the endocochlear potential, heightening the risk for injection-related toxicity.
  • the perilymph- filled spaces surrounding the cochlear duct, scala tympani and scala vestibuli can be accessed from the middle ear, either through the oval or round window membrane.
  • round window membrane which is the only non-bony opening into the inner ear, is relatively easily accessible in many animal models and administration of viral vector using this route is well tolerated. In humans, cochlear implant placement routinely relies on surgical electrode insertion through the round window membrane.
  • inactivating the mutant allele that causes DFNA36 while expressing the wildtype allele can restore auditory function in a subject.
  • the auditory function restored to a subject is about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or even about 100%.
  • Example 1 Screening Cas9 and gRNA combinations in vitro
  • the Bach ( Bth ) mouse In order to develop allele specific genome editing strategies for dominant hearing loss, the Beethoven ( Bth ) mouse was used.
  • the Bth mouse provides an excellent model for DFNA36 hearing loss in humans.
  • the Bth mutation results in an amino acid substition (p.M412K, C.T1253A) in Tmcl.
  • the mutation causes hair cell degeneration and progressive hearing loss in mice.
  • the p.M418K substitution is identical to the Bth mutation in the orthologous position and causes DFNA36, dominant progressive hearing loss.
  • GGAAGT sequence present in Tmcl Bth , but not in Tmcl ⁇ (GGATGT) may allow the PAM site of the SaCas9-KKH variant (NNNRRT) to distinguish the Tmcl Bth from the Tmcl ⁇ allele.
  • Full-length and truncated gRNAs were designed (FIG. 1A) and plasmids expressing each of these together with SaCas9-KKH were transfected into fibroblasts.
  • Indel formation in injected WT animals was not different from background even after 196 days (FIG. 2C). Indel formation was detected in the Tmcl Bth allele but not in the TincI 11 1 allele in injected Tmcl Bth/WT animals (FIGs. 2D, 2E).
  • AAV reads within the Tmcl gene were not detected (FIG. 2F) but AAV integration was evident in the Tmcl Bth allele in all injected animals at P42 or P55.
  • SaCas9-KKH-mediated disruption of the Bth allele was evaluated using hair cell mechanosensory transduction current. Although the Bth mutation eventually causes cell death, the mutation does not cause a loss of mechanosensitivity. Single-cell electrophysiology was performed on hair cells from either Tmcl wr/WT or Tmcl Bth/A mouse pups on a Tmc2 A/A background because Tmc2 contributes to mechanosensory currents and is expressed transiently at neonatal stages. After injection of AAV-SaCas9-KKH-gRNA-4.2 at PI, cochleas were dissected at P5-P7 and cultured 8-10 days, or the equivalent of P14-P16.
  • ABR Auditory brainstem responses
  • DPOAE distortion product otoacoustic emissions
  • ABR peak 1 (PI) amplitudes were in the normal range for most of the injected Bth mice at 8 weeks, in contrast to non-injected animals, which showed small PI amplitudes only at high sound intensities (FIG. 10A). Latencies of PI waves of injected Tmcl l:i " 7 animals were also normalized by injection (FIG. 10B). To test outer hair cell function, DPOAE was measured at 4, 8, 12 and 24 weeks after injection. Like the ABRs, DPOAE thresholds in injected Bth mice revealed preservation of outer hair cell function at lower frequencies (5-11 kHz) at 12 weeks of age (FIG. 3E) and in the surviving animals, up to 24 weeks of age.
  • mice were sacrificed at 24 weeks of age. Surviving hair cells were identified with an antibody for MY07A and phalloidin staining for actin. Inner and outer hair cells were present in uninjected TmcI l 117 mice and those injected with AAV-SaCas9-KKH-gRNA-4.2(FIGs. 9F, 9G). In contrast, uninjected Tmcl Bth/WT animals showed significant hair cell loss in all regions (FIGs. 3G, 3H).
  • Hair bundle morphology was evaluated with scanning electron microscopy, in Bth and WT hair cells.
  • inner and outer hair cells showed classical staircase organization of hair bundles (FIG. 31).
  • surviving hair cells from Tmcl Bth/WT animals showed significant bundle disorganization.
  • Hair cells from SaCas9-KKH-injected mice showed preservation of normal hair bundle morphology in both inner and outer hair cells (FIG. 31).
  • Example 7 Human haploid cells
  • a haploid human cell line was generated containing the p.M418K mutation in TMC1 (c.T1253A).
  • TMC1 DFNA36 and TMCI 1 cells were transfected with SaCas9-KKH and 3 different gRNAs targeting the mutant allele (FIG. 4A). Transfection efficiency was similar between the two lines (FIG.
  • pBG201 AAV-CMV-NLS(SV40)-SaCas9 (E782K/N968K/R1015H)-NLS(nucleoplasmin)-3xHA- bGHpA0-U6-BsaI-sgRNA
  • AAV-CMV-NLS(SV40)-SaCas9 E782K/N968K/R1015H)-NLS(nucleoplasmin)-3xHA- bGHpA0-U6-BsaI-sgRNA
  • TmclWT/WT and TmclBth/WT animals were treated at 37 °C with 1 mg/ml collagenase I (Worthington) for 30 minutes followed by 0.05% trypsin-EDTA treatment for 15 minutes.
  • Cells were cultured in 10% fetal bovine serum containing DMEM (Gibco) supplemented with lx penicillin/streptomycin (Gibco). Cell lines were validated by Sanger sequencing (see below).
  • Mycoplasma screening MycoAlert, Lonza, Basel was performed regularly and before transfection experiments.
  • Qiagen Blood and Tissue Kit Qiagen Blood and Tissue Kit
  • organs were harvested at different ages (FIG. 2C) and dissociated with lx collagenase I/5x dispase (Gibco) for 40 minutes in Cell Dissociation Buffer (Gibco), as described previously (Scheffer, D. I., et al, J. Neurosci. 35: 6366-80 (2015), the contents of which are incorporated herein by reference in their entirety).
  • Organs were further dissociated by passing through a 20-gauge needle 10 times.
  • DNA and RNA from cochlear tissue were isolated using a Qiagen AllPrep DNA/RNA micro kit.
  • the following primers were used: 5’- TAAAGGGACCGCTCTGAAAA-3’ (forward) and 5’-CCATCAAGGCGAGAATGAAT-3’ (reverse).
  • 5’-CCATCAAGGCGAGAATGAAT-3’ forward
  • 5’-ACCTCATCTTTTGGGCTGTG-3 reverse
  • primers were used.
  • PCR products were visualized on a 1% agarose gel using GelRed (Thermo Fisher) and purified on a column (PCR Purification Kit, Qiagen). For Sanger sequencing, 200-500 ng genomic DNA was used as template, and for targeted deep sequencing 500-1400 ng genomic DNA was used.
  • CRISPR-induced indels were analyzed by CRISPResso using two separate methods (FIGs. 13B and 13D, see below). During quantification, substitutions (only insertions and deletions were quantified) were ignored and indels outside of a 10 bp window of the CRISPR cut site were disregarded.
  • the reads were first merged with flash as described above. CRISPResso analysis was performed similarly to global indel analysis (see above). To quantify intact, non-edited reads, the following sequences were used: 5’- CATCCCCAGGAGGG-3’ and 5’- CCCTCCTGGGGATG-3’ for WT reads, and 5’- CTTCCCC AGGAGGG-3’ and 5’- CCCTCCTGGGGAAG-3’ for mutant reads.
  • Inner ear injections Inner ears of TmclBth/WT or TmclWT//WT mouse pups were injected at PI with 1 pi of Anc80-AAV-CMV-SaCas9-KKH-U6-gRNA-4.2 virus at a rate of 60 nl/min. Pups were anesthetized using hypothermia exposure in ice water for 2-3 min. Upon anesthesia, a post-auricular incision was made to expose the otic bulla and visualize the cochlea.
  • Injections were made manually with a glass micropipette. After injection, a suture was used to close the skin cut. Then, the injected mice were placed on a 42°C heating pad for recovery. Pups were returned to the mother after they fully recovered within ⁇ 10 min. Standard post-operative care was applied after surgery. Sample sizes for in vivo studies were determined on a continuing basis to optimize the sample size and decrease the variance. At P5 to P7, organs of Corti were excised from injected ears. Organ of Corti tissues were incubated at 37°C, 5% CO2 for 8-10 days, the tectorial membrane was removed immediately before electrophysiology recording.
  • ABR and DPOAE measurements were recorded using the EPL Acoustic system (Massachusetts Eye and Ear, Boston). Stimuli were generated with 24-bit digital 1-0 cards (National Instruments PXI-4461) in a PXI-1042Q chassis, amplified by a SA-1 speaker driver (Tucker-Davis Technologies, Inc.), and delivered from two electrostatic drivers (CUI CDMG15008-03 A) in a custom acoustic system. An electret microphone (Knowles FG- 23329-P07) at the end of a small probe tube was used to monitor ear-canal sound pressure. ABRs and DPOAEs were recorded from mice during the same session.
  • mice were anesthetized with intraperitoneal injection of xylazine (5-10 mg/kg) and ketamine (60-100 mg/kg), and the base of the pinna was trimmed away to expose the ear canal.
  • Three subcutaneous needle electrodes were inserted into the skin, including a) dorsally between the two ears (reference electrode); b) behind the left pinna (recording electrode); and c) dorsally at the rump of the animal (ground electrode). Additional aliquots of ketamine (60-100 mg/kg i.p.) were given throughout the session to maintain anesthesia if needed. DPOAEs were recorded first.
  • DPOAE threshold was defined from the average spectra as the L2-level eliciting a DPOAE of magnitude 5 dB above the noise floor. The mean noise floor level was under 0 dB across all frequencies.
  • ABR recordings were then recorded, with stimuli of broadband“click” tones as well as the pure tones between 5.6 and 32.0 kHz in half-octave steps, all presented as 5 ms tone pips.
  • the temporal bones of 24-week-old adult mice were harvested, and cleaned temporal bones were placed in 2.5% glutaraldehyde in 0.1 M cacodylate buffer (EMS) supplemented with 2 mM CaCh for 45 minutes.
  • EMS cacodylate buffer
  • Whole-mount tissues were dissected in distilled water and then dehydrated over the course of 4 hours to pure ethanol. Tissues were critical-point dried (Autosamdri-815, series A, Tousimis) and mounted on carbon tape attached to SEM specimen stubs. The mounted tissues were coated with 4 nm of platinum (Leica EM
  • a human cell line carrying the equivalent of the Beethoven mutation in the human TMC1 gene was engineered from the HAP1 parental cell line derived from the KBM-7 haploid cells (Horizon Genomics GmbH, Vienna, Austria)29. Briefly, a T to A point mutation was introduced in the exon 16 of the TMC1 gene (ENSG00000165091; genomic location: chr9: 72,791,914) to generate the TCCCTCCTAGGGAAGTTC sequence.
  • the HAP1 cell line was modified with the CRISPR/Cas9 nuclease using two guide RNA sequences (5’-CATCGCTTTGAAATGGCTAC-3’ and 5’-
  • AACCATGTTCATCTACAAGG-3’ AACCATGTTCATCTACAAGG-3’
  • a 1 kb donor template encompassing TMC1 exon 6 and which contained the T to A Beethoven mutation.
  • the genetic identity of the cells was verified by Sanger sequencing of a PCR amplicon.
  • the parental and HAP1 cell lines were cultured as monolayer at 37°C in a humidified atmosphere with 5% CC , using IMDM medium plus GlutaMAX (Gibco) supplemented with 10% FBS, 100 U/ml penicilin and 100 pg/ml streptomycin. Cells were passaged every 2-3 days when reaching 70-75% confluency. For transfection, the cells were grown in 6-well plates at a 70% confluency. One day later, cells were transfected with 2.5 pg pDNA using Lipofectamine 3000 (ThermoFisher), following manufacturer’s instructions. Two days after transfection, the cells were collected by trypsinization, and the pellet was stored at -20°C. Total genomic DNA was extracted from the cells with the NucleoSpin® Tissue kit
  • PCR amplicon was amplified for next-generation sequencing, using the Phusion High-Fidelity DNA Polymerase (ThermoFisher).
  • the primers used were 5’ - AGC CT AGCT C AGAAT CTTCC A-3’ and 5’-AAAATGCGTCCCAGTAGCCA-3’.
  • TMCWT cells the 5’- AAAATGCGTCCAAGTAGCCA-3’ was used due to a point mutation in the primer binding region.
  • the PCR protocol was based on manufacturer’s instruction, with 35 cycles (5 s at 98°C; 20 s at 59°C; 15 s at 72°C).
  • the PCR product was visualized on a 2% agarose gel and purified with the PCR clean-up and gel extraction kit (Macherey -Nagel AG, Switzerland). Next-generation sequencing was performed by the Massachusetts General Hospital DNA Core facility.
  • TaqMan real-time PCR was used to quantify the number of plasmid copies of the sequence contained in the AAV inverted terminal repeats using the following primers: forward: 5’-GGA ACC CCT AGT GAT GGA GTT-3’; reverse: 5 -CGG CCT CAG TGA GCG A-3’; probe: 5’-FAM-CAC TCC CTC TCT GCG CGC TCG-BHQl-3’.
  • the amount of cellular gDNA was quantified using a set of primers specific for the human albumin gene: forward: 5’-TGA AAC ATA CGT TCC CAA AGA GTT T-3’; reverse: 5’-CTC TCC TTC TCA GAA AGT GTG CAT AT-3’; probe: 5’- FAM-TGC TGA AAC ATT CAC CTT CCA TGC AGA-BHQ1-3’. Absolute number of copies were determined according to standards and used to calculate the number of plasmid copies per cell.
  • GraphPad Prism 7.0 for Mac OS and OriginPro (2015) were used for statistical analysis. To compare means, an unpaired two tailed t-test (after Shapiro-Wilk normality testing) was used; to compare multiple groups, ANOVA followed by Tukey’s post-hoc test (to compare every mean to every other mean) or Dunnetf s test (to compare every mean to a control group mean) was used p values ⁇ 0.05 were accepted as significant.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Virology (AREA)
  • Cell Biology (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The invention provides compositions and methods for allele specific gene editing. In particular, the invention provides methods and compositions for treating dominant progressive hearing loss by selectively inactivating a dominant mutation in TMC1.

Description

METHODS AND COMPOSITIONS FOR AUUEUE SPECIFIC GENE EDITING
CROSS-REFERENCE TO REUATED APPUICATIONS
This application claims priority to and the benefit of U.S. Provisional Application No. 62/864,933, filed June 21, 2019, the disclosure of which is incorporated herein by reference in its entirety.
STATEMENT OF RIGHTS TO INVENTIONS MADE UNDER FEDERAUUY
SPONSORED RESEARCH
This invention was made with government support under Grant Nos. DC013521 and DC005439 awarded by the National Institutes of Health. The government has certain rights in the invention.
BACKGROUND OF THE INVENTION
Most dominant human mutations associated with disease are single nucleotide substitutions. While gene editing strategies (e.g., CRISPR/Cas) are being developed to correct such mutations, single nucleotide discrimination and editing can be difficult to achieve for several reasons. For example, commonly used endonucleases, such as
Streptococcus pyogenes Cas9 (SpCas9), can tolerate up to seven mismatches between a guide RNA (gRNA) and a nucleic acid molecule. Furthermore, the protospacer-adjacent motif (PAM) in some Cas9 enzymes can tolerate mismatches with the target DNA. There is a need for improved gene editing compositions capable of selectively and efficiently targeting a mutant allele, but not targeting a wild-type allele.
SUMMARY OF THE INVENTION
As described below, the present invention features a Cas9 variant capable of selectively targeting a mutant allele without disrupting the wildtype allele, and methods of using such Cas9 variants to disrupt the mutant allele. In particular embodiments, the invention provides for the disruption of dominant mutations associated with single nucleotide substitutions. The invention further provides methods and compositions for treating a disease or condition or symptoms thereof associated with a dominant mutation (e.g., DFN36).
In one aspect, a method is provided for allele specific gene editing, the method includes contacting a double stranded polynucleotide having a mutant allele with a guide RNA that binds the mutant allele and a Cas9 polypeptide with a PAM site selective for the mutant allele, such that indels are selectively induced in the mutant target allele.
Another aspect of the invention provides a method for the allele-specific disruption of a dominant mutation, the method comprising contacting a double stranded polynucleotide comprising a mutant allele with a guide RNA that binds the mutant allele and a Cas9 nuclease with a PAM site selective for the mutant allele, such that indels are selectively induced in the mutant allele.
In one embodiment of the methods described above, the double stranded
polynucleotide is DNA. In an embodiment, the DNA is genomic DNA. In another embodiment, the polynucleotide is present in a cell. In another embodiment, the cell is a cell in vivo or in vitro.
In another aspect, a method is provided for the treatment of a disorder associated with a dominant mutant allele in a target gene, the method includes contacting a cell heterozygous for the dominant mutant allele in a target gene with a guide RNA that binds the target mutant allele and a Cas9 nuclease with a PAM site selective for the mutant allele and selectively inducing an indel in the mutant target allele.
Another aspect provides a method of treating progressive hearing loss in a subject, the method includes contacting a cell of a subject heterozygous for a p.M418K mutation in TMC1 with a SaCas9-KKH and a guide RNA that targets TMC1 and inducing indels in the TMC1 allele having the p.M418K mutation, thereby treating hearing loss in the subject
Another aspect of the present disclosure includes a vector having a polynucleotide encoding a SaCas9-KKH polypeptide, or a fragment thereof, and a gRNA having a nucleic acid sequence complementary to a nucleic acid sequence comprising a mutation associated with DFNA36. In one embodiment, the vector is included in a pharmaceutical composition.
In various embodiments of any of the above aspects, the cell is a cell of the inner ear In various embodiments of any of the above aspects, the cell is an inner or outer hair cell. In various embodiments of any of the above aspects, the administering improves or maintains auditory function in the subject. In various embodiments of any of the above aspects, an improvement in auditory function is associated with preservation of hair bundle morphology and/or restoration of mechanotransduction. In various embodiments of any of the above aspects, the guide RNA and the Cas9 polypeptide are encoded in a single vector. In various embodiments of any of the above aspects, the vector is an adeno-associated virus vector or a lentivirus vector. In various embodiments of any of the above aspects, the contacting includes transfecting cells in the subject with a guide RNA and a polynucleotide encoding a Cas9 protein. In various embodiments of any of the above aspects, the guide RNA and the Cas9 polypeptide are administered simultaneously.
Other features and advantages of the invention will be apparent from the detailed description and from the claims.
Definitions
Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of skill with a general definition of many of the terms used in this invention: Singleton et al, Dictionary of Microbiology and Molecular Biology (2nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). As used herein, the following terms have the meanings ascribed to them below, unless specified otherwise.
By“AAV9-php.b vector” is meant a viral vector comprising an AAV9-php.b polynucleotide or fragment thereof that transfects a cell of the inner ear. In one embodiment, the AAV9-php.b vector transfects at least 70% of inner hair cells and 70% of outer hair cells following administration to the inner ear of a subject or contact with a cell derived from an inner ear in vitro. In other embodiments, at least 85%, 90%, 95% or virtually 100% of inner hair cells and/or 85%, 90%, 95% or virtually 100% of outer hair cells are transfected. The transfection efficiency may be assessed using a gene encoding GFP in a mouse model. The sequence of an exemplary AAV9-php.b vector is provided below.
AAV9-php.b
CCAATGATACGCGTCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATT AAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGTTGTAAAACGACGGCCAGTGAGCGCGCGTAATACGACTC ACTATAGGGCGAATTGGGTACATCGACGGTATCGGGGGAGCTCGCAGGGTCTCCATTTTGAAGCGGGAGGTTTGA ACGCGCAGCCGCCATGCCGGGGTTTTACGAGATTGTGATTAAGGTCCCCAGCGACCTTGACGAGCATCTGCCCGG CATTTCTGACAGCTTTGTGAACTGGGTGGCCGAGAAGGAATGGGAGTTGCCGCCAGATTCTGACATGGATCTGAA TCTGATTGAGCAGGCACCCCTGACCGTGGCCGAGAAGCTGCAGCGCGACTTTCTGACGGAATGGCGCCGT GTGAG TAAGGCCCCGGAGGCTCTTTTCTTTGTGCAATTTGAGAAGGGAGAGAGCTACTTCCACATGCACGTGCTCGTGGA AACCACCGGGGTGAAATCCATGGTTTTGGGACGTTTCCTGAGTCAGATTCGCGAAAAACTGATTCAGAGAATTTA CCGCGGGATCGAGCCGACTTTGCCAAACTGGTTCGCGGTCACAAAGACCAGAAATGGCGCCGGAGGCGGGAACAA GGTGGTGGATGAGTGCTACATCCCCAATTACTTGCTCCCCAAAACCCAGCCTGAGCTCCAGTGGGCGTGGACTAA TATGGAACAGTATTTAAGCGCCTGTTTGAATCTCACGGAGCGTAAACGGTTGGTGGCGCAGCATCTGACGCACGT GTCGCAGACGCAGGAGCAGAACAAAGAGAATCAGAATCCCAATTCTGATGCGCCGGTGATCAGATCAAAAACTTC
AGCCAGGTACATGGAGCTGGTCGGGTGGCTCGTGGACAAGGGGATTACCTCGGAGAAGCAGTGGATCCAGGAGGA CCAGGCCTCATACATCTCCTTCAATGCGGCCTCCAACTCGCGGTCCCAAATCAAGGCTGCCTTGGACAATGCGGG AAAGATTATGAGCCTGACTAAAACCGCCCCCGACTACCTGGTGGGCCAGCAGCCCGTGGAGGACATTTCCAGCAA TCGGATTTATAAAATTTTGGAACTAAACGGGTACGATCCCCAATATGCGGCTTCCGTCTTTCTGGGATGGGCCAC GAAAAAGTTCGGCAAGAGGAACACCATCTGGCTGTTTGGGCCTGCAACTACCGGGAAGACCAACATCGCGGAGGC CATAGCCCACACTGTGCCCTTCTACGGGTGCGTAAACTGGACCAATGAGAACTTTCCCTTCAACGACTGT GTGGA CAAGATGGTGATCTGGTGGGAGGAGGGGAAGATGACCGCCAAGGTCGTGGAGTCGGCCAAAGCCATTCTCGGAGG AAGCAAGGTGCGCGTGGACCAGAAATGCAAGTCCTCGGCCCAGATAGACCCGACTCCCGTGATCGTCACCTCCAA CACCAATATGTGCGCCGTGATTGACGGGAACTCAACGACCTTCGAACACCAGCAGCCGTTGCAAGACCGGATGTT CAAATTTGAACTCACCCGCCGTCTGGATCATGACTTTGGGAAGGTCACCAAGCAGGAAGTCAAAGACTTTTTCCG GTGGGCAAAGGATCACGTGGTTGAGGTGGAGCATGAATTCTACGTCAAAAAGGGTGGAGCCAAGAAAAGACCCGC CCCCAGTGACGCAGATATAAGTGAGCCCAAACGGGTGCGCGAGTCAGTTGCGCAGCCATCGACGTCAGACGCGGA AGCTTCGATCAACTACGCGGACAGGTACCAAAACAAATGTTCTCGTCACGTGGGCATGAATCTGATGCTGTTTCC CTGCAGACAATGCGAGAGACTGAATCAGAATTCAAATATCTGCTTCACTCACGGTGTCAAAGACTGTTTAGAGTG CTTTCCCGTGTCAGAATCTCAACCCGTTTCTGTCGTCAAAAAGGCGTATCAGAAACTGTGCTACATTCATCACAT CATGGGAAAGGTGCCAGACGCTTGCACTGCTTGCGACCTGGTCAATGTGGACTTGGATGACTGTGTTTCTGAACA ATAAATGACTTAAACCAGGTATGAGTCGGCTGGATAAATCTAAAGTCATAAACGGCGCTCTGGAATTACTCAATG AAGTCGGTATCGAAGGCCTGACGACAAGGAAACTCGCTCAAAAGCTGGGAGTTGAGCAGCCTACCCTGTACTGGC ACGTGAAGAACAAGCGGGCCCTGCTCGATGCCCTGGCCATCGAGATGCTGGACAGGCATCATACCCACTTCTGCC CCCTGGAAGGCGAGTCATGGCAAGACTTTCTGCGGAACAACGCCAAGTCATTCCGCTGTGCTCTCCTCTCACATC GCGACGGGGCTAAAGTGCATCTCGGCACCCGCCCAACAGAGAAACAGTACGAAACCCTGGAAAATCAGCTCGCGT TCCTGTGTCAGCAAGGCTTCTCCCTGGAGAACGCACTGTACGCTCTGTCCGCCGTGGGCCACTTTACACTGGGCT GCGTATTGGAGGAACAGGAGCATCAAGTAGCAAAAGAGGAAAGAGAGACACCTACCACCGATTCTATGCCCCCAC TTCTGAGACAAGCAATTGAGCTGTTCGACCGGCAGGGAGCCGAACCTGCCTTCCTTTTCGGCCTGGAACTAATCA TATGTGGCCTGGAGAAACAGCTAAAGTGCGAAAGCGGCGGGCCGGCCGACGCCCTTGACGATTTTGACTTAGACA TGCTCCCAGCCGATGCCCTTGACGACTTTGACCTTGATATGCTGCCTGCTGACGCTCTTGACGATTTTGACCTTG ACATGCTCCCCGGGTAAATGCATGAATTCGATCTAGAGGGCCCTATTCTATAGTGTCACCTAAATGCTAGAGCTC GCTGATCAGCCTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCC TGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATT CTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCATGCTGGGGATG CGGTGGGCTCTATGGCTTCTGAGGCGGAAAGAACCAGCTGGGGCTCGAATCAAGCTATCAAGTGCCACCTGACGT CTCCCTATCAGTGATAGAGAAGTCGACACGTCTCGAGCTCCCTATCAGTGATAGAGAAGGTACGTCTAGAACGTC TCCCTATCAGTGATAGAGAAGTCGACACGTCTCGAGCTCCCTATCAGTGATAGAGAAGGTACGTCTAGAACGTCT CCCTATCAGTGATAGAGAAGTCGACACGTCTCGAGCTCCCTATCAGTGATAGAGAAGGTACGTCTAGAACGTCTC CCTATCAGTGATAGAGAAGTCGACACGTCTCGAGCTCCCTATCAGTGATAGAGAAGGTACCCCCTATATAAGCAG AGAGATCTGTTCAAATTTGAACTGACTAAGCGGCTCCCGCCAGATTTTGGCAAGATTACTAAGCAGGAAGTCAAG GACTTTTTTGCTTGGGCAAAGGTCAATCAGGTGCCGGTGACTCACGAGTTTAAAGTTCCCAGGGAATTGGCGGGA ACTAAAGGGGCGGAGAAATCTCTAAAACGCCCACTGGGTGACGTCACCAATACTAGCTATAAAAGTCTGGAGAAG
CGGGCCAGGCTCTCATTTGTTCCCGAGACGCCTCGCAGTTCAGACGTGACTGTTGATCCCGCTCCTCTGCGACCG CTAGCTTCGATCAACTACGCAGACAGGTACCAAAACAAGTGTTCTCGTCACGTGGGCATTAATCTGATTCTGTTT
CCCTGCAGACAATGCGAGAGAATGAATCAGAACTCAAATATCTGCTTCACTCACGGACAGAAAGACTGTTTAGAG TGCTTTCCCGTGTCAGAATCTCAACCCGTTTCTGTCGTCAAAAAGGCGTATCAGAAACTGTGCTACATTCATCAT ATCATGGGAAAGGTGCCAGACGCTTGCACTGCCTGCGATCTGGTCAATGTGGATTTGGATGACTGCATCTTTGAA CAATAAATGACTTAAGCCAGGTATGGCTGCCGATGGTTATCTTCCAGATTGGCTCGAGGACAACCTTAGTGAAGG AATTCGCGAGTGGTGGGCTTTGAAACCTGGAGCCCCTCAACCCAAGGCAAATCAACAACATCAAGACAACGCTAG AGGTCTTGTGCTTCCGGGTTACAAATACCTTGGACCCGGCAACGGACTCGACAAGGGGGAGCCGGTCAACGCAGC AGACGCGGCGGCCCTCGAGCACGACAAAGCCTACGACCAGCAGCTCAAGGCCGGAGACAACCCGTACCTCAAGTA CAACCACGCCGACGCCGAGTTCCAGGAGCGGCTCAAAGAAGATACGTCTTTTGGGGGCAACCTCGGGCGAGCAGT CTTCCAGGCCAAAAAGAGGCTTCTTGAACCTCTTGGTCTGGTTGAGGAAGCGGCTAAGACGGCTCCTGGAAAGAA GAGGCCTGTAGAGCAGTCTCCTCAGGAACCGGACTCCTCCGCGGGTATTGGCAAATCGGGTGCACAGCCCGCTAA AAAGAGACTCAATTTCGGTCAGACTGGCGACACAGAGTCAGTCCCAGACCCTCAACCAATCGGAGAACCTCCCGC AGCCCCCTCAGGTGTGGGATCTCTTACAATGGCTTCAGGTGGTGGCGCACCAGTGGCAGACAATAACGAAGGTGC CGATGGAGTGGGTAGTTCCTCGGGAAATTGGCATTGCGATTCCCAATGGCTGGGGGACAGAGTCATCACCACCAG CACCCGAACCTGGGCCCTGCCCACCTACAACAATCACCTCTACAAGCAAATCTCCAACAGCACATCTGGAGGATC TTCAAATGACAACGCCTACTTCGGCTACAGCACCCCCTGGGGGTATTTTGACTTCAACAGATTCCACTGCCACTT CTCACCACGTGACTGGCAGCGACTCATCAACAACAACTGGGGATTCCGGCCTAAGCGACTCAACTTCAAGCTCTT TAACATTCAGGTCAAAGAGGTTACGGACAACAATGGAGTCAAGACCATCGCCAATAACCTTACCAGCACGGTCCA GGTCTTCACGGACTCAGACTATCAGCTCCCGTACGTGCTCGGGTCGGCTCACGAGGGCTGCCTCCCGCCGTTCCC AGCGGACGTTTTCATGATTCCTCAGTACGGGTATCTGACGCTTAATGATGGAAGCCAGGCCGTGGGTCGTTCGTC CTTTTACTGCCTGGAATATTTCCCGTCGCAAATGCTAAGAACGGGTAACAACTTCCAGTTCAGCTACGAGTTTGA GAACGTACCTTTCCATAGCAGCTACGCTCACAGCCAAAGCCTGGACCGACTAATGAATCCACTCATCGACCAATA CTTGTACTATCTCTCTAGAACTATTAACGGTTCTGGACAGAATCAACAAACGCTAAAATTCAGTGTGGCCGGACC CAGCAACATGGCTGTCCAGGGAAGAAACTACATACCTGGACCCAGCTACCGACAACAACGTGTCTCAACCACTGT GACTCAAAACAACAACAGCGAATTTGCTTGGCCTGGAGCTTCTTCTTGGGCTCTCAATGGACGTAATAGCTTGAT GAATCCTGGACCTGCTATGGCCTCTCACAAAGAAGGAGAGGACCGTTTCTTTCCTTTGTCTGGATCTTTAATTTT TGGCAAACAAGGTACTGGCAGAGACAACGTGGATGCGGACAAAGTCATGATAACCAACGAAGAAGAAATTAAAAC TACTAACCCGGTAGCAACGGAGTCCTATGGACAAGTGGCCACAAACCACCAGAGTGCCCAAACTTTGGCGGTGCC TTTTAAGGCACAGGCGCAGACCGGTTGGGTTCAAAACCAAGGAATACTTCCGGGTATGGTTTGGCAGGACAGAGA TGT GTACCTGCAAGGACCCATTTGGGCCAAAATTCCTCACACGGACGGCAACTTTCACCCTTCTCCGCTGATGGG AGGGTTTGGAATGAAGCACCCGCCTCCTCAGATCCTCATCAAAAACACACCTGTACCTGCGGATCCTCCAACGGC CTTCAACAAGGACAAGCTGAACTCTTTCATCACCCAGTATTCTACTGGTCAAGTCAGCGTGGAGATCGAGTGGGA GCTGCAGAAGGAAAACAGCAAGCGCTGGAACCCGGAGATCCAGTACACTTCCAACTATTACAAGTCTAATAATGT TGAATTTGCTGTTAATACTGAAGGTGTATATAGTGAACCCCGCCCCATTGGCACCAGATACCTGACTCGTAATCT GTAAGTCGACTTGCTTGTTAATCAATAAACCGTTTAATTCGTTTCAGTTGAACTTTGGTCTCTGCGAAGGGCAAT TCGTTTAAACCTGCAGGACTAGAGGTCCTGTATTAGAGGTCACGTGAGT GTTTTGCGACATTTTGCGACACCATG TGGTCACGCTGGGTATTTAAGCCCGAGTGAGCACGCAGGGTCTCCATTTTGAAGCGGGAGGTTTGAACGCGCAGC CGCCAAGCCGAATTCTGCAGATATCACATGTCCTAGGAACTATCGATCCATCACACTGGCGGCCGCTCGACTAGA GCGGCCGCCACCGCGGTGGAGCTCCAGCTTTTGCGGACCGAATCGGAAAGAACATGTGAGCAAAAGGCCAGCAAA
AGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAA ATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCC
TCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGC TTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGT GTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAAC CCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTAT CGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGT GGTGGCCTAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAA AAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGA TTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAA ACT CAC GT TAAGGGAT TT T GGT CAT GAGAT TAT CAAAAAGGAT CT T CAC CT AGAT C CTTTTAAAT TAAAAAT GAA GTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTA TCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGG GCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAA ACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTT GCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGG TGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCA TGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCAC TCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGT ACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATAATA CCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCT TACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCA GCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAA TACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTG AATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTGACGTC
By“administer” is meant providing one or more compositions described herein to a subject. By way of example and without limitation, composition administration can be performed by injection, for example, into the cochlea. Other routes that deliver the composition to cells affected by a mutation can be employed. Administration can be, for example, by bolus injection or by gradual perfusion over time.
By“agent” is meant any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof.
By“alteration” is meant a change (increase or decrease) in the expression levels or activity of a gene or polypeptide as detected by standard art known methods such as those described herein. As used herein, an alteration includes a 10% change in expression levels, preferably a 25% change, more preferably a 40% change, and most preferably a 50% or greater change in expression levels.
By“ameliorate” is meant decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease. Exemplary diseases include any disease associated with a dominant mutation. In one embodiment, the disease is hearing loss associated with a dominant mutation, for example, Deafness, Deafness, Autosomal Dominant 3B, Deafness, Autosomal Dominant 9, Autosomal Dominant 11, Deafness, Autosomal Dominant 12, Deafness, Autosomal Dominant 13, Deafness, Autosomal Dominantl7, Deafness, Autosomal Dominant 20, Deafness, Autosomal Dominant 22, Deafness,
Autosomal Dominant 25, Deafness, Autosomal Dominant 36, Deafness, Autosomal
Dominant 41, Deafness, Autosomal Dominant 66, Deafness, Autosomal Dominant 68, Deafness, and Autosomal Dominant Nonsyndromic Sensorineural 39, with Dentinogenesis Imperfecta 1.
By“Anc80 polypeptide” is meant a capsid polypeptide having at least about 85% amino acid identity to the following polypeptide sequence:
MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLDKGEPVNAADA
AALEHDKAYDQQLKAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVLEPLGLVEEGAKTAP
GKKRPVEQSPQEPDSSSGIGKKGQQPARKRLNFGQTGDSESVPDPQPLGEPPAAPSGVGSNTMAAGGGAP
MADNNEGADGVGNASGNWHCDSTWLGDRVITTSTRT ALPTYNNHLYKQISSQSGGSTNDNTYFGYSTPW
GYFDFNRFHCHFSPRDWQRLINNNWGFRPKKLNFKLFNIQVKEVTTNDGTTTIANNLTSTVQVFTDSEYQ
LPYVLGSAHQGCLPPFPADVFMI PQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYTFEDVP
FHSSYAHSQSLDRLMNPLIDQYLYYLSRTQTTSGTAGNRTLQFSQAGPSSMANQAKNWLPGPCYRQQRVS
KTTNQNNNSNFAWTGATKYHLNGRDSLVNPGPAMATHKDDEDKFFPMSGVLIFGKQGAGNSNVDLDNVMI
TNEEEIKTTNPVATEEYGTVATNLQSANTAPATGTVNSQGALPGMVWQDRDVYLQGPIWAKIPHTDGHFH
PSPLMGGFGLKHPPPQILIKNTPVPANPPTTFSPAKFASFITQYSTGQVSVEIE ELQKENSKRWNPEIQ
YTSNYNKSTNVDFAVDTNGVYSEPRPIGTRYLTRNL
By“Anc80 polynucleotide” is meant a nucleic acid molecule encoding a Anc80 polypeptide.
By“Cas9 (CRISPR associated protein 9)” is meant a polypeptide or fragment thereof having at least about 85% amino acid identity to NCBI Accession No. NP_269215 and having RNA binding activity, DNA binding activity, and/or DNA cleavage activity (e.g., endonuclease or nickase activity). An exemplary Cas9 polypeptide sequence is provided below.
1 mdkkysigld igtnsvgwav itdeykvpsk kfkvlgntdr hsikknliga llfdsgetae
61 atrlkrtarr rytrrknric ylqeifsnem akvddsffhr leesflveed kkherhpifg
121 nivdevayhe kyptiyhlrk klvdstdkad lrliylalah mikfrghfli egdlnpdnsd
181 vdklfiqlvq tynqlfeenp inasgvdaka ilsarlsksr rlenliaqlp gekknglfgn
241 lialslgltp nfksnfdlae daklqlskdt ydddldnlla qigdqyadlf laaknlsdai
301 llsdilrvnt eitkaplsas mikrydehhq dltllkalvr qqlpekykei ffdqskngya 361 gyidggasqe efykfikpil ekmdgteell vklnredllr kqrtfdngsi phqihlgelh
421 ailrrqedfy pflkdnreki ekiltfripy yvgplargns rfawmtrkse etitpwnfee
481 vvdkgasaqs fiermtnfdk nlpnekvlpk hsllyeyftv yneltkvkyv tegmrkpafl
541 sgeqkkaivd llfktnrkvt vkqlkedyfk kiecfdsvei sgvedrfnas lgtyhdllki
601 ikdkdfldne enedilediv ltltlfedre mieerlktya hlfddkvmkq lkrrrytgwg
661 rlsrklingi rdkqsgktil dflksdgfan rnfmqlihdd sltfkediqk aqvsgqgdsl
721 hehianlags paikkgilqt vkvvdelvkv mgrhkpeniv iemarenqtt qkgqknsrer
781 mkrieegike lgsqilkehp ventqlqnek lylyylqngr dmyvdqeldi nrlsdydvdh
841 ivpqsflkdd sidnkvltrs dknrgksdnv pseevvkkmk nywrqllnak litqrkfdnl
901 tkaergglse ldkagfikrq lvetrqitkh vaqildsrmn tkydendkli revkvitlks
961 klvsdfrkdf qfykvreinn yhhahdayln avvgtalikk ypklesefvy gdykvydvrk
1021 miakseqeig katakyffys nimnffktei tlangeirkr plietngetg eivwdkgrdf
1081 atvrkvlsmp qvnivkktev qtggfskesi lpkrnsdkli arkkdwdpkk yggfdsptva
1141 ysvlvvakve kgkskklksv kellgitime rssfeknpid fleakgykev kkdliiklpk
1201 yslfelengr krmlasagel qkgnelalps kyvnflylas hyeklkgspe dneqkqlfve
1261 qhkhyldeii eqisefskrv iladanldkv lsaynkhrdk pireqaenii hlftltnlga
1321 paafkyfdtt idrkrytstk evldatlihq sitglyetri dlsqlggd
By“Cas 9 nucleic acid molecule” is meant a polynucleotide encoding a Cas9 polypeptide or fragment thereof. An exemplary Cas9 nucleic acid molecule sequence is provided at NCBI Accession No. NC_002737 and is shown below.
1 atggataaga aatactcaat aggcttagat atcggcacaa atagcgtcgg atgggcggtg
61 atcactgatg aatataaggt tccgtctaaa aagttcaagg ttctgggaaa tacagaccgc
121 cacagtatca aaaaaaatct tataggggct cttttatttg acagtggaga gacagcggaa
181 gcgactcgtc tcaaacggac agctcgtaga aggtatacac gtcggaagaa tcgtatttgt
241 tatctacagg agattttttc aaatgagatg gcgaaagtag atgatagttt ctttcatcga
301 cttgaagagt cttttttggt ggaagaagac aagaagcatg aacgtcatcc tatttttgga
361 aatatagtag atgaagttgc ttatcatgag aaatatccaa ctatctatca tctgcgaaaa
421 aaattggtag attctactga taaagcggat ttgcgcttaa tctatttggc cttagcgcat
481 atgattaagt ttcgtggtca ttttttgatt gagggagatt taaatcctga taatagtgat
541 gtggacaaac tatttatcca gttggtacaa acctacaatc aattatttga agaaaaccct
601 attaacgcaa gtggagtaga tgctaaagcg attctttctg cacgattgag taaatcaaga
661 cgattagaaa atctcattgc tcagctcccc ggtgagaaga aaaatggctt atttgggaat
721 ctcattgctt tgtcattggg tttgacccct aattttaaat caaattttga tttggcagaa
781 gatgctaaat tacagctttc aaaagatact tacgatgatg atttagataa tttattggcg
841 caaattggag atcaatatgc tgatttgttt ttggcagcta agaatttatc agatgctatt
901 ttactttcag atatcctaag agtaaatact gaaataacta aggctcccct atcagcttca
961 atgattaaac gctacgatga acatcatcaa gacttgactc ttttaaaagc tttagttcga
1021 caacaacttc cagaaaagta taaagaaatc ttttttgatc aatcaaaaaa cggatatgca
1081 ggttatattg atgggggagc tagccaagaa gaattttata aatttatcaa accaatttta 1141 gaaaaaatgg atggtactga ggaattattg gtgaaactaa atcgtgaaga tttgctgcgc
1201 aagcaacgga cctttgacaa cggctctatt ccccatcaaa ttcacttggg tgagctgcat
1261 gctattttga gaagacaaga agacttttat ccatttttaa aagacaatcg tgagaagatt
1321 gaaaaaatct tgacttttcg aattccttat tatgttggtc cattggcgcg tggcaatagt
1381 cgttttgcat ggatgactcg gaagtctgaa gaaacaatta ccccatggaa ttttgaagaa
1441 gttgtcgata aaggtgcttc agctcaatca tttattgaac gcatgacaaa ctttgataaa
1501 aatcttccaa atgaaaaagt actaccaaaa catagtttgc tttatgagta ttttacggtt
1561 tataacgaat tgacaaaggt caaatatgtt actgaaggaa tgcgaaaacc agcatttctt
1621 tcaggtgaac agaagaaagc cattgttgat ttactcttca aaacaaatcg aaaagtaacc
1681 gttaagcaat taaaagaaga ttatttcaaa aaaatagaat gttttgatag tgttgaaatt
1741 tcaggagttg aagatagatt taatgcttca ttaggtacct accatgattt gctaaaaatt
1801 attaaagata aagatttttt ggataatgaa gaaaatgaag atatcttaga ggatattgtt
1861 ttaacattga ccttatttga agatagggag atgattgagg aaagacttaa aacatatgct
1921 cacctctttg atgataaggt gatgaaacag cttaaacgtc gccgttatac tggttgggga
1981 cgtttgtctc gaaaattgat taatggtatt agggataagc aatctggcaa aacaatatta
2041 gattttttga aatcagatgg ttttgccaat cgcaatttta tgcagctgat ccatgatgat
2101 agtttgacat ttaaagaaga cattcaaaaa gcacaagtgt ctggacaagg cgatagttta
2161 catgaacata ttgcaaattt agctggtagc cctgctatta aaaaaggtat tttacagact
2221 gtaaaagttg ttgatgaatt ggtcaaagta atggggcggc ataagccaga aaatatcgtt
2281 attgaaatgg cacgtgaaaa tcagacaact caaaagggcc agaaaaattc gcgagagcgt
2341 atgaaacgaa tcgaagaagg tatcaaagaa ttaggaagtc agattcttaa agagcatcct
2401 gttgaaaata ctcaattgca aaatgaaaag ctctatctct attatctcca aaatggaaga
2461 gacatgtatg tggaccaaga attagatatt aatcgtttaa gtgattatga tgtcgatcac
2521 attgttccac aaagtttcct taaagacgat tcaatagaca ataaggtctt aacgcgttct
2581 gataaaaatc gtggtaaatc ggataacgtt ccaagtgaag aagtagtcaa aaagatgaaa
2641 aactattgga gacaacttct aaacgccaag ttaatcactc aacgtaagtt tgataattta
2701 acgaaagctg aacgtggagg tttgagtgaa cttgataaag ctggttttat caaacgccaa
2761 ttggttgaaa ctcgccaaat cactaagcat gtggcacaaa ttttggatag tcgcatgaat
2821 actaaatacg atgaaaatga taaacttatt cgagaggtta aagtgattac cttaaaatct
2881 aaattagttt ctgacttccg aaaagatttc caattctata aagtacgtga gattaacaat
2941 taccatcatg cccatgatgc gtatctaaat gccgtcgttg gaactgcttt gattaagaaa
3001 tatccaaaac ttgaatcgga gtttgtctat ggtgattata aagtttatga tgttcgtaaa
3061 atgattgcta agtctgagca agaaataggc aaagcaaccg caaaatattt cttttactct
3121 aatatcatga acttcttcaa aacagaaatt acacttgcaa atggagagat tcgcaaacgc
3181 cctctaatcg aaactaatgg ggaaactgga gaaattgtct gggataaagg gcgagatttt
3241 gccacagtgc gcaaagtatt gtccatgccc caagtcaata ttgtcaagaa aacagaagta
3301 cagacaggcg gattctccaa ggagtcaatt ttaccaaaaa gaaattcgga caagcttatt
3361 gctcgtaaaa aagactggga tccaaaaaaa tatggtggtt ttgatagtcc aacggtagct
3421 tattcagtcc tagtggttgc taaggtggaa aaagggaaat cgaagaagtt aaaatccgtt
3481 aaagagttac tagggatcac aattatggaa agaagttcct ttgaaaaaaa tccgattgac 3541 tttttagaag ctaaaggata taaggaagtt aaaaaagact taatcattaa actacctaaa
3601 tatagtcttt ttgagttaga aaacggtcgt aaacggatgc tggctagtgc cggagaatta
3661 caaaaaggaa atgagctggc tctgccaagc aaatatgtga attttttata tttagctagt
3721 cattatgaaa agttgaaggg tagtccagaa gataacgaac aaaaacaatt gtttgtggag
3781 cagcataagc attatttaga tgagattatt gagcaaatca gtgaattttc taagcgtgtt
3841 attttagcag atgccaattt agataaagtt cttagtgcat ataacaaaca tagagacaaa
3901 ccaatacgtg aacaagcaga aaatattatt catttattta cgttgacgaa tcttggagct
3961 cccgctgctt ttaaatattt tgatacaaca attgatcgta aacgatatac gtctacaaaa
4021 gaagttttag atgccactct tatccatcaa tccatcactg gtctttatga aacacgcatt
4081 gatttgagtc agctaggagg tgactga
SaCas9:
MAPKKKRKVGIHGVPAAKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRR RRHRIQRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEEDTGNELST KEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQKAYHQLDQSFIDTYIDLLETRR TYYEGPGEGSPFGWKDIKEWYEMLMGHCTYFPEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQI I ENVFKQKKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEIIENAELLDQIAKILTIYQ SSEDIQEELTNLNSELTQEEIEQI SNLKGYTGTHNLSLKAINLILDELWHTNDNQIAI FNRLKLVPKKVDLSQQK EIPTTLVDDFILSPWKRSFIQSIKVINAIIKKYGLPNDIIIELAREKNSKDAQKMINEMQKRNRQTNERIEEII RTTGKENAKYLIEKIKLHDMQEGKCLYSLEAIPLEDLLNNPFNYEVDHI IPRSVSFDNSFNNKVLVKQEENSKKG NRTPFQYLSSSDSKISYETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNLVDTRYATRGLMNL LRSYFRVNNLDVKVKSINGGFTSFLRRKWKFKKERNKGYKHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFE EKQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKYSHRVDKKPNRELINDTLYSTRKDDKGNTLIVNNLNGLY DKDNDKLKKLINKSPEKLLMYHHDPQTYQKLKLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYG NKLNAHLDITDDYPNSRNKWKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKCYEEAKKLKKI SNQ AEFIASFYNNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKTIASKTQSIKKYSTDI LGNLYEVKSKKHPQIIKKGKRPAATKKAGQAKKKKGS
SaCas9-KKH
Bold and underlined denotes variation from SaCas9
MAPKKKRKVGIHGVPAAKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRR RRHRIQRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEEDTGNELST KEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQKAYHQLDQSFIDTYIDLLETRR TYYEGPGEGSPFGWKDIKEWYEMLMGHCTYFPEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQI I ENVFKQKKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEIIENAELLDQIAKILTIYQ SSEDIQEELTNLNSELTQEEIEQI SNLKGYTGTHNLSLKAINLILDELWHTNDNQIAI FNRLKLVPKKVDLSQQK EIPTTLVDDFILSPWKRSFIQSIKVINAIIKKYGLPNDIIIELAREKNSKDAQKMINEMQKRNRQTNERIEEII RTTGKENAKYLIEKIKLHDMQEGKCLYSLEAIPLEDLLNNPFNYEVDHI IPRSVSFDNSFNNKVLVKQEENSKKG NRTPFQYLSSSDSKISYETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNLVDTRYATRGLMNL LRSYFRVNNLDVKVKSINGGFTSFLRRKWKFKKERNKGYKHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFE EKQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKYSHRVDKKPNRKLINDTLYSTRKDDKGNTLIVNNLNGLY DKDNDKLKKLINKSPEKLLMYHHDPQTYQKLKLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYG NKLNAHLDITDDYPNSRNKWKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKCYEEAKKLKKI SNQ AEFIASFYKNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREYLENMNDKRPPHIIKTIASKTQSIKKYSTDI LGNLYEVKSKKHPQIIKKGKRPAATKKAGQAKKKKGS
Kleinstiver et al. (Nat Biotechnol. 2015 Dec;33(12): 1293-1298. doi:
10.1038/nbt.3404. Epub 2015 Nov 2) describes SaCas9- KKH.
“Detect” refers to identifying the presence, absence or amount of the analyte to be detected.
By“detectable label” is meant a composition that when linked to a molecule of interest renders the latter detectable, via spectroscopic, photochemical, biochemical, immunochemical, or chemical means. For example, useful labels include radioactive isotopes, magnetic beads, metallic beads, colloidal particles, fluorescent dyes, electron-dense reagents, enzymes (for example, as commonly used in an ELISA), biotin, digoxigenin, or haptens.
By“disease” is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ. Examples of diseases include any pathology, such as a hearing disorder, associated with a dominant mutation.
By“effective amount” is meant the amount of an agent required to ameliorate the symptoms of a disease relative to an untreated patient. The effective amount of active compound(s) used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the ahending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an“effective” amount.
By“fragment” is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, preferably, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide. A fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
“Hybridization” means hydrogen bonding, which may be Watson-Crick, Hoogsteen or reversed Hoogsteen hydrogen bonding, between complementary nucleobases. For example, adenine and thymine are complementary nucleobases that pair through the formation of hydrogen bonds. By“identity” is meant the amino acid or nucleic acid sequence identity between a sequence of interest and a reference sequence. Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e and e 100 indicating a closely related sequence.
By“identity” is meant the amino acid or nucleic acid sequence identity between a sequence of interest and a reference sequence. Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e 3 and e 100 indicating a closely related sequence.
The term“indel” refers to the insertion or deletion of at least one nucleotide at a locus in a nucleic acid molecule. An indel present in the coding region of a gene may result in a frameshift mutation resulting in a premature stop codon or other signal for the expressed protein to be degraded.
The terms“isolated,”“purified,” or“biologically pure” refer to material that is free to varying degrees from components which normally accompany it as found in its native state. “Isolate” denotes a degree of separation from original source or surroundings.“Purify” denotes a degree of separation that is higher than isolation. A“purified” or“biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high-performance liquid chromatography. The term “purified” can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
By“isolated polynucleotide” is meant a nucleic acid (e.g., a DNA) that is free of the genes which, in the naturally-occurring genome of the organism from which the nucleic acid molecule of the invention is derived, flank the gene. The term therefore includes, for example, a recombinant DNA that is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote; or that exists as a separate molecule (for example, a cDNA or a genomic or cDNA fragment produced by PCR or restriction endonuclease digestion) independent of other sequences. In addition, the term includes an RNA molecule that is transcribed from a DNA molecule, as well as a recombinant DNA that is part of a hybrid gene encoding additional polypeptide sequence.
By an“isolated polypeptide” is meant a polypeptide of the invention that has been separated from components that naturally accompany it. Typically, the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated. Preferably, the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention. An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
By“marker” is meant any protein or polynucleotide having an alteration in expression level or activity that is associated with a disease or disorder. By“mechanosensation” is meant a response to a mechanical stimulus. Touch, hearing, and balance of examples of the conversion of a mechanical stimulus into a neuronal signal. Mechanosensory input is converted into a response to a mechanical stimulus through a process termed“mechanotransduction.”
As used herein,“obtaining” as in“obtaining an agent” includes synthesizing, purchasing, or otherwise acquiring the agent.
As used herein, the terms“prevent,”“preventing,”“prevention,”“prophylactic treatment” and the like refer to reducing the probability of developing a disorder or condition in a subject, who does not have, but is at risk of or susceptible to developing a disorder or condition.
By "promoter" is meant a polynucleotide sufficient to direct transcription of a downstream polynucleotide.
By“Espin promoter” is meant a regulatory polynucleotide sequence derived from NCBI Reference Sequence: NG_015866.1 that is sufficient to direct expression of a downstream polynucleotide in an outer or inner hair cell, vestibular hair cell, a spiral ganglion, or a vestibular ganglion. In one embodiment, the Espin promoter comprises or consists of at least about 350, 500, 1000, 2000, 3000, 4000, 5000, or more base pairs upstream of an Espin coding sequence.
By“protocadherin related 15 (PCDH15) promoter” is meant a regulatory
polynucleotide sequence derived from NCBI Reference Sequence: NG_009191 that is sufficient to direct expression of a downstream polynucleotide in an outer or inner hair cell, vestibular hair cell, a spiral ganglion, or a vestibular ganglion. In one embodiment, the PCDH15 promoter comprises at least about 350, 500, 1000, 2000, 3000, 4000, 5000, or more base pairs upstream of an PCDH15 coding sequence. In some embodiments, the PCDH15 promoter comprises or consists of a nucleic acid sequence having at least about 85% sequence identity to the following nucleotide sequence:
TCTTCACCTGTCATTTTCAACCAGCCTCAGCCTATCTGCTCTGTCACAATCACTACTAAAATATGTTCCTAAATT GCTTGTTTCTAGATCCTTCCTTCTCATATGCTCAGGTGAACACATGGGTGAAATTTAATATGGAATTGAAATATG TACTATGCAAGATAGATTCCTTAAGAAATGTTTCTCTGATTTATATGACATAATTGTATTTTACTAGTTTACCTG TCCATCTGTAAAACTTTGTTTTGGAGATTTCATATATTACAATGTTTAAGAAATATGCTATAATGTTTTGTATAG TATATTTCTTCGTGATAACCTTATATACTACCAGTCACACGTGTTTGTAAAAATCTAAAGAGTACTTTTGGCTCC TACAGAATGT GTGAAGTTGTGAAATTGTTTTTTTGTTTTGTTTTGTTTTGTTTTTATGCCCCAAAGATGTGGAGG GCTTCATATAAGAGGGTAGATTTAATGAGAGAGAGAGGGAGAGACAGAGAGAATGATAAAAGAAGCTTAAGAGAT TATTTTATCTTGTCAACGACATTGTTATTGAATGTAAGCTGCTAAACTTCTTAGATAAAGTAAAACAGTAAAAAC
AAACACACAAAACAGAACAGAGAAT CAT CAGACAGGCT GAC GAACACAGTACAATAAAGCAGC CAGTACC GAT GA TCAGTGGACATCAATTTGTCTTTTGGGCTGTAGCACCTGCTACTAATTGGTGCAAAGCGCTCACCAGTCAGTGCG
TGGTTTAGCGCACTCAGCTGTCTCCTGTATGTGCTGCGAGAAGCAAGATAGCTAATTGCTGTTGCTTCAGTGCCA
GTGAAATCAACGTGCTGAGCTAATAGCGACAGATAGAGGGCAGACAGATTCCTGCTAGCAGCTTAGTGTTAGTTG
CTTGTGGTAACTAAGGCAGGTGGCATACATCTCAGAACGTGGAGAATGATGGTATGCTTTCTGA
By“protein tyrosine phosphatase, receptor type Q (PTPRQ) promoter” is meant a regulatory polynucleotide sequence derived from GenelD: 374462 that is sufficient to direct expression of a downstream polynucleotide in an outer or inner hair cell, vestibular hair cell, a spiral ganglion, or a vestibular ganglion. In one embodiment, the PTPRQ promoter comprises at least about 350, 500, 1000, 2000, 3000, 4000, 5000, or more base pairs upstream of an PTPRQ coding sequence. In some embodiments, the PTPRQ promoter comprises or consists of a nucleic acid sequence having at least about 85% sequence identity to the following nucleotide sequence:
TGGTAGCCTCCCTAGAGACACAGAGCTGGGCCGGATGAGTCCAGGCACTGACGTGATCCATTATCTTTCACCTTA
AAGAGTAAAAGGGAAACTAAAGTTAATTACCTCCACGAAACAAAAAGGTGCCTTCTTGTGCTTCAATTACATGGA
TATATTCTACTAGTCTAAAAGTATCTTCTCACTTCTTTCTGTCACTGTGAGGACTTGAGTCAGAAGAAAGTTTAA
ATACAGTCATTGAGCTGGAAAGAGTGGAAAGAGAAGCAAAGAGGGGGAAGCTGTAGGAAGGACGAAGTCACCCCC
AAGATACATGGTTACTGCTTACACCAAGCAAGCTGCCTTGGGAACGCTTCCCCCGAGCAGCCAGAATGCTCAGCA
GTGGAAGACACCTCTATTCCTGTAGGCGAGTCCTGGGAAGCTGGTCAATCTGCAAATGCCAATTCCCAGCAGTGA
GCTCGGTCCACGTGTAAATCAAGATTTGGGGAAAGAGTAGGGTGGGTGGCATGGTTGACAATGTCATCAGCTCCC
TCCTCTGACTCCTGTGGTCGTGCCCCCATCTACTCTCACTCAGCTACACCCCACCTTCGGATTTGTGATGGACGC
TGGGTCCCTAGTAACCACAGCAAGTGTCTCCCCCGCACTTCCCCCTTCCCCACCCCCACCCCCACCCCCAACCAC
CACCCCAGCGATGGAGCCTACTCTGCTCCAAGCCGCCGCTAAGACCCGGAGAAGCGGAATTTCACTTTGAAATTC
CCTTGCCTCGTGAGGGCCGGCGCTGGGCATGCTCAGTAGCCGCGGCGCTGCTGCTGGGCTGCTGGGCTGGCGCGG
AGTCCACCCTGCCGTCTCCGCCTTGGCTTCTGGGCGTCCAGAAGGCCAGGCATTTGCCGCCTCTGAGCGCTTCTG
TTCCCCTTACCCGCAACCTCCTACTGCTCTTCCTCTCTCCCTCTCTTAGGGAGGTTGAAGCTGGTGCTGGTTTCT
GTCGGCGCCACAGACTGACTGCTCTGCAAACCCCAGCCGAGGACCTGAATCCCGGAGACTAGAAG
By“lipoma HMGIC fusion partner-like 5 (LHFPL5) promoter” also termed“TMHS promoter” is meant a regulatory polynucleotide sequence derived from NCBI Reference Sequence: GenelD: 222662 that is sufficient to direct expression of a downstream polynucleotide in an outer or inner hair cell, vestibular hair cell, a spiral ganglion, or a vestibular ganglion. In one embodiment, the TMHS promoter comprises at least about 350, 500, 1000, 2000, 3000, 4000, 5000, or more base pairs upstream of an PCDH15 coding sequence. In some embodiments, the TMHS promoter comprises or consists of a nucleic acid sequence having at least about 85% sequence identity to the following nucleotide sequence:
GCCCAGTGGAATTTTCCTAGTTCTTTACACTAGCCATGTATTTACCTATAAAATCAGGAGAAATAT GTATATATA TAATATATTAAAACATATATATATTTAAATGGGGAAATATGTAACAAACAAATAGAAACAAGGGGAGAAAGGCAT
TGTATTTGACAAAACACATATGTTCAGGTCTGAGAAGGCTCATAAAGAATGTTGTCTGCTATACTTTGTAGTTGC TTCTGTTATCACACAATCAGTCTGCATATACAGGCGTTTTATATATATATTTATATAGACTACATATATACGTAT
ATTATATATGTAAATATTTCACTGTCTTTGAGGACGGGGGCCCTGTCTTTTTTATCTGTGGTTTTGCTTAGATGT
CCTCCAACATAATCTTAACACATAGTATGCTTTTAGAAATCGTTGACTGAATGCTAAGGACGAAAAACCGGTGAC
CAGAAGGCAACCAGGAAAGGCTTTGCTGACCTCCGGAGTGGTGGAGTTGGAGGTTCTGGGAAGGCGACTAGGGAG
CCAGGCAGGGGCGGGGTGGGATGGGATGTGGACAGCGCTTTTGCGGGGGGAAAGCGTTTTTGCTGCTGGAATTGA
GCAGTAGGAATGTGTCAGTCACATCCCCACCTTCCCAATTCTTGTCATCTCGGTTCAGGAAGGTGAACGGTGTTC
CGATTCCCCGCGGCGGGGGCCTGTAGTGGGAGCTCTGCCCCTTCCCCGCCTCTGCTGCAGGCCCCGCCCCTCGCC
CGGAACCCCGGGGCGCTGGCCGCGGTGCTGAAACGGCGCCCTCCGCGGACGGAGGAGGGGGCGGGGCTCTCGGGA
GCCGTGAGCCGGGAAGAGGGAGACGGGCAGGGCGGCGCCAGCAGGCCCTGGTGGGCTTGGGAGGAGGCAGGAGAC
TGGAGACAGCCTCGGCTAGAGCGGACACAGGCACCTGGCAAGCTTTCCTTGACCAAATCAAGGT
By“synapsin promoter” also termed“Syn promoter” is meant a regulatory polynucleotide sequence comprising or consisting of a nucleic acid sequence sufficient to direct expression of a downstream polynucleotide in an outer or inner hair cell, a vestibular hair cell, a spiral ganglion, or a vestibular ganglion and having at least about 85% sequence identity to the following nucleotide sequence:
tctagactgcagagggccctgcgtatgagtgcaagtgggttttaggaccaggatgaggcggggtgggggtgccta cctgacgaccgaccccgacccactggacaagcacccaacccccattccccaaattgcgcatcccctatcagagag ggggaggggaaacaggatgcggcgaggcgcgtgcgcactgccagcttcagcaccgcggacagtgccttcgccccc gcctggcggcgcgcgccaccgccgcctcagcactgaaggcgcgctgacgtcactcgccggtcccccgcaaactcc ccttcccggccaccttggtcgcgtccgcgccgccgccggcccagccggaccgcaccacgcgaggcgcgagatagg gggGcacgggcgcgaccatctgcgctgcggcgccggcgactcagcgctgcctcagtctgcggtgggcagcggagg agtcgtgtcgtgcctgagagcgcagtc
By“reduces” is meant a negative alteration of at least 10%, 25%, 50%, 75%, or
100%.
By“reference” is meant a standard or control condition.
A“reference sequence” is a defined sequence used as a basis for sequence comparison. A reference sequence may be a subset of or the entirety of a specified sequence; for example, a segment of a full-length cDNA or gene sequence, or the complete cDNA or gene sequence. For polypeptides, the length of the reference polypeptide sequence will generally be at least about 16 amino acids, preferably at least about 20 amino acids, more preferably at least about 25 amino acids, and even more preferably about 35 amino acids, about 50 amino acids, or about 100 amino acids. For nucleic acids, the length of the reference nucleic acid sequence will generally be at least about 50 nucleotides, preferably at least about 60 nucleotides, more preferably at least about 75 nucleotides, and even more preferably about 100 nucleotides or about 300 nucleotides or any integer thereabout or therebetween.
By“specifically binds” is meant a compound or antibody that recognizes and binds a polypeptide of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which naturally includes a polypeptide of the invention.
Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having“substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule. Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having“substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule.
By“hybridize” is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency. (See, e.g., Wahl, G. M. and S. L. Berger (1987) Methods Enzymol. 152:399; Kimmel, A. R. (1987) Methods Enzymol. 152:507).
For example, stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate. Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide. Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C. Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art. Various levels of stringency are accomplished by combining these various conditions as needed. In a preferred: embodiment, hybridization will occur at 30° C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS. In a more preferred embodiment, hybridization will occur at 37° C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 pg/ml denatured salmon sperm DNA (ssDNA). In a most preferred embodiment, hybridization will occur at 42° C in 250 mM NaCl, 25 mM trisodium citrate,
1% SDS, 50% formamide, and 200 pg/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
For most applications, washing steps that follow hybridization will also vary in stringency. Wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature. For example, stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate. Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C. In a preferred embodiment, wash steps will occur at 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42 C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS.
Additional variations on these conditions will be readily apparent to those skilled in the art. Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196: 180, 1977); Grunstein and Hogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001); Berger and Kimmel (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York.
By“substantially identical” is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein). Preferably, such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705,
BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine;
aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e 3 and e 100 indicating a closely related sequence.
By“subject” is meant a mammal, including, but not limited to, a human or non human mammal, such as a bovine, equine, canine, ovine, or feline.
By“TMC1 polypeptide” is meant a polypeptide having at least about 85% or greater amino acid sequence identity to NCBI Reference Sequence: NP_619636.2 or a fragment thereof having mechanotransduction channel activity. An exemplary amino acid sequence of TMC1 is provided below:
1 mspkkvqikv eekedetees sseeeeeved klprreslrp krkrtrdvin eddpepeped 61 eetrkareke rrrrlkrgae eeeideeele rlkaeldekr qiiatvkckp wkmekkievl 121 keakkfvsen egalgkgkgk rwfafkrarama kkwakflrdf enfkaacvpw enkikaiesq
181 fgssvasyfl flrwmygvnm vlfiltfsli mlpeylwglp ygslprktvp raeeasaanf
241 gvlydfngla qysvlfygyy dnkrtig mn frlplsyflv gimcigysfl vvlkamtkni
301 gddgggddnt fnfswkvfts wdylignpet adnkfnsitm nfkeaiteek aaqveenvhl
361 irflrflanf fvfltlggsg ylifwavkrs qefaqqdpdt lgwweknemn mwisllgmfc
421 ptlfdlfael edyhplialk wllgrifall lgnlyvfila lmdeinnkie eeklvkanit
481 lweanmikay nasfsenstg ppffvhpadv prgpcwetmv gqefvrltvs dvlttyvtil
541 igdflracfv rfcnycwcwd leygypsyte fdisgnvlal ifnqgmiwmg sffapslpgi
601 nilrlhtsmy fqcwawiccn vpearvfkas rsnnfylgml llilflstmp vlymivslpp
661 sfdcgpfsgk nrmfeviget lehdfps ma kilrqlsnpg lviavilvmv laiyylnata
721 kgqkaanldl kkkmkmqale nkmrnkkmaa araaaaagrq
By“TMC1 polynucleotide” is meant a polynucleotide encoding a TMCl polypeptide. The sequence of an exemplary TMC1 polynucleotide is provided at NCBI Reference Sequence: NM_138691.2, which is reproduced below:
1 cagaaactat gagggcagaa cccagcaatc tgtgctttct ttcacaagcc ctccaggagt
61 tgctgaaatt taggaatcat tgccccaaaa agtggccctc ataatgatgc cagatgggat 121 cttactctgt tgcccaggct ggagtgcagt ggtgcgatct cggctctctg caacctccgc
181 ctcccaggtt caagtgattc tcctgcctcg gcctcctgag tagctgggat ttcaggccat
241 gaaagatcac tgttttagtc tgcgtggtgc agtggaacag atagacctcg gtttgaatct 301 cagctctact gtttactaga catgaaatgg ggaaatctaa aatgagatgc cagaagcctc
361 aaaaatggaa aaccccctgt gcttcacatc tgaaaatctc tgctgggggc agcaactttg
421 agcctgtggg gaaggaactg tccacgtgga gtggtctggt gaatgcttaa ggagctgcag
481 aagggaagtc cctctccaaa ctagccagcc actgagacct tctgacagga cacccccagg
541 atgtcaccca aaaaagtaca aatcaaagtg gaggaaaaag aagacgagac tgaggaaagc
601 tcaagtgaag aggaagagga ggtggaagat aagctacctc gaagagagag cttgagacca
661 aagaggaaac ggaccagaga tgttatcaat gaggatgacc cagaacctga accagaggat
721 gaagaaacaa ggaaggcaag agaaaaagag aggaggagga ggctaaagag aggagcagaa
781 gaagaagaaa ttgatgaaga ggaattggaa agattgaagg cagagttaga tgagaaaaga
841 caaataattg ctactgtcaa atgcaaacca tggaagatgg agaagaaaat tgaagttctc
901 aaggaggcaa aaaaatttgt gagtgaaaat gaaggggctc ttgggaaagg aaaaggaaaa
961 cggtggtttg catttaagat gatgatggcc aagaaatggg caaaattcct ccgtgatttt
1021 gagaacttca aagctgcgtg tgtcccatgg gaaaataaaa tcaaggctat tgaaagtcag
1081 tttggctcct cagtggcctc atacttcctc ttcttgagat ggatgtatgg agtcaatatg
1141 gttctcttta tcctgacatt tagcctcatc atgttgccag agtacctctg gggtttgcca
1201 tatggcagtt tacctaggaa aaccgttccc agagccgaag aggcatcggc agcaaacttt
1261 ggtgtgttgt acgacttcaa tggtttggca caatattccg ttctctttta tggctattat
1321 gacaataaac gaacaattgg atggatgaat ttcaggttgc cgctctccta ttttctagtg
1381 gggattatgt gcattggata cagctttctg gttgtcctca aagcaatgac caaaaacatt
1441 ggtgatgatg gaggtggaga tgacaacact ttcaatttca gctggaaggt ctttaccagc
1501 tgggactacc tgatcggcaa tcctgaaaca gcagacaaca aatttaattc tatcacaatg
1561 aactttaagg aagctatcac agaagaaaaa gcagcccaag tagaagaaaa cgtccacttg
1621 atcagattcc tgaggtttct ggctaacttc ttcgtgtttc taacacttgg agggagtgga
1681 tacctcatct tttgggctgt gaagcgatcc caggaatttg cacagcaaga tcctgacacc
1741 cttgggtggt gggaaaaaaa tgaaatgaac atggttatgt ccctcctagg gatgttctgt
1801 ccaacattgt ttgacttatt tgctgaatta gaagactacc atcctctcat cgctttgaaa
1861 tggctactgg gacgcatttt tgctcttctt ttaggcaatt tatacgtatt tattcttgca
1921 ttaatggatg agattaacaa caagattgaa gaggagaagc tagtaaaggc caatattacc
1981 ctttgggaag ccaatatgat caaggcctac aatgcatcat tctctgaaaa tagcactgga
2041 ccaccctttt ttgttcaccc tgcagatgta cctcgaggac cttgctggga aacaatggtg
2101 ggacaggagt ttgtgaggct gacagtctct gatgttctga ccacctacgt cacaatcctc
2161 attggggact ttctaagggc atgttttgtg aggttttgca attattgctg gtgctgggac
2221 ttggagtatg gatatccttc atacaccgaa ttcgacatca gtggcaacgt cctcgctctg
2281 atcttcaacc aaggcatgat ctggatgggc tccttctttg ctcccagcct cccaggcatc
2341 aatatccttc gactccatac atccatgtac ttccagtgct gggccgttat gtgctgcaat
2401 gttcctgagg ccagggtctt caaagcttcc agatcaaata acttctacct gggcatgcta
2461 ctgctcatcc tcttcctgtc cacaatgcct gtcttgtaca tgatcgtgtc cctcccacca
2521 tcttttgatt gtggtccatt cagtggcaaa aatagaatgt ttgaagtcat tggagagacc
2581 ctggagcacg atttcccaag ctggatggcg aagatcttga gacagctttc aaaccctggg
2641 ctggtcattg ctgtcatttt ggtgatggtt ttggccatct attatctcaa tgctactgcc
2701 aagggccaga aggcagcgaa tctggatctc aaaaagaaga tgaaaatgca agctttggag
2761 aacaaaatgc gaaacaagaa aatggcagct gcacgagcag ctgcagctgc tggtcgccag
2821 taataagtat cctgagagcc cagaaaaggt acactttgcc ttgctgttta aaagtaatgc 2881 aatatgtgaa cgcccagaga acaagcactg tggaactgct attttcctgt tctacccttg 2941 atggattttc aaggtcatgc tggccaatta aggcatcatc agtcctacct gagcaacaag 3001 aatctaaact ttattccaag tcagaaactg tttctgcaga gccactctct cccctgctcc 3061 atttcgtgac tttttttttt tttttaacaa attgagttta gaagtgagtg taatccagca
3121 atacagttta ctggtttagt tggtgggtta attaaaaaaa atttgctcat atgaactttc 3181 attttatatg tttcttttgc c
As used herein, the terms“treat,”“treating,”“treatment,” and the like refer to reducing or ameliorating a disorder and/or symptoms associated therewith. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
Unless specifically stated or obvious from context, as used herein, the term“or” is understood to be inclusive. Unless specifically stated or obvious from context, as used herein, the terms“a”,“an”, and“the” are understood to be singular or plural.
Unless specifically stated or obvious from context, as used herein, the term“about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
In this disclosure,“comprises,”“comprising,”“containing” and“having” and the like can have the meaning ascribed to them in U.S. Patent law and can mean“includes,” “including,” and the like;“consisting essentially of’ or“consists essentially” likewise has the meaning ascribed in U.S. Patent law and the term is open-ended, allowing for the presence of more than that which is recited so long as basic or novel characteristics of that which is recited is not changed by the presence of more than that which is recited, but excludes prior art embodiments.
Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40,
41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
The recitation of a listing of chemical groups in any definition of a variable herein includes definitions of that variable as any single group or combination of listed groups. The recitation of an embodiment for a variable or aspect herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof. Any compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
BRIEF DESCRIPTION OF THE DRAWINGS FIGs. 1A-1G illustrate targeting the TmclBth allele with high-fidelity SpCas9s and SaCas9-KKH. FIG. 1A is a sequence alignment illustrating gRNA design. Mutation site is enclosed. PAM sites are marked by underlined nucleotides. Mismatching nucleotides are encircled. SaCas9-KKH: KKH PAM variant of SaCas9,eSpCas9(l.l), HypaCas9 and SpCas9-HFl are different high fidelity variants of SpCas9 (used in combination with 1.1 gRNA, as shown in FIG. 5A). FIG. IB is a graph showing gene editing efficiency as measured by mean indel percentage in TmclBth/wr and TmclWT/WT fibroblasts determined by targeted deep-sequencing and CRISPResso analysis. SpCas9 with 1.1, 2.1 and 2.4 gRNA represent the same conditions as in FIG. 5 (except that cells were not sorted for GFP expression); however, experiments were repeated to allow for head-to-head comparison with SaCas9-KKH and high fidelity SpCas9 enzymes. Cells were transfected on two different occasions (SpCas9 only and SpCas9 + gRNAl. l on four occasions) and genomic DNA from two independent biological samples on eachtransfection day were pooled for sequencing.
Data for TmclBth/WT is presented to the left of data for TMC1WT/WT for each condition. FIG.
1C is a graph showing gene editing efficiency as measured by allele-specific indel analysis of the samples from FIG. IB in Tmc I l:ih T cells. TmclBth and Tmclwl reads were segregated using a Python script and indel percentages were analyzed for each allele. Thus, one condition represents indel formation in the same population of cells. The numbers above the graphs show specificity towards the Beethoven allele, expressed as percentages. Data for Bth reads is presented to the left of data for WT reads for each condition. FIG. ID is a sequence alignment of the most abundant reads in the SaCas9-KKH + gRNA 4.2 treated cells, shown separately for TmclBth (top) and TincI11 1 (bottom) reads. The CRISPR cut site is marked by black dashed line. Dashes represent deleted nucleotides. Nucleotides in bold are substitutions; however, these were not quantified as CRISPR actions. Sequences were aligned to Bth allele, thus in the bottom panel, WT sequence appears as a substitution (an A to T change). Mutation site is marked by an arrow. FIG. IE includes graphs illustrating the indel profiles from SaCas9-KKH + gRNA-4.2 transfected TmclBth/WT fibroblasts. TmclBth and TmclWTreads are plotted separately. Minus numbers represent deletions, plus numbers representinsertions. Sequences without indels (value=0) are omitted from the chart. FIG. IF is a pie chart showing the percentage of indels that cause inframe and frame shift mutations (percentages are shown) in the coding sequence after SaCas9-KKH + gRNA 4.2 transfection. FIG. 1G is output from a GUIDE-Seq analysis on SaCas9-KKH + gRNA 4.2 transfected TmclBth/WT fibroblasts. Genomic DNA was pooled from three biological replicates for sequencing on one occasion. The number next to read is read count in the GUIDE-Seq assay.
FIGs. 2A-2H illustrate in vivo genome editing with SaCas9-KKH. FIG. 2A is a schematic of the cassette encoding SaCas9-KKH and a guide RNA inserted into an AAV vector used in the study; ITR denotes inverted terminal repeat, CMV denotes the
cytomegalovirus promoter, U6 denotes sequencing primer: 5’-
GACTATCATATGCTTACCGT-3’; and AAV-Anc80 denotes the vector backbone. FIG.
2B provides an experimental overview for in vivo studies (ABR denotes auditory brain response). FIG. 2C is a graph of gene editing efficiency determined by targeted deep sequencing of noninjected or AAV-SaCas9-KKH-gRNA-4.2 injected whole cochleas (mean ± S.D.). In non-injected animals, background indel frequencies ranged between 0.05 - 0.06%. Every data point represents a unique sequencing reaction from pooled cochleas includes the number of cochleas each data point, number of independent sequencing reactions for non-injected: 5 (P7), 2 (P14), 2 (P27), injected: 5 (P7), 2 (P14), 2 (P42), 2 (P55) and 2 (P196 WT)). ANOVA was performed to describe overall difference (F=445.8, p<0.0001) followed by Tukey’s post hoc test. FIG. 2D comprises two graphs of indel profiles from AAV-SaCas9-KKH-gRNA-4.2 injected TmclBth/WT animals. TmclBth and TmclWT reads are plotted separately. Minus numbers represent deletions, plus numbers represent insertions. Sequences without indels (value=0) are omitted from the chart. FIG. 2E is a sequence alignment showing the most abundant reads in the AAV-SaCas9-KKH + gRNA 4.2 injected TmclBth/wr animals, shown separately for TmclBth (top) and Tmcl^ (bottom) reads. Arrow denotes mutation site. FIG. 2F is a graph of AAV integration into the TmclBth and DncI111 alleles in non-injected and injected TmclBth/WT animals at P14-P55. Mean ± SD, number of independent experiments and sequencing reactions: 2 for non-injected and 6 for injected). FIG. 2G is a series of sequence alignments that illustrate indel profiles and read abundance at the mRNA level from AAV-SaCas9-KKH-gRNA-4.2 injected Tmclliih ll7 animals. Arrow denotes mutation site. FIG. 2H is a graph showing the relative read counts for TmclBth and Tmcl^ representing mRNA in non-injected and injected animals. The dashed line represents an equal ratio (ratio=l). ANOVA, p=0.0001, Dunnett’s multiple comparisons: p=0.0005 for injected (P42) vs non-injected (P42) and p=0.0001 for injected (P55) vs non- injected (P42)).
FIGs. 3A-3I illustrate the effects of SaCas9-KKH+sgRNA4.2 on inner ear function in Bth mice. FIG. 3A provides representative sensory transduction currents recorded at PI 4- 16 from apical inner and outer hair cells of uninjected TmclBth/A; Tmc2A/A mice (Bth, left) and those injected with AAV-SaCas9-KKH-sgRNA4.2 at P1-P2 (Bth+SaCas9, right). FIG. 3B provides plots showing the mean (± SEM) maximal current amplitudes, measured at PI 4- 16 for uninjected inner hair cells (IHC) (n = 19; top) and outer hair cells (OHC) (n = 10; bottom) from uninjected TmclBth/A; Tmc2A/A (left) and injected (right) mice; (inner hair cells: 124 ± 118 pA, « = 7 , p = 3.4x l0-6; outer hair cells: 71 ± 41 pA, n = 12, p = 8.1 x l0 7; unpaired two- tailed /-test). FIG. 3C shows families of ABR waveforms recorded at eight weeks from an uninjected TmclBth/WT mouse (left) and a TmclBth/WT mouse injected with AAV-SaCas9-KKH- gRNA-4.2 at PI (right). Arrows denote indicate threshold traces. Scale bar applies to all traces. FIG. 3D includes three graphs showing ABR thresholds plotted as a function of frequency for ten injected TmclBth/WT mice (plot lines without error bars). Mean (± S.D.) ABR thresholds for uninjected TmclBth/WT (top plot line with error bars, n = 8), and uninjected TmclWT/WT control mice (bottom plot line with error bars) tested at 4 (n = 6), 8 (n = 12) and 12 (n = 12) weeks. FIG. 3E is a graph showing DPOAE thresholds verses stimulus frequency at 12 weeks for eight injected TmclBth/WT mice (plot lines without error bars).
Mean ± S.D. DPOAE thresholds for uninjected TmclBth/WT (top plot line with error bars, n = 9), and uninjected TmclWT/WT control mice (bottom plot line with error bars, n = 13). FIG.
3F is a plot showing the mean (± S.D.) ABR thresholds at 8 kHz verses age, from 4 to 40 weeks (WT: n = 6, 12, 12, 6; TmclBth/WT : n = 8, 8, 9, 9, 6; +SaCas9-KKH: n = 8, 7, 7, 4, 4; one-way ANOVA, p = 0.32). FIG. 3G is a set of representative confocal images of lOO-pm cochlear sections harvested at 24 weeks from 8, 16, and 32 kHz regions of four uninjected (top), and six injected TmclBth/WT mice (bottom). Tissue was stained for MY07A (red) and actin (green). FIG. 3H comprises two plots showing the mean (± S.D.) number of IHCs (left) and OHCs (right) per lOO-pm section for four uninjected and six injected TmclBth/WT mice. FIG. 31 is a series of scanning electron microscope (SEM) images of the apical cochlear sensory epithelium showing hair bundle morphology for one uninjected TmclWT/WT (left), one uninjected TmclBth/WT (middle), and one injected TmclBth/WT mouse (right).
FIGs. 4A-4D illustrate human dominant mutations targetable with SaCas9 and SaCas9-KKH, and allele-specific targeting of human DFNA36. FIG. 4A. is a sequence alignment illustrating gRNA design targeting a human DFNA36 allele. Mutation site is enclosed. PAM sites are marked by underlined nucleotides. Mismatching nucleotides are encircled. FIG. 4B is a graph showing genome editing efficiency (indel formation percentage) in haploid TMC1DFNA36 and TMdtt r cells after transfection with SaCas9-KKH and HI, H2, H3 gRNA (mean ± SD, 3 biological replicates sequenced independently).
Control cells were transfected with GFP only. Data for TmclDFNA36 is presented to the left of data for TMCI I for each condition. FIG. 4C is an illustration of the types of indels in the case of H2 gRNA in TMC1DFNA36 and TMdtt r cells (CRISPResso analysis, similar results were obtained from all gRNAs and all biological replicates). FIG. 4D is an illustration of all human dominant mutations in the ClinVar database (accessed 2019.03.25) and mutations targetable with SaCas9 and SaCas9-KKH
FIGs. 5A-5I illustrate targeting TmclBth with SpCas9. FIG. 5A is a sequence alignment illustrating gRNA design for SpCas9. Mutation site is highlighted in red. PAM sites are marked by green nucleotides. Mismatching nucleotides are shown in blue. The numbers or letters (e.g. 1.1) next to the PAM site represent gRNAs IDs. The gRNA 1.1 presently disclosed is identical to the Tmcl-mut3 gRNA in the study of Gao et al. Plasmids encoding SpCas9-2A-GFP, along with the different gRNAs, were transfected into fibroblasts. Four days after transfection, GFP-positive cells were sorted by FACS. FIG. 5B includes Sanger sequencing traces from TmclBth/WT or TmclWT/WT mouse fibroblasts transfected with SpCas9-2A-GFP with or without gRNA 1.1. GFP expressing cells were sorted by FACS 4 days after transfection. The mutation site is marked by red arrow. Additional peaks appearing downstream (marked by black arrowheads) of the mutation site demonstrate sequence heterogeneity and thus, indel formation. Similar results were obtained by all gRNAs from two technical replicates (forward and reverse sequencing). Genome editing is apparent both in TmclBth/WT or TmclWT/WT cells with SpCas9 + gRNA 1.1. FIG. 5C includes Sanger sequencing data analyzed by TIDE. The control sample (SpCas9-2A-GFP only, black) and the genome edited sample (SpCas9-2A-GFP + gRNA 1.1, green) are overlaid. Downstream of the expected cut site (blue dashed line) the percentage of aberrant sequences was quantified in the region for decomposition. FIG. 5D is a graph of indel percentages (mean ± standard deviation) in TmclBth/WT or Tmcl^^ cells based on TIDE analysis. Cells were transfected in duplicates and two independent sequencing reactions (forward and reverse) were performed. No indel formation was observed in the case of 3.1, 3.2 and 3.3 gRNAs. gRNA 1.4 showed minimal, but specific genome editing on the TmclBth/WT cells. All the other gRNAs mediated efficient indel formation both in TmclBth/WT or TmclWT/WT cells. Data for TmclBth/WT is presented to the left of data for TMC1WT/WT for each condition. FIG.
5E provides pie charts summarizing the targeted deep sequencing of control cells transfected with SpCas9-2A-GFP only cells, and cells transfected with SpCas9-2A-GFP and WT gRNA or SpCas9-2A-GFP and one of the three most specific gRNAs (1.1, 2.1 and 2.4) in TmclBth/WT (top) TmclWT/WT (bottom) cells. Indels were quantified after segregating TmclBth and Tmcl^ reads by CRISPResso (only insertions and deletions were quantified, substitutions were ignored). None of the gRNAs are specific to the TmclBth allele, and mediate efficient indel formation on the Tmcl^ allele as well (light blue). Sequencing was performed one time from pooled cells, transfected in triplicates. Numbers in pie charts represent the percentage of reads. Specificity was defined as the indel percentage towards the targeted allele among total indels. The gRNA with the highest selectivity towards the TmclBth allele was gRNA 2.4. On the top row of pie chart, the left most pie chart shows WT = 50% and Bth = 49.9%. The following pie charts show clockwise WT, WT indel, Bth, Bth indel (WT = 43.4, 45.6, 48.1, and 16.3, respectively). On the bottom row of pie charts, WT and WT indel are shown, with WT being the larger percentage. FIG. 5F includes sequence alignments of the most abundant reads in the SpCas9 + gRNA 2.4 treated cells, shown separately for TmclBth (top) and TmclWT (bottom) reads. The CRISPR cut site is marked by a black dashed line. Dashes represent deleted nucleotides. Insertions are shown with nucleotides in red squares.
Nucleotides in bold are substitutions, however these were not quantified as CRISPR actions. Sequences were aligned to Bth allele, thus in the bottom panel, WT reads appear as having a substitution (a T to A change). Mutation site is marked by red arrow. Indel formation is evident in both TmclBth and Tincl11 1 reads. FIG. 5G includes graphs of indel profiles from SpCas9 + gRNA 2.4 transfected Tincl11'1' 117 fibroblasts. TmclBth and TmclWT reads are plotted separately. Minus numbers represent deletions, plus numbers represent insertions. Sequences without indels (value=0) are omitted from the chart. The most common indel event is a single base deletion. FIG. 5H is a pie chart of indels causing in-frame vs. frame shift mutations (percentages are shown) in the coding sequence after SpCas9 + gRNA 2.4 transfection. FIG. 51 provides the GUIDE-Seq analysis on SpCas9 + gRNA 2.4 transfected Tincl1111' 117 fibroblasts. Genomic DNA was isolated from 3 biological replicates for sequencing on one occasion. Only one off-target site was identified. Numbers next to reads are read counts in the GUIDE-Seq assay. FIG. 6 is a graph of the number of indels based on targeted deep sequencing data from TmclBth/WT and TmclWT/WT cell lines treated with different Cas9+gRNA combinations (from FIG. IB). Note that data points show non-normalized read counts. Cells were transfected on two different occasions (SpCas9 only and SpCas9 + gRNA 1.1 on four occasions) and genomic DNA from two independent biological samples on each transfection day were pooled for sequencing. Indels in the SaCas9-KKH treated TmclWT/WT lines are not different from the background (i.e. untreated samples). This method revealed high sensitivity, as the indel rates in CRISPR treated samples were 40- 160-fold higher than the background indel rates observed in untreated samples. Data for TmclBth/WT is presented to the left of data for TMClWT/WT for each condition.
FIGs. 7A-7D are graphs illustrating single nucleotide substitutions after Cas9+gRNA treatment. Cells were transfected on two different occasions (SpCas9 only and SpCas9 + gRNA 1.1 on four occasions) and genomic DNA from two independent biological samples on each transfection day were pooled for sequencing. Experimental conditions are the same as in FIG. IB. FIG. 7A is a graph illustrating substitutions given as percentages (i.e.
normalized to total read counts). Analysis was performed on non-segregated .fastq files in TmclBth/WT cells and in TmclWT/WT cells. FIG. 7B is a graph of substitutions given as non- normalized values (i.e. the number of reads with substitutions). Analysis was performed on non-segregated .fastq files in TmclBth/WT cells and in TmclWT/WT cells . FIG. 7C is a graph illustrating substitutions given as percentages (i.e. normalized to total read counts). Analysis was performed on segregated .fastq files in TmclBth/WT cells. FIG. 7D is a graph of substitutions given as non-normalized values (i.e. the number of reads with substitutions). Analysis was performed on segregated .fastq files in TmclWT/WT cells. Substitutions were not frequent (0.1-0.5% of reads) and there was no difference between untreated and treated samples in the percentage or number of reads with single nucleotide substitutions. For FIGs. 7A-7D Data for TmclBth/WT is presented to the left of data for TMClWT/WT for each condition.
FIG. 8 is a graph illustrating the background sequencing error and indel formation with SaCas9-KKH (mean ± SD). Background sequencing error rate (GFP only) and comparison indel events in SaCas9-KKH + gRNA 4.1/gRNA 4.2 and gRNA 4.3 transfected TmclWT/WT fibroblasts are plotted.
FIG. 9A-9G show the effects of SaCas9-KKH+sgRNA4.2 on inner ear function in WT & Bth mice. FIG. 9A. provides plots of the representative sensory transduction currents recorded at PI 4- 16 from inner hair cells (IHCs) and outer hair cells (OHC) of wild-type (WT) mice injected with AAV-SaCas9-KKH-sgRNA4.2 at P1-P2. FIG. 9B is a graph showing the mean ± SEM maximal transduction current amplitudes for PI 4- 16 inner hair cells (left, n = 8) and outer hair cells (right, n = 6) from WT mice injected with AAV-SaCas9-KKH-sgRNA4.2 at P1-P2. FIG. 9C comprises plots of families of ABR waveforms recorded at eight weeks from an uninjected TmclWT/WT mouse (left) and a TmclWT/WT mouse injected with AAV- SaCas9-KKH-gRNA-4.2 at PI (right). Bolded traces indicate threshold. Scale bar applies to all traces. FIG. 9D is a graph showing the mean ± S.D. ABR thresholds plotted as a function of stimulus frequency for six Tmcl^^ mice (black, n = 6) and three TmclWT/WT mice injected with AAV-SaCas9-KKH-gRNA-4.2 (gray) at 24 weeks of age (p = 0.9). FIG. 9E is a graph showing the mean ± S.D. ABR thresholds plotted as a function of stimulus frequency for six TmclWT/wr mice (bottom plot line with error bars), nine TmclBth/WT (top plot line with error bars), and five TmclBth/wr mice injected with AAV-SaCas9-KKH-gRNA-4.2 (plot lines without error bars) at 24 weeks of age. 8-kHz thresholds for injected: 38 ± 11 dB (n = 9) and uninjected: 64 ± 19 dB (n = 8) were significantly different (p = 0.004, unpaired two-tailed I- test). ABR thresholds at higher frequencies (22 kHz) for injected (84 ± 15 dB, n = 9) and uninjected TmclBth/WT mice (103 ± 5 dB, n = 8 p = 0.004, unpaired two-tailed /-test). FIG. 9F is a series of representative confocal images of lOO-pm cochlear sections harvested at 24 weeks from the 8, 16, and 32 kHz regions from three uninjected TmclWT/wr mice (top), and three TmclWT/WT mice injected with AAV-SaCas9-KKH-gRNA-4.2 (bottom). The tissue was stained for MY07A (red) and actin (green). FIG. 9G comprises plots of the Mean ± S.D. number of surviving inner and outer hair cells per 100-pm section ( n = 3).
FIG. 10A-10C illustrates ABR amplitude, latencies, and correlation of thresholds with surviving hair cells. FIG. 10A is a graph of Peak 1 amplitudes measured from 8 kHz ABR waveforms at the 8-week time point (from examples shown in FIGs. 9A and 9C) for all TmclBth/WT mice injected with AAV-SaCas9-KKH-gRNA-4.2 (all traces except trace denoted by arrow) and an example of an uninjected TmclBth/WT (arrow). FIG. 10B is a graph of Peak 1 latencies measured from 8 kHz ABR waveforms at the 8-week time point (from examples shown in FIGs. 9A and 9C, for all TmclBth/WT mice injected with AAV-SaCas9- KKH-gRNA-4.2 (all traces except trace denoted by arrow) and an example of an uninjected TmclBth/WT (arrow). FIG. IOC is a graph of the mean ABR thresholds measured at 24 weeks, evoked by 8 and 16 kHz tone bursts (from FIG. 9E) plotted as function of the mean percentage of surviving inner and outer hair cells from the 8 and 16 kHz regions (from FIG. 3H). The data were fit with a linear equation that had a slope of -2.1 dB/% and a correlation coefficient of -0.82 (line, Pearson’s r).
FIG. 11 is a graph illustrating the results of qPCR specific for the inverted terminal repeat (ITR) region in the transfected plasmid (AAV-CMV-SaCas9-KKH-U6-gRNA) normalized to albumin gene in HAP-1DFNA36 and HAP1WT cells. Bars show mean ± S.D. Data points are from three independent biological replicates. Data for TmclBth/WT is presented to the left of data for TMdtt r 111 for each condition.
FIG. 12 is a graph showing the number of targeted deep sequencing reads with indels from TMC1DFNA36 and TMd l cells treated with different Cas9+gRNA combinations (from FIG. 4C). Data points show non-normalized read counts. Bars show mean ± S.D. Data points are from three independent biological replicates. Data for TmclBth/WT is presented to the left of data for TMC1WT/WT for each condition.
FIG. 13A illustrates targeted deep sequencing and CRISPResso analysis. FIG. 13A is a schematic illustrating PCR and sequencing of the Tmcl gene. FIG. 13B is a schematic illustrating global indel analysis by CRISPREsso, wherein reads are not segregated. FIG. 13C provides a strategy to segregate TmclBth reads and Tmclwl reads. The region for splitting partly overlaps with indels, thus some reads cannot be assigned as mutant or WT. FIG. 13D is a schematic illustrating allele specific indel analysis by CRISPResso.
DETAILED DESCRIPTION OF THE INVENTION
As described below, the present invention features a Cas9 variant capable of selectively targeting a mutant allele without disrupting the wildtype allele, and methods of using such variants for gene editing. In particular embodiments, the invention provides for the editing of dominant mutations associated with single nucleotide substitutions. The invention further provides methods and compositions for treating a disease or condition or symptoms thereof associated with a dominant mutation.
The invention is based, at least in part, on the discovery that a Cas9 variant (SaCas9- KKH) recognizes a non-canonical PAM sequence present in a TMC1 allele that carries a dominant mutation associated with progressive deafness and generates double-strand breaks in only the TMC1 alleles that carry the dominant allele. Importantly, SaCas9-KKH does not generate double strand breaks in the wild type allele lacking the PAM sequence. In an effort to identify Cas9 variants having the desired properties, 14 Cas9/gRNA combinations were screened for specific and efficient disruption of a nucleotide substitution that causes the dominant progressive hearing loss, DFNA36. As a model for DFNA36, Beethoven mice were used. Beethoven mice harbor a point mutation in Tmcl, a gene required for hearing that encodes a pore-forming subunit of mechanosensory transduction channels in inner ear hair cells. A PAM variant of Staphylococcus aureus Cas9 (SaCas9-KKH) was identified that selectively and efficiently disrupted the mutant allele, but not the wild-type Tmcl/TMCl allele, in Beethoven mice and in a DFNA36 human cell line. AAV-mediated SaCas9-KKH delivery prevented deafness in Beethoven mice up to one year post transduction. Analysis of current ClinVar entries revealed that -21% of dominant human mutations could be targeted using a similar approach.
Cas9
Cas9 is a nuclease, an enzyme specialized for cutting DNA, with two active cutting sites, one for each strand of the double helix. Jinek et al. (2012) combined tracrRNA and spacer RNA into a "single-guide RNA" molecule that, mixed with Cas9, could find and cut the correct DNA targets. It has been proposed that such synthetic guide RNAs might be able to be used for gene editing (Jinek et al, Science. 2012 Aug 17;337(6096):816-21).
Cas9 proteins are known in the art, such as Streptococcus pyogenes Cas9 (SpCas9), Staphylococcus aureus Cas9 (SaCas9), and Francisella novicida Cas9 (FnCas9). In general, Cas9 proteins preferentially interrogate and act upon DNA sequences containing a protospacer adjacent motif (PAM) sequence, and different Cas9 proteins have affinities for different PAMs. The canonical PAM sequence is 5’-NGG-3’, which is recognized by multiple Cas9 proteins, where N can be any nucleotide. For example, SpCas9 and FnCas9 recognize the canonical NGG PAM sequence. Streptococcus thermophilus Cas9 recognizes a 5’-NGA-3’ PAM sequence, and SaCas9 recognizes a 5’-NNGRR(N)-3’ PAM sequence. Additionally, Cas9 proteins can be modified to recognize PAM sequences that are distinct from the PAM sequences recognized by the unmodified Cas9 protein. For example, SaCas9- KKH recognizes a 5’-RRT-3’, where R denotes an adenosine or guanine nucleotide. The Cas9 nuclease used in the presently described methods will recognize a PAM sequence that is present only in the allele to be inactivated (i.e., the allele carrying a deleterious mutation). Thus, the nuclease activity of the Cas9 will act only upon the allele to be inactivated. gRNA
A Cas9 protein, having an affinity for a particular PAM sequence can be directed to a particular locus in a genome by a guide RNA. In some embodiments, the guide RNA is a single guide RNA, which comprises a tracrRNA and a spacer RNA. The short spacer RNA, comprising a nucleic acid sequence that specifically binds to the target genomic locus, directs the Cas9 protein to the target, which is then cleaved by the Cas9 protein’s nuclease activity.
In some embodiments, synthetic gRNAs are about 18, 19, 20, 21, 22, 25, 30, 40, 50, 60, 70, 80, 90, 100, over 100 bp and comprise a nucleic acid sequence complementary to protospacer nucleotides near the PAM sequence
In some embodiments, the guide RNA will bind a nucleic acid sequence comprising a PAM sequence that is present in an allele carrying a mutation, but is not present in an allele that does not carry the mutation. In some embodiments, the guide RNA binds a nucleic acid sequence that is in close proximity to a PAM sequence that is present only in an allele to be inactivated (i.e., an allele carrying a deleterious mutation). The PAM sequence may be 1, 2,
3, 4, 5, 6, 7, 8, 9, or 10 nucleotides upstream or downstream of the sequence to which with guide RNA binds.
The following US patents and patent publications are incorporated herein by reference in their entireties: Patent No. 8,697,359, 20140170753, 20140179006, 20140179770, 20140186843, 20140186958, 20140189896, 20140227787, 20140242664, 20140248702, 20140256046, 20140273230, 20140273233, 20140273234, 20140295556, 20140295557, 20140310830, 20140356956, 20140356959, 20140357530, 20150020223, 20150031132, 20150031133, 20150031134, 20150044191, 20150044192, 20150045546, 20150050699, 20150056705, 20150071898, 20150071899, 20150071903, 20150079681, 20150159172, 20150165054, 20150166980, and 20150184139.
Polynucleotide Delivery
Therapeutic success in these approaches relies significantly on the safe and efficient delivery of exogenous gene constructs to the relevant therapeutic cell targets in the organ of Corti in the cochlea. The organ of Corti includes two classes of sensory hair cells: inner hair cells, which convert mechanical information carried by sound into electrical signals transmitted to neuronal structures and outer hair cells which serve to amplify and tune the cochlear response, a process required for complex hearing function. Methods of delivering nucleic acids to cells generally are known in the art, and methods of delivering viruses (which also can be referred to as viral particles) containing a transgene to inner ear cells in vivo are described herein. As described herein, about 108 to about 1012 viral particles can be administered to a subject, and the virus can be suspended within a suitable volume (e.g., 10 pL, 50 pL, 100 pL, 500 pL, or 1000 pL) of, for example, artificial perilymph solution.
A virus containing a promoter (e.g., an Espin promoter, a PCDH15 promoter, a PTPRQ promoter, a Myo6 promoter, a KCNQ4 promoter, a Myo7a promoter, a synapsin promoter, a GFAP promoter, a CMV promoter, a CAG promoter, a CBH promoter, a CBA promoter, a U6 promoter, and a TMHS (LHFPL5) promoter) and a polynucleotide encoding a Cas9 protein (e.g., SaCas9-KKH), and in some embodiments, a guide RNA, as described herein can be delivered to inner ear cells (e.g., cells in the cochlea) using any number of means. For example, a therapeutically effective amount of a composition including virus particles containing one or more different types of transgenes as described herein can be injected through the round window or the oval window, or the utricle, typically in a relatively simple (e.g., outpatient) procedure. In some embodiments, a composition comprising a therapeutically effective number of virus particles containing a transgene (e.g., a
polynucleotide encoding a transgene and a gRNA), or containing one or more sets of different virus particles, wherein each particle in a set can contain the same type of transgene, but wherein each set of particles contains a different type of transgene than in the other sets, as described herein can be delivered to the appropriate position within the ear during surgery (e.g., a cochleostomy or a canalostomy).
In addition, delivery vehicles (e.g., polymers) are available that facilitate the transfer of agents across the tympanic membrane and/or through the round window or utricle, and any such delivery vehicles can be used to deliver the viruses described herein. See, for example, Arnold et al, 2005 , Audiol. Neurootol. , 10:53-63.
The compositions and methods described herein enable the highly efficient delivery of nucleic acids to inner ear cells, e.g., cochlear cells. For example, a polynucleotide encoding a Cas9 protein, variant (e.g., SaCas9-KKH), or a fragment thereof, can be cloned into a retroviral vector and expression can be driven from its endogenous promoter, from the retroviral long terminal repeat, or from a promoter specific for a target cell type of interest. Other viral vectors that can be used include, for example, a vaccinia virus, a bovine papilloma virus, or a herpes virus, such as Epstein-Barr Virus. Retroviral vectors are particularly well developed and have been used in clinical settings. In some embodiments, a viral vector is used to administer a Cas9 polynucleotide systemically. In some embodiments, a viral vector is used to administer a Cas9 polynucleotide to a particular region of the body.
For example, the compositions and methods described herein enable the delivery to, and expression of, a KKH-Cas9 polynucleotide in at least 65% (e.g., at least 65, 70, 75, 80,
85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99%) of inner and/or outer hair cells or delivery to, and expression in, at least 80% (e.g., at least 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99) of outer hair cells.
As demonstrated herein, expression of a KKH-Cas9 polynucleotide delivered using an AAV-vector can result in improved structure and function of inner and outer hair cells such that hearing is restored for an extended period of time (e.g., months, years, decades, a life time).
As described herein, an adeno-associated virus (AAV) are particularly efficient at delivering nucleic acids (e.g., polynucleotides encoding a Cas9 polypeptide and, in some embodiments, a gRNA) to inner ear cells. The Anc80 vector is an example of an Inner Ear Hair Cell Targeting AAV that advantageously transduced greater than about 60%, 70%, 80%, 90%, 95%, or even 100% of inner or outer hair cells. One particular ancestral capsid protein that falls within the class of Anc80 ancestral capsid protein is Anc80-0065 (SEQ ID NO:2) described in International Application No. PCT/US2018/017104, which is incorporated herein by reference in its entirety. However, WO 2015/054653, which is also incorporated herein by reference in its entirety, describes a number of additional ancestral capsid proteins that fall within the class of Anc80 ancestral capsid proteins.
In particular embodiments, the adeno-associated virus (AAV) contains an ancestral AAV capsid protein that has a natural or engineered tropism for hair cells. In some embodiments, the virus is an Inner Ear Hair Cell Targeting AAV, which delivers a transgene (e.g., a polynucleotide encoding a Cas9 polypeptide and, in some embodiments, a gRNA) to the inner ear in a subject. In some embodiments, the virus is an AAV that comprises purified capsid polypeptides. In some embodiments, the virus is artificial. In some embodiments, the virus is an AAV that has lower seroprevalence than AAV2. In some embodiments, the virus is an exome-associated AAV. In some embodiments, the virus is an exome-associated AAVl. In some embodiments, the virus comprises a capsid protein with at least 95% amino acid sequence identity or homology to Anc80 capsid proteins. Expression of a Cas9 polynucleotide may be directed by a heterologous promoter (e.g., CMV promoter, Espin promoter, a PCDH15 promoter, a PTPRQ promoter and a TMHS (LHFPL5) promoter). As used herein, a“heterologous promoter” refers to a promoter that does not naturally direct expression of that sequence (i.e., is not found with that sequence in nature).
Methods for packaging a transgene into a virus that contains an Anc80 capsid protein are known in the art, and utilize conventional molecular biology and recombinant nucleic acid techniques. In one embodiment, a construct that includes a nucleic acid sequence encoding an Anc80 capsid protein and a construct carrying the polynucleotide encoding a Cas9 (and in some cases a Cas9 and a gRNA) flanked by suitable Inverted Terminal Repeats (ITRs) are provided, which allows for the transgene to be packaged within the Anc80 capsid protein.
The Cas9 polynucleotide (and in some embodiments, a Cas9 and a gRNA) can be packaged into an AAV containing an Anc80 capsid protein using, for example, a packaging host cell. The components of a virus particle (e.g., rep sequences, cap sequences, inverted terminal repeat (ITR) sequences) can be introduced, transiently or stably, into a packaging host cell using one or more constructs as described herein.
In some embodiments, a AAVs containing a AAV9-php.b vector is used to efficiently target inner ear cells. AAV9-php.b is described in International Application No.
PCT/US2019/020794, the contents of which are incorporated herein by reference in their entirety. AAV-PHP.B encodes the 7-mer sequence TLAVPFK and efficiently delivers transgenes to the cochlea, where it showed remarkably specific and robust expression in the inner and outer hair cells. An AAV-PHP.B vector can comprise, but is not limited to, any of the promoters described herein.
Non-viral approaches can also be employed for the introduction of therapeutic to a cell of a patient requiring inactivation of an allele carrying a mutation associated with a disease or condition or symptom thereof. For example, a nucleic acid molecule can be introduced into a cell by administering the nucleic acid in the presence of lipofection.
Gene transfer can also be achieved using non-viral means involving transfection in vitro. Such methods include the use of calcium phosphate, DEAE dextran, electroporation, and protoplast fusion. Liposomes can also be potentially beneficial for delivery of DNA into a cell. Transplantation of normal genes into the affected tissues of a patient can also be accomplished by transferring a normal nucleic acid into a cultivatable cell type ex vivo (e.g., an autologous or heterologous primary cell or progeny thereol), after which the cell (or its descendants) are injected into a targeted tissue.
cDNA expression for use in polynucleotide therapy methods can be directed from any suitable promoter (e.g., the human cytomegalovirus (CMV), simian virus 40 (SV40), or metallothionein promoters), and regulated by any appropriate mammalian regulatory element. For example, if desired, enhancers known to preferentially direct gene expression in specific cell types can be used to direct the expression of a nucleic acid. The enhancers used can include, without limitation, those that are characterized as tissue- or cell-specific enhancers. Alternatively, if a genomic clone is used as a therapeutic construct, regulation can be mediated by the cognate regulatory sequences or, if desired, by regulatory sequences derived from a heterologous source, including any of the promoters or regulatory elements described above.
Another therapeutic approach included in the invention involves administration of a recombinant therapeutic, such as a recombinant a Cas9 protein, variant, or fragment thereof, either directly to the site of a potential or actual disease-affected tissue or systemically (for example, by any conventional recombinant protein administration technique). The dosage of the administered protein depends on a number of factors, including the size and health of the individual patient. For any particular subject, the specific dosage regimes should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions.
Inactivating Alleles
Compositions and methods are provided herein for altering a cell to inactivate a mutant allele associated with a disease or condition using a CRISPR-Cas system. In some embodiments, a Cas9 (e.g., SaCas9-KKH), in combination with a single guide RNA is used to target an allele comprising a mutation. To selectively inactivate the allele carrying the mutation, while not inactivating the wild type or other non-deleterious forms of the allele, a Cas protein is used that recognizes a PAM sequence present in the mutant allele but not in the wild type (or other non-mutant form) allele. Upon target recognition, the Cas protein (e.g., Cas9) induces at least one double strand break in the target mutant allele. Repair of the double-strand break by non-homologous end joining (NHEJ) increases the probability of an indel at the double-strand break site. In some embodiments, an indel at the double-strand break site generates a premature stop codon in the mutant allele that inactivates the mutant allele. In some embodiments, the indel can be in a regulatory region of the allele that results in inhibited expression of the allele. In some embodiments, the indel generates a protein product that is lacks a deleterious nature (i.e., the edited allele does not interfere with the expression and function of the wildtype (or non-mutant form) allele.
Compositions and Methods of Treatment
The present invention provides methods of treating disease and/or disorders or symptoms thereof which comprise administering a therapeutically effective amount of a pharmaceutical composition comprising a Cas9 nuclease and a guide RNA that specifically binds a nucleic acid sequence in the genome comprising a mutation and a PAM sequence recognized by the Cas9 to a subject (e.g., a mammal such as a human), wherein the PAM sequence is not present in the allele that does not carry the mutation. Thus, one embodiment is a method of treating a subject suffering from or susceptible to a disease or disorder or symptom thereof associated with a mutation. The method includes administering to the mammal a therapeutic amount of an amount of a compound herein sufficient to treat the disease or disorder or symptom. In some embodiments, the mutation is a dominant mutation.
The therapeutic methods of the invention (which include prophylactic treatment), in general, comprise administration of a therapeutically effective amount of the compounds herein, such as a compound of the formulae herein to a subject (e.g., animal, human) in need thereof, including a mammal, particularly a human. Such treatment will be suitably administered to subjects, particularly humans, suffering from, having, susceptible to, or at risk for a disease, disorder, or symptom thereof. Determination of those subjects“at risk” can be made by any objective or subjective determination by a diagnostic test or opinion of a subject or health care provider (e.g., genetic test, enzyme or protein marker, Marker (as defined herein), family history, and the like).
Compositions are contemplated herein for the treatment of diseases or conditions associated with a mutation. For therapeutic purposes, compositions comprising a Cas9 polypeptide, or a polynucleotide encoding a Cas9 polypeptide and a guide RNA that specifically binds to a nucleic acid sequence in a genome that comprises a mutation that causes or contributes to a disease or condition (e.g., dominant progressive hearing loss) as described herein may be administered directly to a region of the body (e.g., cochlea) that is affected by the disease or condition. In some embodiments, the compositions are formulated in a pharmaceutically-acceptable buffer such as physiological saline. Non-limiting methods of administration include injecting into the cochlear duct or the perilymph-filled spaces surrounding the cochlear duct (e.g., scala tympani and scala vestibuli). Injecting into the cochlear duct, which is filled with high potassium endolymph fluid, could provide direct access to hair cells. However, alterations to this delicate fluid environment may disrupt the endocochlear potential, heightening the risk for injection-related toxicity. The perilymph- filled spaces surrounding the cochlear duct, scala tympani and scala vestibuli, can be accessed from the middle ear, either through the oval or round window membrane. The round window membrane, which is the only non-bony opening into the inner ear, is relatively easily accessible in many animal models and administration of viral vector using this route is well tolerated. In humans, cochlear implant placement routinely relies on surgical electrode insertion through the round window membrane.
Treatment of human patients or non-human animals are carried out using a therapeutically effective amount of a combination therapeutic in a physiologically-acceptable carrier. The phrase“pharmaceutically acceptable” refers to those compounds of the invention, compositions containing such compounds, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
The phrase“pharmaceutically-acceptable excipient” includes pharmaceutically- acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, carrier, solvent or encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be“acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient. Some examples of materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as com starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, com oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide;
(15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) phosphate buffer solutions; and (21) other non-toxic compatible substances employed in pharmaceutical formulations.
The compositions may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the host being treated, the particular mode of administration. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the compound which produces a therapeutic effect.
Generally, out of one hundred per cent, this amount will range from about 1 per cent to about ninety -nine percent of active ingredient, preferably from about 5 per cent to about 70 per cent, most preferably from about 10 per cent to about 30 per cent.
Additional suitable carriers and their formulations are described, for example, in the most recent edition of Remington's Pharmaceutical Sciences by E. W. Martin. The amount of the therapeutic agent to be administered varies depending upon the manner and mode of administration, the age and disease status (e.g., the extent of hearing loss present prior to treatment).
Compositions are administered at a dosage that controls the clinical or physiological symptoms of the disease or condition, as may in some cases be determined by a diagnostic method known to one skilled in the art.
Therapeutic compounds and therapeutic combinations are administered in an effective amount. For example, about 108 to about 1012 viral particles can be administered to a subject, and the virus can be suspended within a suitable volume (e.g., 10 pL, 50 pL, 100 pL, 500 pL, or 1000 pL) of, for example, artificial perilymph solution.
Methods of Treating Dominant Progressive Hearing Loss
Compositions and methods for treating dominant progressive hearing loss (e.g., Deafness, Autosomal Dominant 36, or dominant progressive deafness 36, (DFNA36)) are provided.
DFNA36 is associated with dominant mutations (acquired or inherited) in the TMC1 gene of affected individuals. To inactivate the dominant mutation in a heterozygous subject, a SaCas9-KKH protein along with a guide RNA that recognizes the genomic locus containing the TMC1 dominant mutant, is administered to a subject as described above. The
SaCas9=KKH protein that recognizes the RRT PAM sequence present in the TMC1 allele carrying the dominant mutation. Mutations within the TMC1 gene can cause Deafness, Autosomal Dominant 36 (DFNA36), a dominant progressive form of deafness. The SaCas9- KKH protein binds to a cleaves the TMC1 allele carrying the dominant mutation (but not the wild type allele), which promotes indel formation at the break site during non-homologous end joining. Resulting premature stop codons generate truncated, non-functional TMC1 proteins that are not dominant to the expressed wild type protein.
In some embodiments, the SaCas9-KKH nuclease is administered to a subject by directly injecting a vector (e.g., AAV or lentiviral vector) encoding the SaCas9-KKH protein and a guide RNA into the cochlea of the subject. In some embodiments, the vector only encodes the SaCas9-KKH protein and the guide RNA is administered in the injection as RNA For therapeutic purposes, compositions comprising a Cas9 polypeptide, or a polynucleotide encoding a Cas9 polypeptide and a guide RNA that specifically binds to a nucleic acid sequence in a genome that comprises a mutation that causes or contributes to dominant progressive hearing loss as described herein may be administered directly to a region of the body (e.g., cochlea) that is affected by the disease or condition. Non-limiting methods of administration include injecting into the cochlear duct or the perilymph-filled spaces surrounding the cochlear duct (e.g., scala tympani and scala vestibuli). Injecting into the cochlear duct, which is filled with high potassium endolymph fluid, could provide direct access to hair cells. However, alterations to this delicate fluid environment may disrupt the endocochlear potential, heightening the risk for injection-related toxicity. The perilymph- filled spaces surrounding the cochlear duct, scala tympani and scala vestibuli, can be accessed from the middle ear, either through the oval or round window membrane. The round window membrane, which is the only non-bony opening into the inner ear, is relatively easily accessible in many animal models and administration of viral vector using this route is well tolerated. In humans, cochlear implant placement routinely relies on surgical electrode insertion through the round window membrane.
In some embodiments, inactivating the mutant allele that causes DFNA36 while expressing the wildtype allele can restore auditory function in a subject. In some embodiments, the auditory function restored to a subject is about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or even about 100%. EXAMPLES
Example 1: Screening Cas9 and gRNA combinations in vitro
In order to develop allele specific genome editing strategies for dominant hearing loss, the Beethoven ( Bth ) mouse was used. The Bth mouse provides an excellent model for DFNA36 hearing loss in humans. The Bth mutation results in an amino acid substition (p.M412K, C.T1253A) in Tmcl. The mutation causes hair cell degeneration and progressive hearing loss in mice. In humans, the p.M418K substitution is identical to the Bth mutation in the orthologous position and causes DFNA36, dominant progressive hearing loss.
To selectively disrupt the Bth allele in fibroblasts from TmclBth/WT mice (Tmcl^^7 cells were used as controls), various Cas9 and gRNA combinations were screened in vitro. Plasmids encoding SpCas9-2A-GFP, along with the different gRNAs, were transfected into fibroblasts in duplicate. Four days after transfection, GFP-positive cells were sorted by fluorescence assisted cell sorting (FACS). SpCas9 in combination with 12 different gRNAs were tested, including full-length and truncated forms targeting either TmclBth or Tmcl11 1 (FIG. 5A). Two independent sequencing reactions (forward and reverse) were performed. However, none of the various combinations, including the Cas9:gRNAl. l combination previously reported to show transient improvement in auditory thresholds in Bth mice, had the necessary specificity, as indel formation was evident in both Bth and WT alleles (FIG. 5B). Sequencing data was further analyzed using Tracking of Indels by Decomposition (TIDE), and no indel formation was observed in the case of 3.1, 3.2 and 3.3 gRNAs. gRNA 1.4 showed minimal, but specific genome editing on the TmclBth/WT cells. All the other gRNAs mediated efficient indel formation both in TmclBth/WT or TmclWT/WT cells
(FIGs. 5C and 5D)
Targeted deep sequencing was performed on control (SpCas9-2A-GFP only) cells,
WT gRNA and the 3 most specific gRNAs (1.1, 2.1 and 2.4) in TmclBth/WT (top) TmclWT/WT (bottom) cells. Indels were quantified after segregating TmclBth and TmclWT reads by CRISPResso (only insertions and deletions were quantified, substitutions were ignored).
None of the gRNAs are specific to the TmclBth allele, and mediate efficient indel formation on the TmclWT allele as well. Sequencing was performed one time from pooled cells, transfected in triplicates. Specificity was defined as the indel percentage towards the targeted allele among total indels. The gRNA with the highest selectivity towards the TmclBth allele was gRNA 2.4 (FIG. 5E). The most abundant reads in the SpCas9 + gRNA 2.4 treated cells were aligned to Bth allele. WT reads appear as having a substitution (a T to A change). Indel formation is evident in both TmclBth and TmclWT reads (FIG. 5F). Referring to FIG. 5G, the most common indel event identified in the indel profiles from SpCas9 + gRNA 2.4 transfected TmclBth/WT fibroblasts is a single base deletion. The percentages of indels causing in-frame and frame shift mutations in the coding sequence of Tmcl after SpCas9 + gRNA 2.4 transfection is shown in FIG. 5H. GUIDE-Seq analysis was performed on SpCas9 + gRNA 2.4 transfected Tmcll:i 117 fibroblasts. Genomic DNA was isolated from 3 biological replicates for sequencing on one occasion. Only one off-target site was identified (FIG. 51).
To improve allele selectivity, high-fidelity SpCas9 enzymes were also evaluated; however, none mediated selective targeting of the Bth allele (FIGs. 1A, IB, and FIG. 6).
Example 2: SaCas9-KKH recognizes a PAM site selective for the TMCm allele
It was hypothesized that a Cas9 nuclease with a PAM site selective for the mutant sequence might show specific targeting of the TmclBth allele. The Bth mutation is a T to A change; thus, the GGAAGT sequence present in TmclBth, but not in Tmcl^ (GGATGT), may allow the PAM site of the SaCas9-KKH variant (NNNRRT) to distinguish the TmclBth from the Tmcl^ allele. Full-length and truncated gRNAs were designed (FIG. 1A) and plasmids expressing each of these together with SaCas9-KKH were transfected into fibroblasts. SaCas9-KKH induced indels in TmclBth/WT, but not in TmclWT/wr fibroblasts (FIG. IB and FIG. 6). This method revealed high sensitivity, as the indel rates in CRISPR treated samples were 40- 160-fold higher than the background indel rates observed in untreated samples.
Allele-specific indel formation in TmclBth/WT cells was analyzed to avoid potential differences in transfection efficiency between TmclBth/WT and TmclWT/WT fibroblasts. TmclBth and TmclWT sequencing reads were segregated using a Python script and indel percentages were analyzed for each allele. (FIG. 1C). Allele-specific analysis revealed that 98-99% of all indels that occurred in TmclBth/WT cells were present just in the mutant allele. The indel profile revealed that the majority of CRISPR-induced variants were deletions, the most common being a single base deletion causing a frame-shift. (FIGs. ID- IF). Single nucleotide changes were not frequent events (0.1-0.5% of reads) and there was no difference between Cas9-treated and control cells in the percentage or number of reads with single nucleotide substitutions (FIGs. 7A-7D). The few indels (less than 0.2%) in TmclWT/WT fibroblasts were not significantly different from indel rates in no-gRNA control samples, which likely reflect PCR/sequencing error (FIG. 8). Importantly, SaCas9-KKH + gRNA 4.2 was specific for the TmclBth allele in transfected fibroblasts. Genomic DNA was pooled from three biological replicates for sequencing. Cleavage was not detected at any genome-wide off-target sites using GUIDE- Seq (FIG. 1G).
Example 3: SaCas9-KKH-mediated indel formation in sensory hair cells
To assess the capability of SaCas9-KKH and gRNA 4.2 to introduce indels into the TMC1 gene, the Cas9 protein and guide RNA were packaged into Anc80L65 capsids (FIG. 2A) for delivery to sensory hair cells of the cochlea. 1 pi of virus was injected into the inner ears of PI mice (FIG. 2B). Targeted deep sequencing from whole cochlear tissue at different ages post-injection and in non-injected animals (FIG. 2C) was performed. In whole cochlea, in which supporting cells vastly outnumber viral-targeted hair cells, 0.2%, 1.8%, 1.6% and 2.2% indel frequencies at 7, 14, 42 and 55 days after injection were observed, respectively. Indel formation in injected WT animals was not different from background even after 196 days (FIG. 2C). Indel formation was detected in the TmclBth allele but not in the TincI11 1 allele in injected TmclBth/WT animals (FIGs. 2D, 2E). A more sensitive, independent analysis— the presence of AAV inverted terminal repeats in the cut site— was used to investigate allele selectivity of SaCas9-KKH. In non-injected TmclBth/WT animals, AAV reads within the Tmcl gene were not detected (FIG. 2F) but AAV integration was evident in the TmclBth allele in all injected animals at P42 or P55. However, only three unique Tine 1111 reads with AAV integration in 45 injected mice were observed, corresponding to a 0.0075% indel rate, suggesting little SaCas9-KKH activity on the WT allele. As a final test, gene editing at the mRNA level was analyzed. In contrast to non-injected TmclBth/WT animals, some indel formation was observed at the mRNA level in injected animals at P55 (0.83% in injected animals, FIG. 2G), but only in mutant alleles. A 24% decrease (FIG. 2H) in non- modified Bth mRNA relative to non-modified WT mRNA in injected animals was also observed.
Example 4: SaCas9-KKH-guide RNA significantly reduces auditory brainstem responses
SaCas9-KKH-mediated disruption of the Bth allele was evaluated using hair cell mechanosensory transduction current. Although the Bth mutation eventually causes cell death, the mutation does not cause a loss of mechanosensitivity. Single-cell electrophysiology was performed on hair cells from either Tmclwr/WT or TmclBth/A mouse pups on a Tmc2A/A background because Tmc2 contributes to mechanosensory currents and is expressed transiently at neonatal stages. After injection of AAV-SaCas9-KKH-gRNA-4.2 at PI, cochleas were dissected at P5-P7 and cultured 8-10 days, or the equivalent of P14-P16. Both inner and outer hair cells from injected TmclWT/WT mice showed normal current amplitudes (FIGs. 9A, 9B) similar to WT amplitudes reported previously, which indicated no disruption of the TmclWT allele. TmclBth/A; Tmc2A/A hair cells from mice injected with AAV- CMV-SaCas9-KKH-U6-gRNA-4.2 showed a significant reduction in current amplitude in both inner and outer hair cells, relative to hair cells of uninjected TmclBth/A; Tmc2A/A mice, in some cases almost completely abolishing the current (FIGS. 3A, 3B).
Example 5: SaCas9-KKH-guide RNA improves auditory brain responses
Auditory brainstem responses (ABR) and distortion product otoacoustic emissions (DPOAE) were evaluated in Bth mice using the allele-specific SaCas9-KKH nuclease (FIG. 2B). In 8-week old TmclBth/wr mice, ABR recordings revealed elevated hearing thresholds (90 dB at 8 kHz; FIG. 3C) compared to WT controls (30 dB, FIG. 9C), consistent with the progressive hearing loss in Bth mice. In TmclBth/WT animals injected with AAV-SaCas9- KKH-gRNA-4.2, improved thresholds were observed at eight weeks (45 dB median threshold; FIGs. 3C, 3D). At four weeks, the mouse with the greatest hearing preservation had ABR thresholds of 20-35 dB in the 5-16 kHz test range, indistinguishable from wild-type mice (FIG. 3D).
Since the Bth mutation causes progressive hearing loss, the time course of hearing sensitivity in TmclBth/WT and TmclWT/WT animals was measured at 4, 8, 12 and 24 weeks after injection at frequencies from 5.6 to 32 kHz (FIGS. 3D, 3F and FIGs. 9D, 9E). At 4 weeks of age, uninjected Bth mice had low frequency hearing but high frequency hearing loss (FIG. 3D), similar to previous reports. At later time points, ABR thresholds were progressively elevated, and at 24 weeks of age, no ABR thresholds were detected in untreated Bth mice (FIG. 9E). In contrast, Bth mice injected with AAV-SaCas9-KKH-gRNA-4.2 showed normal or near-normal ABR thresholds at low frequencies (8 kHz, injected: 38 ± 11 dB n = 9; uninjected: 64 ± 19 dB n = 8) and improved, but not completely normalized, ABR thresholds at high frequencies (22kHz, injected: 84 ± 15 dB n = 9; uninjected: 103 ± 5 dB n = 8). In contrast to uninjected Bth mice, ABR thresholds in injected mice did not deteriorate over time (8 kHz, 8 weeks: 45 ± 15 dB n = 9; 12 weeks: 48 ± 17 dB n = 10; 24 weeks: 40 ± 7 dB, n = 4; FIG. 3F). At 24 weeks, injected mice exhibited normal or near-normal thresholds at 5-8 kHz, while untreated animals were profoundly deaf. One injected animal showed remarkable preservation of hearing even in high frequencies at 24 weeks of age (FIG. 9E).
ABR peak 1 (PI) amplitudes were in the normal range for most of the injected Bth mice at 8 weeks, in contrast to non-injected animals, which showed small PI amplitudes only at high sound intensities (FIG. 10A). Latencies of PI waves of injected Tmcll:i "7 animals were also normalized by injection (FIG. 10B). To test outer hair cell function, DPOAE was measured at 4, 8, 12 and 24 weeks after injection. Like the ABRs, DPOAE thresholds in injected Bth mice revealed preservation of outer hair cell function at lower frequencies (5-11 kHz) at 12 weeks of age (FIG. 3E) and in the surviving animals, up to 24 weeks of age.
Whether AAV-SaCas9-KKH-gRNA-4.2 injection disrupts hearing in wild-type animals was also investigated. ABRs were performed and no ABR or DPOAE threshold shifts were observed, even 24 weeks post-injection (FIG. 9D, 8 kHz, injected: 38 ± 8 dB n = 3; uninjected: 38 ± 6 dB n = 6) confirming that AAV-SaCas9-KKH does not disrupt hearing function in Tmcl^^ mice.
In one cohort of four Bth mice, ABR thresholds were measured at 40 weeks post injection. Thresholds (8 kHz) between 4 and 40 weeks were tracked and data from two mice with failed injections was excluded, based on histological examination (below). Thresholds were stable over time and only slightly elevated relative to WT mice (FIG. 3F). Two of six mice that survived to one year of age had stable ABR thresholds of 35 and 40 dB at 8 kHz.
Next, hair cell survival was evaluated in injected and non-injected TmclBth/WT and TmclWT/WT animals. Following ABR and DPOAE evaluations, mice were sacrificed at 24 weeks of age. Surviving hair cells were identified with an antibody for MY07A and phalloidin staining for actin. Inner and outer hair cells were present in uninjected TmcI l 117 mice and those injected with AAV-SaCas9-KKH-gRNA-4.2(FIGs. 9F, 9G). In contrast, uninjected TmclBth/WT animals showed significant hair cell loss in all regions (FIGs. 3G, 3H). In the low-frequency (8 kHz) apex, many hair cells were missing, and in the 16 and 32 kHz regions, essentially all hair cells were absent. In contrast, injected TmclBth/WT animals showed normal sensory epithelia in the 8 and 16 kHz regions (FIGs. 3G, 3H), with minimal hair cell loss. In the basal region (32 kHz) inner hair cells, but not outer hair cells survived (FIGs. 3G, 3H). Mean ABR thresholds were correlated with the percent of surviving hair cells at the low frequency end of the cochlea (FIG. IOC). Example 6: Preservation of normal hair bundle morphology
Hair bundle morphology was evaluated with scanning electron microscopy, in Bth and WT hair cells. In uninjected TmclWT/WT animals at 24 weeks of age, inner and outer hair cells showed classical staircase organization of hair bundles (FIG. 31). In contrast, surviving hair cells from TmclBth/WT animals showed significant bundle disorganization. Hair cells from SaCas9-KKH-injected mice, however, showed preservation of normal hair bundle morphology in both inner and outer hair cells (FIG. 31). These results are concordant with the ABR data, which showed robust preservation of thresholds at low frequencies (8 and 16 kHz), but less restoration at high frequencies (32 kHz). Together, these results suggest robust therapeutic benefit of AAV-SaCas9-KKH-gRNA-4.2 injection in Bth mice.
Example 7: Human haploid cells
To validate the strategy for targeting the human p.M418K mutation, a haploid human cell line was generated containing the p.M418K mutation in TMC1 (c.T1253A). TMC1DFNA36 and TMCI 1 cells were transfected with SaCas9-KKH and 3 different gRNAs targeting the mutant allele (FIG. 4A). Transfection efficiency was similar between the two lines (FIG.
11). Targeted deep sequencing of TMCl revealed indel formation in the 7 MC1DFNA36 line, but no indel formation in the TMC^ line (FIG. 4B and FIG. 12) suggesting specific disruption of the mutant allele. The most common indel event was a single nucleotide deletion, but larger deletions were also observed (FIG. 4C). These results suggest that the strategy translates to human cells and that allele-specific targeting of dominant mutations holds promise for preventing dominant hearing loss.
Example 8: SaCas9-KKH PAM is present in other dominant mutations
In addition to the TMCl p.M418K mutation (DFNA36), 15 other dominant mutations in deafness genes that are targetable with SaCas9-KKH were identified (FIG. 4D and Table 1). All known dominant human mutations for specific PAM targeting using SaCas9 and SaCas9-KKH were analyzed. SaCas9 has a unique PAM requirement of‘GRRT’, while SaCas9-KKH has a PAM requirement only of‘RRT. Of 17,783 dominant entries in the ClinVar database, the SaCas9 GRRT PAM site was evident in 1,328 variants (7.5%) (FIG. 4D), while the SaCas9-KKH PAM site is able to distinguish mutant from wild-type for 3,759 dominant alleles (21.1%) (FIG. 4D). Table 1 Dominant deafness variants potentially targetable with SaCas9-KKH
Figure imgf000047_0001
Figure imgf000048_0001
The results reported herein were generated using the following methods and materials.
Plasmids and cloning
Table 2 provides information on the specifics of the CRISPR/Cas9 plasmids used in the above examples. Table 3 shows the sequences of the gRNAs and the Cas9 plasmids used together with the gRNA vectors. 11 different gRNAs were tested with SpCas9 (FIG. 5A) that targeted the TmclBth allele and differed in their length and distance between the mutation and PAM site.
Table 2. Specification of plasmids used in this study
Figure imgf000049_0001
Table 3. gRNA sequences and usage
Figure imgf000049_0002
Figure imgf000050_0001
Non-matching 5' G nucleotides are marked underlined
For gRNAs 1.1-1.4 and 2.1-2.4, a PAM site was adjacent to the mutation. gRNA 1.1 is identical to the Tmcl-mut3 gRNA in the study of Gao et al, Nature, 553: 217-21 (2018). In the case of gRNAs 3.1-3.3, an AAG PAM site created by the mutation was used in order to specifically recognize the mutant allele, as it has been shown that SpCas9 can also cleave at NAG PAM sites with somewhat lower efficiency. Several truncated gRNAs were also used because previous studies reported enhanced specificity (Fu, Y. et al, Nat. Biotechnol. 32: 279-84 (2014)). One gRNA specific for the TmclWT allele was synthesized as a control. gRNA 1.1 was used (FIG. 5A) in combination with eSpCas9(l. l), HypaCas9 or SpCas9-HFl (FIG. 5A). gRNA 2.4 was not used in these experiments, as it has been shown that truncated gRNAs substantially decrease on-target activity of high fidelity Cas9 enzymes. pBG201 (AAV-CMV-NLS(SV40)-SaCas9 (E782K/N968K/R1015H)-NLS(nucleoplasmin)-3xHA- bGHpA0-U6-BsaI-sgRNA) was created by synthesizing a gene fragment of the SaCas9-KKH and cloning into the pX60125 backbone using Fsel (NEB) and Csil (Thermo Scientific). Whole plasmid sequencing (MGH DNA Core, Cambridge, MA, USA) was used to verify the sequence of pBG201. To clone gRNAs into pX458, MLM3636 and pBG201, Fast Digest Bpil (Thermo Scientific), Bsmbl (NEB), and Bsal, respectively, were used. 3 different gRNAs (4.1, 4.2 and 4.3) were used with SaCas9-KKH (FIG. 5A). The correct gRNA inserts were sequenced using a U6 sequencing primer: 5’-GACTATCATATGCTTACCGT- 3’.
Cell culture, transfection and sorting
Mouse primary dermal fibroblasts were established from neonatal C57BL/6
TmclWT/WT and TmclBth/WT animals. Briefly, after euthanasia, a small amount of skin was dissected into small pieces and washed with PBS. Next, cells were treated at 37 °C with 1 mg/ml collagenase I (Worthington) for 30 minutes followed by 0.05% trypsin-EDTA treatment for 15 minutes. Cells were cultured in 10% fetal bovine serum containing DMEM (Gibco) supplemented with lx penicillin/streptomycin (Gibco). Cell lines were validated by Sanger sequencing (see below). Mycoplasma screening (MycoAlert, Lonza, Basel) was performed regularly and before transfection experiments. For transfection of fibroblasts, Nucleofection (Lonza) (CZ-167 program, P2 Primary Cell 4D-Nucleofector X Kit) was used. Every transfection reaction was performed in duplicate and experiments were performed on at least two separate occasions. Four days after transfection of pX458 plasmids, cells were sorted based on GFP fluorescence using a FACS Aria Cell Sorter (BD), and genomic DNA was isolated and analyzed by Sanger sequencing and targeted deep sequencing (see below).
In the case of high fidelity SpCas9s (eSpCas9(E l), HypaCas9, SpCas9-HFl) and SaCas9- KKH transfections, cells were not sorted, but genomic DNA was isolated from all cells 4 days after transfection for deep-sequencing analysis.
Mouse genomic DNA isolation and PCR
Genomic DNA was isolated from fibroblasts 4 days after transfection using a Qiagen Blood and Tissue Kit (Qiagen). In the case of cochlear tissue, organs were harvested at different ages (FIG. 2C) and dissociated with lx collagenase I/5x dispase (Gibco) for 40 minutes in Cell Dissociation Buffer (Gibco), as described previously (Scheffer, D. I., et al, J. Neurosci. 35: 6366-80 (2015), the contents of which are incorporated herein by reference in their entirety). Organs were further dissociated by passing through a 20-gauge needle 10 times. DNA and RNA from cochlear tissue were isolated using a Qiagen AllPrep DNA/RNA micro kit. To amplify the Tmcl gene, the following primers were used: 5’- TAAAGGGACCGCTCTGAAAA-3’ (forward) and 5’-CCATCAAGGCGAGAATGAAT-3’ (reverse). To amplify Tmcl message, 5’-CCATCAAGGCGAGAATGAAT-3’ (forward) and 5’-ACCTCATCTTTTGGGCTGTG-3’ (reverse) primers were used. PCR products were visualized on a 1% agarose gel using GelRed (Thermo Fisher) and purified on a column (PCR Purification Kit, Qiagen). For Sanger sequencing, 200-500 ng genomic DNA was used as template, and for targeted deep sequencing 500-1400 ng genomic DNA was used.
Sequencing was performed at the MGH DNA Core (S anger-sequencing and CRISPR- sequencing service). Paired-end reads (150 bp) were generated on an Illumina MiSeq platform with a 100K read depth per sample (FIG. 13A). Sanger sequencing and TIDE analysis
Sanger sequencing was performed in the MGH DNA Core. Sequence traces were analyzed by deconvolution (TIDE, Tracking Indels by Decomposition, Desktop genetics, UK). Aberrant sequences were quantified downstream of the CRISPR cut site. Analysis was performed on forward versus reverse traces and efficiency was averaged.
Targeted deep sequencing data analysis
CRISPR-induced indels were analyzed by CRISPResso using two separate methods (FIGs. 13B and 13D, see below). During quantification, substitutions (only insertions and deletions were quantified) were ignored and indels outside of a 10 bp window of the CRISPR cut site were disregarded.
Global CRISPResso indel analysis
To analyze CRISPR action on both TmclBth and TmclWT alleles, the fastq files were subjected to CRISPResso analysis without segregating them to mutant and WT reads (FIG. 13B). Briefly, reads were split to read 1 and read 2 then merged using flash vl.2.11 (parameters: min overlap: 4, max overlap: 126, max mismatch density: 0.250000, allow "outie" pairs: true, cap mismatch quals: false, combiner threads: 8, input format: fastq, phred_offset=33, output format: fastq, phred_offset=33). Next, CRISPResso was run with the following parameters: CRISPResso -rl <fastq_file>— split_paired_end -w 5 -c
<protein_coding_sequence>— ignore substitutions -a <amplicon_sequence> -g
<gRNA_sequence>.
Allele-specific CRISPResso indel analysis
To analyze CRISPR action on TmclBth and TmclWT alleles separately, fastq files were first split into read 1 and read 2, and then merged using flash vl .2.11, as described above. The reads from heterozygous samples were segregated based on the presence of wild- type sequence (“TGGGACAGAACA” and its reverse complement“TGTTCTGTCCCA”) and mutant sequence (“TGGGACAGAACT” and its reverse complement
“AGTTCTGTCCCA”; mutation site is underlined) using a custom Python script (version 3.4.2) used previously (Gyorgy, B. et al, Mol. Ther. - Nucleic Acids 11 : 429-40 (2018), the contents of which are incorporated herein by reference in their entirety). Reads were segregated based on a sequence downstream of the projected CRISPR cut site so that indels have minor influence on the segregation (FIG. 13C). After segregation, CRISPResso was run separately on TmclBth and TmclWT reads with the following paramters: -rl
<fastq_file> -w 5 -c <protein_coding_sequence>— ignore substitutions -a
<amplicon_sequence> -g <gRNA_sequence>.
For mRNA analysis, the reads were first merged with flash as described above. CRISPResso analysis was performed similarly to global indel analysis (see above). To quantify intact, non-edited reads, the following sequences were used: 5’- CATCCCCAGGAGGG-3’ and 5’- CCCTCCTGGGGATG-3’ for WT reads, and 5’- CTTCCCC AGGAGGG-3’ and 5’- CCCTCCTGGGGAAG-3’ for mutant reads.
Off-target analysis
To detect genome-wide Cas9 nuclease activity, a GUIDE-Seq assay was performed in fibroblasts. Briefly, 2 pg of Cas9-2A-GFP-U6-gRNA-2.4 or 2 pg of pAAV-CMV-SaCas9- KKH-U6-gRNA-4.2 along with 50 pmol annealed GUIDE-Seq oligo (forward:
/5Phos/G*T*TTAATTGAGTTGTCATATGTTAATAACGGT*A*T, reverse:
/5Phos/A*T*ACCGTTATTAACATATGACAACTCAATTAA*A*C, stars indicate thioate bonds) were transfected into TmclBth/WT fibroblasts using electroporation (see above).
Four days after transfection, genomic DNA was isolated with a Qiagen DNA Blood and Tissue kit, and a library was constructed as described previously (Tsai, S. Q. et al, Nat. Biotechnol. 33: 187-98 (2015), the contents of which are incorporated herein by reference in their entirety). Sequencing was performed on an Illumina MiSeq machine. As a control, GUIDE-Seq oligo was transfected without CRISPR/Cas9 plasmids. GUIDE-Seq data were analyzed with the guideseq pipeline vl. lb4 (github.com/aryeelab/guideseq) using mmlO as the reference mouse genome.
AAV vector production
AAV vectors were produced by the Boston Children’s Hospital Viral Core (Boston, MA, USA). Plasmid containing SaCas9-KKH and gRNA 4.2 was sequenced before packaging (MGH DNA Core, complete plasmid sequencing) into AAV2/Anc8028. Vector titer was 4.8 1014 gc/ml as determined by qPCR specific for the inverted terminal repeat of the virus.
Inner ear injections Inner ears of TmclBth/WT or TmclWT//WT mouse pups were injected at PI with 1 pi of Anc80-AAV-CMV-SaCas9-KKH-U6-gRNA-4.2 virus at a rate of 60 nl/min. Pups were anesthetized using hypothermia exposure in ice water for 2-3 min. Upon anesthesia, a post-auricular incision was made to expose the otic bulla and visualize the cochlea.
Injections were made manually with a glass micropipette. After injection, a suture was used to close the skin cut. Then, the injected mice were placed on a 42°C heating pad for recovery. Pups were returned to the mother after they fully recovered within ~10 min. Standard post-operative care was applied after surgery. Sample sizes for in vivo studies were determined on a continuing basis to optimize the sample size and decrease the variance. At P5 to P7, organs of Corti were excised from injected ears. Organ of Corti tissues were incubated at 37°C, 5% CO2 for 8-10 days, the tectorial membrane was removed immediately before electrophysiology recording.
Hair cell electrophysiology
Mechanotransduction currents were recorded from cochlear IHCs and OHCs at P Id le. Organ of Corti tissues were bathed in external solution containing: 140 mM NaCl, 5.8 mM KC1, 0.7 mM NaH2P04, 10 mM HEPES, 1.3 mM CaCk, 0.9 mM MgCk, 5.6 mM glucose, and vitamins and essential amino acids (Thermo Fisher Scientific, Waltham, MA), adjusted to pH 7.4 with NaOH, -310 mmol/kg. Recording electrodes were pulled from R6 capillary glass (King Precision Glass). The intracellular solution contained: 140 mM CsCl, 5 mM EGTA, 5 mM HEPES, 2.5 mM Na2-ATP, 0.1 mM CaCk, and 3.5 mM MgCk, and was adjusted to pH 7.4 with CsOH, -285 mmol/kg. Mechanotransduction currents were recorded under whole-cell voltage-clamp configuration using an Axopatch 200B (Molecular Devices) amplifier. Cells were held at -80 mV for all electrophysiology recordings. Data were low-pass filtered at 5 kHz (Bessel filter), then sampled at 20 kHz with a 16-bit acquisition board (Digidata 1440 A). Data were corrected for a -4 mV liquid junction potential in standard extracellular solutions. Cochlea IHC and OHC bundles were deflected using stiff glass probes mounted on a PICMA chip piezo actuator (Physik Instruments) driven by an LPZT amplifier (Physik Instruments) and filtered with an 8-pole Bessel filter at 40 kHz to eliminate residual pipette resonance. Fire-polished stimulus pipettes with 3-5 pm tip diameter were designed to fit into the concave aspect of hair cell bundle as previously described (Stauffer and Holt, 2007). Hair bundle deflections were monitored using a C2400 CCD camera (Hamamatsu, Japan). Hearing tests
ABR and DPOAE measurements were recorded using the EPL Acoustic system (Massachusetts Eye and Ear, Boston). Stimuli were generated with 24-bit digital 1-0 cards (National Instruments PXI-4461) in a PXI-1042Q chassis, amplified by a SA-1 speaker driver (Tucker-Davis Technologies, Inc.), and delivered from two electrostatic drivers (CUI CDMG15008-03 A) in a custom acoustic system. An electret microphone (Knowles FG- 23329-P07) at the end of a small probe tube was used to monitor ear-canal sound pressure. ABRs and DPOAEs were recorded from mice during the same session. Mice were anesthetized with intraperitoneal injection of xylazine (5-10 mg/kg) and ketamine (60-100 mg/kg), and the base of the pinna was trimmed away to expose the ear canal. Three subcutaneous needle electrodes were inserted into the skin, including a) dorsally between the two ears (reference electrode); b) behind the left pinna (recording electrode); and c) dorsally at the rump of the animal (ground electrode). Additional aliquots of ketamine (60-100 mg/kg i.p.) were given throughout the session to maintain anesthesia if needed. DPOAEs were recorded first. FI and f2 primary tones (f2/fl = 1.2) were presented with f2 varied between 5.6 and 32.0 kHz in half-octave steps and L1-L2 = 10 dB SPL. At each f2, L2 was varied between 10 and 80 dB in 10 dB increments. DPOAE threshold was defined from the average spectra as the L2-level eliciting a DPOAE of magnitude 5 dB above the noise floor. The mean noise floor level was under 0 dB across all frequencies. ABR recordings were then recorded, with stimuli of broadband“click” tones as well as the pure tones between 5.6 and 32.0 kHz in half-octave steps, all presented as 5 ms tone pips. The responses were amplified (10,000 times), filtered (0.1-3 kHz), and averaged with an analog-to-digital board in a PC based data-acquisition system (EPL, Cochlear function test suite, MEE, Boston). Across various trials, the sound level was raised in 5 to 10 dB steps from 0 to 110 dB sound pressure level (decibels SPL). At each level, 512 responses were averaged (with stimulus polarity alternated) after“artifact rejection”. Threshold was determined by visual inspection of the appearance of Peak 1 relative to background noise. Data were analyzed and plotted using Origin-2015 (OriginLab Corporation, MA). Thresholds averages ± standard deviations are presented unless otherwise stated. The majority of these experiments were not performed under blind conditions.
Confocal microscopy The temporal bones of 24-week-old adult mice were harvested, cleaned, and placed in 4% PFA for 1 hour, followed by decalcification for 24 to 36 h with 120 mM EDTA (pH = 7.4). The sensory epithelium was then dissected and remained in PBS until staining. Tissues were permeabilized with 0.01% Triton X-100 for one hour, blocked with 2.5% NDS and 2.5 % BSA in 0.01% Triton X-100 for one hour, and then incubated with anti-MY07A primary antibody (Proteus Biosciences) overnight (1 :500 dilution). Tissues were then washed and counterstained with phalloidin for 2-3 hours. Images were acquired on a Zeiss LSM 800 laser confocal microscope. Full cochlear maps were reconstructed in Adobe Photoshop and tonotopically mapped using an ImageJ plugin.
Scanning electron microscopy
The temporal bones of 24-week-old adult mice were harvested, and cleaned temporal bones were placed in 2.5% glutaraldehyde in 0.1 M cacodylate buffer (EMS) supplemented with 2 mM CaCh for 45 minutes. Whole-mount tissues were dissected in distilled water and then dehydrated over the course of 4 hours to pure ethanol. Tissues were critical-point dried (Autosamdri-815, series A, Tousimis) and mounted on carbon tape attached to SEM specimen stubs. The mounted tissues were coated with 4 nm of platinum (Leica EM
ACE600) and then imaged at 5 kV with a scanning electron microscope (Hitachi S-4700 FESEM).
ClinVar database analysis
The ClinVar database from April 25, 2019 was downloaded from
ftp.ncbi.nlm.nih. gov/pub/clinvar/vcf_GRCh38/archive_2.0/2019/clinvar_20190325.vcf.gz. The database was filtered for‘dominant’ diseases, resulting in 17,783 entries. The possibility of generating a PAM site from single nucleotide mutations was analyzed for the SaCas9 (GRRT) and SaCas9-KKH (RRT) recognition motifs. The GRCh38 human reference genome was queried for 7-nt or 5-nt sequences surrounding the site of interest, i.e., 3 (GRRT) or 2 (RRT) nucleotides on either side of the mutation. These sequences were analyzed with a sliding window of length 4 (GRRT) or 3 (RRT) nucleotides. Entries that had a putative PAM site in both the‘variant’ nucleotide string and the‘reference’ (i.e. wild-type) string were excluded from further analysis. The same procedure was used for the reverse complement strand. The resulting databases (all dominant entries, dominant entries with PAM site formation for SaCas9, and dominant entries with PAM site formation for SaCas9-KKH recognition) are uploaded as Supplementary Tables 3-5. All ClinVar entries were analyzed without filtering from dominant diseases. This analysis was done, as several dominant variants are not annotated as‘dominant’ in the ClinVar database.
TMC1 gene inactivation in human haploid cells
A human cell line carrying the equivalent of the Beethoven mutation in the human TMC1 gene (ATG to AAG mutation, encoding the M418K amino acid substitution) was engineered from the HAP1 parental cell line derived from the KBM-7 haploid cells (Horizon Genomics GmbH, Vienna, Austria)29. Briefly, a T to A point mutation was introduced in the exon 16 of the TMC1 gene (ENSG00000165091; genomic location: chr9: 72,791,914) to generate the TCCCTCCTAGGGAAGTTC sequence. For insertion of the mutation by gene editing, the HAP1 cell line was modified with the CRISPR/Cas9 nuclease using two guide RNA sequences (5’-CATCGCTTTGAAATGGCTAC-3’ and 5’-
AACCATGTTCATCTACAAGG-3’) and a 1 kb donor template encompassing TMC1 exon 6 and which contained the T to A Beethoven mutation. The genetic identity of the cells was verified by Sanger sequencing of a PCR amplicon.
The parental and HAP1 cell lines were cultured as monolayer at 37°C in a humidified atmosphere with 5% CC , using IMDM medium plus GlutaMAX (Gibco) supplemented with 10% FBS, 100 U/ml penicilin and 100 pg/ml streptomycin. Cells were passaged every 2-3 days when reaching 70-75% confluency. For transfection, the cells were grown in 6-well plates at a 70% confluency. One day later, cells were transfected with 2.5 pg pDNA using Lipofectamine 3000 (ThermoFisher), following manufacturer’s instructions. Two days after transfection, the cells were collected by trypsinization, and the pellet was stored at -20°C. Total genomic DNA was extracted from the cells with the NucleoSpin® Tissue kit
(Macherey -Nagel AG, Switzerland). A PCR amplicon was amplified for next-generation sequencing, using the Phusion High-Fidelity DNA Polymerase (ThermoFisher). For TMC1DFNA36 cells, the primers used were 5’ - AGC CT AGCT C AGAAT CTTCC A-3’ and 5’-AAAATGCGTCCCAGTAGCCA-3’. For TMCWT cells, the 5’- AAAATGCGTCCAAGTAGCCA-3’ was used due to a point mutation in the primer binding region. The PCR protocol was based on manufacturer’s instruction, with 35 cycles (5 s at 98°C; 20 s at 59°C; 15 s at 72°C). The PCR product was visualized on a 2% agarose gel and purified with the PCR clean-up and gel extraction kit (Macherey -Nagel AG, Switzerland). Next-generation sequencing was performed by the Massachusetts General Hospital DNA Core facility.
To verify transfection efficacy in each sample, TaqMan real-time PCR was used to quantify the number of plasmid copies of the sequence contained in the AAV inverted terminal repeats using the following primers: forward: 5’-GGA ACC CCT AGT GAT GGA GTT-3’; reverse: 5 -CGG CCT CAG TGA GCG A-3’; probe: 5’-FAM-CAC TCC CTC TCT GCG CGC TCG-BHQl-3’. The amount of cellular gDNA was quantified using a set of primers specific for the human albumin gene: forward: 5’-TGA AAC ATA CGT TCC CAA AGA GTT T-3’; reverse: 5’-CTC TCC TTC TCA GAA AGT GTG CAT AT-3’; probe: 5’- FAM-TGC TGA AAC ATT CAC CTT CCA TGC AGA-BHQ1-3’. Absolute number of copies were determined according to standards and used to calculate the number of plasmid copies per cell.
Statistical analysis
GraphPad Prism 7.0 for Mac OS and OriginPro (2015) were used for statistical analysis. To compare means, an unpaired two tailed t-test (after Shapiro-Wilk normality testing) was used; to compare multiple groups, ANOVA followed by Tukey’s post-hoc test (to compare every mean to every other mean) or Dunnetf s test (to compare every mean to a control group mean) was used p values <0.05 were accepted as significant.
Other Embodiments
From the foregoing description, it will be apparent that variations and modifications may be made to the invention described herein to adopt it to various usages and conditions. Such embodiments are also within the scope of the following claims.
The recitation of a listing of elements in any definition of a variable herein includes definitions of that variable as any single element or combination (or subcombination) of listed elements. The recitation of an embodiment herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.
All patents and publications mentioned in this specification are herein incorporated by reference to the same extent as if each independent patent and publication was specifically and individually indicated to be incorporated by reference.

Claims

What is claimed is:
1. A method for allele specific gene editing, the method comprising contacting a double stranded polynucleotide comprising a wild-type allele and a mutant allele with a guide RNA that binds the alleles and a Cas9 polypeptide with a PAM site selective for the mutant allele, such that indels are selectively induced in the mutant target allele.
2. A method for the allele-specific disruption of a dominant mutation, the method comprising contacting a double stranded polynucleotide comprising a wild-type allele and a mutant allele with a guide RNA that binds the alleles and a Cas9 nuclease with a PAM site selective for the mutant allele, such that indels are selectively induced in the mutant allele.
3. The method of any one of claims 1-2, wherein the double stranded polynucleotide is DNA.
4. The method of claim 3, wherein the DNA is genomic DNA.
5. The method of any one of claims 1-2, wherein the polynucleotide is present in a cell.
6. The method of claim 5, wherein the cell is a cell in vivo or in vitro.
7. A method for the treatment of a disorder associated with a dominant mutant allele in a target gene, the method comprising:
(a) contacting a cell heterozygous for the dominant mutant allele in a target gene with a guide RNA that binds the target gene and a Cas9 nuclease with a PAM site selective for the mutant allele; and
(b) selectively inducing an indel in the mutant allele.
8. A method of treating progressive hearing loss in a subject, the method comprising
(a) contacting a cell of a subject heterozygous for a p.M418K mutation in TMC1 with a SaCas9-KKH and a guide RNA that targets TMC1; and
(b) inducing indels in the TMC1 allele comprising the p.M418K mutation, thereby treating hearing loss in the subject.
9. The method of claim 8, wherein the cell is a cell of the inner ear.
10. The method of claim 9, wherein the cell is an inner or outer hair cell.
11. The method of claim 8, wherein the administering improves or maintains auditory function in the subject.
12. The method of claim 11, wherein an improvement in auditory function is associated with preservation of hair bundle morphology and/or restoration of mechanotransduction.
13. The method of any of claims 1-12, wherein the guide RNA and the Cas9 polypeptide are encoded in a single vector.
14. The method of claim 13, wherein the vector is an adeno-associated virus vector or a lentivirus vector.
15. The method of claim 1, wherein the contacting comprises transfecting cells in the subject with a guide RNA and a polynucleotide encoding a Cas9 protein.
16. The method of claim 15, wherein the guide RNA and the Cas9 polypeptide are administered simultaneously.
17. A vector comprising a polynucleotide encoding a SaCas9-KKH polypeptide, or a fragment thereof, and a gRNA having a nucleic acid sequence complementary to a nucleic acid sequence comprising a mutation associated with DFNA36.
18. A pharmaceutical composition comprising the vector of claim 17.
PCT/US2020/038516 2019-06-21 2020-06-18 Methods and compositions for allele specific gene editing Ceased WO2020257514A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/556,463 US20220112504A1 (en) 2019-06-21 2021-12-20 Methods and compositions for allele specific gene editing

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962864933P 2019-06-21 2019-06-21
US62/864,933 2019-06-21

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/556,463 Continuation US20220112504A1 (en) 2019-06-21 2021-12-20 Methods and compositions for allele specific gene editing

Publications (1)

Publication Number Publication Date
WO2020257514A1 true WO2020257514A1 (en) 2020-12-24

Family

ID=74040696

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/038516 Ceased WO2020257514A1 (en) 2019-06-21 2020-06-18 Methods and compositions for allele specific gene editing

Country Status (2)

Country Link
US (1) US20220112504A1 (en)
WO (1) WO2020257514A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113584082A (en) * 2021-06-22 2021-11-02 复旦大学附属眼耳鼻喉科医院 CRISPR/Cas9 gene editing system and application thereof in preparation of medicine for treating hereditary sensorineural deafness
WO2023285431A1 (en) * 2021-07-12 2023-01-19 Alia Therapeutics Srl Compositions and methods for allele specific treatment of retinitis pigmentosa

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025166351A1 (en) * 2024-02-01 2025-08-07 Massachusetts Eye And Ear Infirmary Compositions and methods for hearing loss

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170152528A1 (en) * 2012-12-12 2017-06-01 The Broad Institute Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170152528A1 (en) * 2012-12-12 2017-06-01 The Broad Institute Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
GAO, X ET AL.: "Treatment of autosomal dominant hearing loss by in vivo delivery of genome editing agents", NATURE, vol. 553, no. 7687, 11 January 2018 (2018-01-11), pages 217 - 221, XP055776079, DOI: 10.1038/nature25164 *
GYORGY, B ET AL.: "Allele-specific gene editing prevents deafness in a model of dominant progressive hearing loss", NATURE MEDICINE, vol. 25, no. 7, 3 July 2019 (2019-07-03), pages 1123 - 1130, XP036901105, DOI: 10.1038/s41591-019-0500-9 *
GYORGY, B ET AL.: "CRISPR/Cas9 Mediated Disruption of the Swedish APP Allele as a Therapeutic Approach for Early-Onset Alzheimer's Disease", MOLECULAR THERAPY: NUCLEIC ACIDS, vol. 11, June 2018 (2018-06-01), pages 429 - 440, XP055776075, DOI: 10.1016/j.omtn.2018.03.007 *
KLEINSTIVER, BP ET AL.: "Broadening Staphylococcus aureus Cas9 Targeting Range by Modifying PAM Recognition", NATURE BIOTECHNOLOGY, vol. 33, no. 12, December 2015 (2015-12-01), pages 1293 - 1298, XP055309933, DOI: 10.1038/nbt.3404 *
LI PINGJUAN ET AL.: "Allele-Specific CRISPR-Cas9 Genome Editing of the Single-Base P23H Mutation for Rhodopsin-Associated Dominant Retinitis Pigmentosa", THE CRISPR JOURNAL, vol. 1, no. 1, February 2018 (2018-02-01), pages 55 - 64, XP055557445, DOI: 10.1089/crispr.2017.0009 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113584082A (en) * 2021-06-22 2021-11-02 复旦大学附属眼耳鼻喉科医院 CRISPR/Cas9 gene editing system and application thereof in preparation of medicine for treating hereditary sensorineural deafness
WO2023285431A1 (en) * 2021-07-12 2023-01-19 Alia Therapeutics Srl Compositions and methods for allele specific treatment of retinitis pigmentosa

Also Published As

Publication number Publication date
US20220112504A1 (en) 2022-04-14

Similar Documents

Publication Publication Date Title
US20230330268A1 (en) Materials and methods for delivering nucleic acids to cochlear and vestibular cells
JP7846626B2 (en) Large gene vectors and methods for their delivery and use
US12281313B2 (en) Compositions and methods for delivering nucleic acids to cochlear and vestibular cells
JP2023516692A (en) Methods and compositions for modulating the genome
CN110337493B (en) Compositions and methods for treating myotonic dystrophy
US20220112504A1 (en) Methods and compositions for allele specific gene editing
CN114245803A (en) Methods and compositions for reconstituting microglia
JP2021500070A (en) Adeno-associated virus composition for restoring HBB gene function and how to use it
Chung et al. Functional, sustained recovery of hearing in Otoferlin-deficient mice using DB-OTO, a hair-cell-specific AAV-based gene therapy
JP7724721B2 (en) Compositions and methods for gene replacement
US20230220361A1 (en) Crispr-cas9 mediated disruption of alcam gene inhibits adhesion and trans-endothelial migration of myeloid cells
US20240189451A1 (en) Exosome gene therapy for treating inner ear disease
JP2025538153A (en) Muscle-specific base editor for correcting mutations causing dilated cardiomyopathy
CN110099999A (en) Animal model and its treatment method for hearing disability syndrome
CN114762733B (en) Cochlear outer hair cell-specific cis-regulatory element and its application
LLADO SANTAEULARIA THERAPEUTIC GENOME EDITING IN RETINA AND LIVER
WO2025235828A2 (en) Engineered prime editors for treating genetic deafness
TW202603174A (en) Aav capsids comprising anti-transferrin antibody domains
WO2023229964A2 (en) Compositions and methods for hearing loss
TW202535908A (en) Redirection of aav capsids for central nervous system targeting
JP2025515471A (en) Improving the safety and accuracy of CRISPR-Cas-induced gene editing by using a variant of DNA polymerase with CAS-PLUS variant
IT202000008014A1 (en) Guide RNA and their uses

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20827799

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 20827799

Country of ref document: EP

Kind code of ref document: A1