WO2023285431A1 - Compositions and methods for allele specific treatment of retinitis pigmentosa - Google Patents
Compositions and methods for allele specific treatment of retinitis pigmentosa Download PDFInfo
- Publication number
- WO2023285431A1 WO2023285431A1 PCT/EP2022/069401 EP2022069401W WO2023285431A1 WO 2023285431 A1 WO2023285431 A1 WO 2023285431A1 EP 2022069401 W EP2022069401 W EP 2022069401W WO 2023285431 A1 WO2023285431 A1 WO 2023285431A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- grna
- seq
- sequence
- cell
- mutation
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 226
- 108700028369 Alleles Proteins 0.000 title claims description 182
- 239000000203 mixture Substances 0.000 title abstract description 29
- 208000007014 Retinitis pigmentosa Diseases 0.000 title description 25
- 238000011282 treatment Methods 0.000 title description 22
- 108020005004 Guide RNA Proteins 0.000 claims abstract description 483
- 108091033409 CRISPR Proteins 0.000 claims abstract description 313
- 239000002245 particle Substances 0.000 claims abstract description 268
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 214
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 211
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 211
- 101150079354 rho gene Proteins 0.000 claims abstract description 59
- 101000611338 Homo sapiens Rhodopsin Proteins 0.000 claims abstract description 15
- 230000035772 mutation Effects 0.000 claims description 405
- 210000004027 cell Anatomy 0.000 claims description 366
- 125000003729 nucleotide group Chemical group 0.000 claims description 341
- 239000002773 nucleotide Substances 0.000 claims description 339
- 102100040756 Rhodopsin Human genes 0.000 claims description 204
- 108090000820 Rhodopsin Proteins 0.000 claims description 197
- 125000006850 spacer group Chemical group 0.000 claims description 171
- 230000001717 pathogenic effect Effects 0.000 claims description 115
- 238000012217 deletion Methods 0.000 claims description 69
- 230000037430 deletion Effects 0.000 claims description 69
- 239000008194 pharmaceutical composition Substances 0.000 claims description 34
- 230000004048 modification Effects 0.000 claims description 33
- 238000012986 modification Methods 0.000 claims description 33
- 101100518359 Homo sapiens RHO gene Proteins 0.000 claims description 32
- 210000000130 stem cell Anatomy 0.000 claims description 32
- 241000282414 Homo sapiens Species 0.000 claims description 31
- 150000002632 lipids Chemical class 0.000 claims description 27
- 230000003612 virological effect Effects 0.000 claims description 27
- 230000002207 retinal effect Effects 0.000 claims description 25
- 210000005260 human cell Anatomy 0.000 claims description 23
- 210000001164 retinal progenitor cell Anatomy 0.000 claims description 23
- 102200141512 rs104893768 Human genes 0.000 claims description 23
- 241000702423 Adeno-associated virus - 2 Species 0.000 claims description 22
- 150000001413 amino acids Chemical class 0.000 claims description 22
- 239000002105 nanoparticle Substances 0.000 claims description 19
- 210000000608 photoreceptor cell Anatomy 0.000 claims description 19
- 241001164825 Adeno-associated virus - 8 Species 0.000 claims description 18
- 241001634120 Adeno-associated virus - 5 Species 0.000 claims description 17
- 241000702421 Dependoparvovirus Species 0.000 claims description 15
- 241000193996 Streptococcus pyogenes Species 0.000 claims description 15
- 238000001727 in vivo Methods 0.000 claims description 15
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 13
- 102200141258 rs29001566 Human genes 0.000 claims description 13
- 101710132601 Capsid protein Proteins 0.000 claims description 11
- 230000000295 complement effect Effects 0.000 claims description 11
- 210000002919 epithelial cell Anatomy 0.000 claims description 8
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 claims description 7
- 239000010931 gold Substances 0.000 claims description 7
- 229910052737 gold Inorganic materials 0.000 claims description 7
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 7
- 238000003205 genotyping method Methods 0.000 claims description 5
- 230000008685 targeting Effects 0.000 abstract description 98
- NCYCYZXNIZJOKI-IOUUIBBYSA-N 11-cis-retinal Chemical compound O=C/C=C(\C)/C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C NCYCYZXNIZJOKI-IOUUIBBYSA-N 0.000 description 182
- 230000014509 gene expression Effects 0.000 description 60
- 239000013598 vector Substances 0.000 description 52
- 108090000623 proteins and genes Proteins 0.000 description 46
- 230000015572 biosynthetic process Effects 0.000 description 37
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 33
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 33
- 108091034117 Oligonucleotide Proteins 0.000 description 32
- 108020004414 DNA Proteins 0.000 description 31
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 31
- 102000040430 polynucleotide Human genes 0.000 description 31
- 108091033319 polynucleotide Proteins 0.000 description 31
- 239000002157 polynucleotide Substances 0.000 description 31
- 125000003275 alpha amino acid group Chemical group 0.000 description 30
- -1 e.g. Proteins 0.000 description 28
- 239000013612 plasmid Substances 0.000 description 28
- 230000000694 effects Effects 0.000 description 27
- 239000013603 viral vector Substances 0.000 description 27
- 108090000765 processed proteins & peptides Chemical group 0.000 description 26
- 210000004263 induced pluripotent stem cell Anatomy 0.000 description 25
- 229920001184 polypeptide Chemical group 0.000 description 25
- 102000004196 processed proteins & peptides Human genes 0.000 description 25
- 108020004999 messenger RNA Proteins 0.000 description 24
- 102000004169 proteins and genes Human genes 0.000 description 23
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 21
- 235000001014 amino acid Nutrition 0.000 description 21
- 229940024606 amino acid Drugs 0.000 description 21
- 235000018102 proteins Nutrition 0.000 description 19
- 239000013607 AAV vector Substances 0.000 description 18
- 241000700605 Viruses Species 0.000 description 18
- 229940035893 uracil Drugs 0.000 description 18
- 230000008672 reprogramming Effects 0.000 description 17
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 16
- 238000001890 transfection Methods 0.000 description 16
- 238000003776 cleavage reaction Methods 0.000 description 15
- 238000011156 evaluation Methods 0.000 description 15
- 230000007017 scission Effects 0.000 description 15
- 238000006467 substitution reaction Methods 0.000 description 15
- 210000001519 tissue Anatomy 0.000 description 15
- 238000013461 design Methods 0.000 description 14
- 230000003828 downregulation Effects 0.000 description 14
- 108020001507 fusion proteins Proteins 0.000 description 14
- 102000037865 fusion proteins Human genes 0.000 description 14
- 230000001105 regulatory effect Effects 0.000 description 14
- 239000003795 chemical substances by application Substances 0.000 description 13
- 238000003146 transient transfection Methods 0.000 description 13
- PHTXVQQRWJXYPP-UHFFFAOYSA-N ethyltrifluoromethylaminoindane Chemical compound C1=C(C(F)(F)F)C=C2CC(NCC)CC2=C1 PHTXVQQRWJXYPP-UHFFFAOYSA-N 0.000 description 12
- 238000010362 genome editing Methods 0.000 description 12
- 238000004422 calculation algorithm Methods 0.000 description 11
- 238000001514 detection method Methods 0.000 description 11
- 239000013604 expression vector Substances 0.000 description 11
- 230000006780 non-homologous end joining Effects 0.000 description 11
- 241000701022 Cytomegalovirus Species 0.000 description 10
- 101710163270 Nuclease Proteins 0.000 description 10
- 239000002253 acid Substances 0.000 description 10
- 125000000217 alkyl group Chemical group 0.000 description 10
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 10
- 210000001525 retina Anatomy 0.000 description 10
- 210000001082 somatic cell Anatomy 0.000 description 10
- 238000013518 transcription Methods 0.000 description 10
- 230000035897 transcription Effects 0.000 description 10
- RYVNIFSIEDRLSJ-UHFFFAOYSA-N 5-(hydroxymethyl)cytosine Chemical compound NC=1NC(=O)N=CC=1CO RYVNIFSIEDRLSJ-UHFFFAOYSA-N 0.000 description 9
- 150000001875 compounds Chemical class 0.000 description 9
- 230000006870 function Effects 0.000 description 9
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 9
- 230000008439 repair process Effects 0.000 description 9
- 235000000346 sugar Nutrition 0.000 description 9
- 102000004533 Endonucleases Human genes 0.000 description 8
- 108010042407 Endonucleases Proteins 0.000 description 8
- 238000011529 RT qPCR Methods 0.000 description 8
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- 108091008695 photoreceptors Proteins 0.000 description 8
- 239000000047 product Substances 0.000 description 8
- 210000003583 retinal pigment epithelium Anatomy 0.000 description 8
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 8
- 108020004705 Codon Proteins 0.000 description 7
- 108091093037 Peptide nucleic acid Proteins 0.000 description 7
- 230000008901 benefit Effects 0.000 description 7
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical group C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 7
- 201000010099 disease Diseases 0.000 description 7
- 238000005516 engineering process Methods 0.000 description 7
- 239000003623 enhancer Substances 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 229920001223 polyethylene glycol Polymers 0.000 description 7
- 230000002829 reductive effect Effects 0.000 description 7
- 238000011160 research Methods 0.000 description 7
- 238000010361 transduction Methods 0.000 description 7
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 6
- 229930024421 Adenine Natural products 0.000 description 6
- 241000713666 Lentivirus Species 0.000 description 6
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- 102100035423 POU domain, class 5, transcription factor 1 Human genes 0.000 description 6
- 239000002202 Polyethylene glycol Substances 0.000 description 6
- 108091028113 Trans-activating crRNA Proteins 0.000 description 6
- 229960000643 adenine Drugs 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 230000001419 dependent effect Effects 0.000 description 6
- 238000000338 in vitro Methods 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 210000002569 neuron Anatomy 0.000 description 6
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 6
- 238000012163 sequencing technique Methods 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 238000001262 western blot Methods 0.000 description 6
- 102000003964 Histone deacetylase Human genes 0.000 description 5
- 108090000353 Histone deacetylase Proteins 0.000 description 5
- 101000991410 Homo sapiens Nucleolar and spindle-associated protein 1 Proteins 0.000 description 5
- 210000005156 Müller Glia Anatomy 0.000 description 5
- 102100030991 Nucleolar and spindle-associated protein 1 Human genes 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 239000011543 agarose gel Substances 0.000 description 5
- 238000001574 biopsy Methods 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 235000012000 cholesterol Nutrition 0.000 description 5
- 230000001186 cumulative effect Effects 0.000 description 5
- 229940104302 cytosine Drugs 0.000 description 5
- 230000005782 double-strand break Effects 0.000 description 5
- 239000003814 drug Substances 0.000 description 5
- 230000000670 limiting effect Effects 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 210000001778 pluripotent stem cell Anatomy 0.000 description 5
- 210000000880 retinal rod photoreceptor cell Anatomy 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- 230000026683 transduction Effects 0.000 description 5
- 241000701161 unidentified adenovirus Species 0.000 description 5
- 108020003589 5' Untranslated Regions Proteins 0.000 description 4
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 4
- 108091093088 Amplicon Proteins 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 4
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 4
- 241000714474 Rous sarcoma virus Species 0.000 description 4
- 241000700584 Simplexvirus Species 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 4
- 150000007513 acids Chemical class 0.000 description 4
- 150000001408 amides Chemical group 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 210000001185 bone marrow Anatomy 0.000 description 4
- 238000012937 correction Methods 0.000 description 4
- 238000007848 endpoint PCR Methods 0.000 description 4
- 239000012091 fetal bovine serum Substances 0.000 description 4
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 4
- 238000002513 implantation Methods 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- 210000004379 membrane Anatomy 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 239000002777 nucleoside Substances 0.000 description 4
- 150000003904 phospholipids Chemical class 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 239000002904 solvent Substances 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 229940113082 thymine Drugs 0.000 description 4
- 231100000419 toxicity Toxicity 0.000 description 4
- 230000001988 toxicity Effects 0.000 description 4
- 238000013519 translation Methods 0.000 description 4
- 241001430294 unidentified retrovirus Species 0.000 description 4
- OVONXEQGWXGFJD-UHFFFAOYSA-N 4-sulfanylidene-1h-pyrimidin-2-one Chemical compound SC=1C=CNC(=O)N=1 OVONXEQGWXGFJD-UHFFFAOYSA-N 0.000 description 3
- LRSASMSXMSNRBT-UHFFFAOYSA-N 5-methylcytosine Chemical compound CC1=CNC(=O)N=C1N LRSASMSXMSNRBT-UHFFFAOYSA-N 0.000 description 3
- MSSXOMSJDRHRMC-UHFFFAOYSA-N 9H-purine-2,6-diamine Chemical compound NC1=NC(N)=C2NC=NC2=N1 MSSXOMSJDRHRMC-UHFFFAOYSA-N 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 101710177611 DNA polymerase II large subunit Proteins 0.000 description 3
- 101710184669 DNA polymerase II small subunit Proteins 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 3
- 108700024394 Exon Proteins 0.000 description 3
- 206010064571 Gene mutation Diseases 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- 101000687905 Homo sapiens Transcription factor SOX-2 Proteins 0.000 description 3
- 108700021430 Kruppel-Like Factor 4 Proteins 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- 102000008730 Nestin Human genes 0.000 description 3
- 108010088225 Nestin Proteins 0.000 description 3
- 239000004952 Polyamide Substances 0.000 description 3
- 101100247004 Rattus norvegicus Qsox1 gene Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 3
- 102000040945 Transcription factor Human genes 0.000 description 3
- 108091023040 Transcription factor Proteins 0.000 description 3
- 102100024270 Transcription factor SOX-2 Human genes 0.000 description 3
- 102100035071 Vimentin Human genes 0.000 description 3
- 108010065472 Vimentin Proteins 0.000 description 3
- 230000000692 anti-sense effect Effects 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 230000037429 base substitution Effects 0.000 description 3
- 230000027455 binding Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 125000002091 cationic group Chemical group 0.000 description 3
- 125000000753 cycloalkyl group Chemical group 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 230000002708 enhancing effect Effects 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 210000001654 germ layer Anatomy 0.000 description 3
- 238000009396 hybridization Methods 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 230000037041 intracellular level Effects 0.000 description 3
- 238000005304 joining Methods 0.000 description 3
- 125000005647 linker group Chemical group 0.000 description 3
- 238000004020 luminiscence type Methods 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 210000002901 mesenchymal stem cell Anatomy 0.000 description 3
- 125000000325 methylidene group Chemical group [H]C([H])=* 0.000 description 3
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 3
- 210000002894 multi-fate stem cell Anatomy 0.000 description 3
- 210000005055 nestin Anatomy 0.000 description 3
- 230000007935 neutral effect Effects 0.000 description 3
- 150000003833 nucleoside derivatives Chemical class 0.000 description 3
- 230000009438 off-target cleavage Effects 0.000 description 3
- 230000003285 pharmacodynamic effect Effects 0.000 description 3
- 108010079892 phosphoglycerol kinase Proteins 0.000 description 3
- 229920002647 polyamide Polymers 0.000 description 3
- 229920000768 polyamine Polymers 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 229950010131 puromycin Drugs 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 238000003757 reverse transcription PCR Methods 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- OHRURASPPZQGQM-GCCNXGTGSA-N romidepsin Chemical compound O1C(=O)[C@H](C(C)C)NC(=O)C(=C/C)/NC(=O)[C@H]2CSSCC\C=C\[C@@H]1CC(=O)N[C@H](C(C)C)C(=O)N2 OHRURASPPZQGQM-GCCNXGTGSA-N 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 230000005783 single-strand break Effects 0.000 description 3
- 235000002639 sodium chloride Nutrition 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- RTKIYFITIVXBLE-QEQCGCAPSA-N trichostatin A Chemical compound ONC(=O)/C=C/C(/C)=C/[C@@H](C)C(=O)C1=CC=C(N(C)C)C=C1 RTKIYFITIVXBLE-QEQCGCAPSA-N 0.000 description 3
- 238000010200 validation analysis Methods 0.000 description 3
- 210000005048 vimentin Anatomy 0.000 description 3
- WAEXFXRVDQXREF-UHFFFAOYSA-N vorinostat Chemical compound ONC(=O)CCCCCCC(=O)NC1=CC=CC=C1 WAEXFXRVDQXREF-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 2
- BHQCQFFYRZLCQQ-UHFFFAOYSA-N (3alpha,5alpha,7alpha,12alpha)-3,7,12-trihydroxy-cholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 BHQCQFFYRZLCQQ-UHFFFAOYSA-N 0.000 description 2
- QGVQZRDQPDLHHV-DPAQBDIFSA-N (3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthrene-3-thiol Chemical compound C1C=C2C[C@@H](S)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 QGVQZRDQPDLHHV-DPAQBDIFSA-N 0.000 description 2
- PFDHVDFPTKSEKN-YOXFSPIKSA-N 2-Amino-8-oxo-9,10-epoxy-decanoic acid Chemical compound OC(=O)[C@H](N)CCCCCC(=O)C1CO1 PFDHVDFPTKSEKN-YOXFSPIKSA-N 0.000 description 2
- NEAQRZUHTPSBBM-UHFFFAOYSA-N 2-hydroxy-3,3-dimethyl-7-nitro-4h-isoquinolin-1-one Chemical compound C1=C([N+]([O-])=O)C=C2C(=O)N(O)C(C)(C)CC2=C1 NEAQRZUHTPSBBM-UHFFFAOYSA-N 0.000 description 2
- ZLAQATDNGLKIEV-UHFFFAOYSA-N 5-methyl-2-sulfanylidene-1h-pyrimidin-4-one Chemical compound CC1=CNC(=S)NC1=O ZLAQATDNGLKIEV-UHFFFAOYSA-N 0.000 description 2
- UJBCLAXPPIDQEE-UHFFFAOYSA-N 5-prop-1-ynyl-1h-pyrimidine-2,4-dione Chemical compound CC#CC1=CNC(=O)NC1=O UJBCLAXPPIDQEE-UHFFFAOYSA-N 0.000 description 2
- PEHVGBZKEYRQSX-UHFFFAOYSA-N 7-deaza-adenine Chemical compound NC1=NC=NC2=C1C=CN2 PEHVGBZKEYRQSX-UHFFFAOYSA-N 0.000 description 2
- LOSIULRWFAEMFL-UHFFFAOYSA-N 7-deazaguanine Chemical compound O=C1NC(N)=NC2=C1CC=N2 LOSIULRWFAEMFL-UHFFFAOYSA-N 0.000 description 2
- HCGHYQLFMPXSDU-UHFFFAOYSA-N 7-methyladenine Chemical compound C1=NC(N)=C2N(C)C=NC2=N1 HCGHYQLFMPXSDU-UHFFFAOYSA-N 0.000 description 2
- LPXQRXLUHJKZIE-UHFFFAOYSA-N 8-azaguanine Chemical compound NC1=NC(O)=C2NN=NC2=N1 LPXQRXLUHJKZIE-UHFFFAOYSA-N 0.000 description 2
- 229960005508 8-azaguanine Drugs 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- 102000005427 Asialoglycoprotein Receptor Human genes 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 101000909256 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) DNA polymerase I Proteins 0.000 description 2
- 239000004380 Cholic acid Substances 0.000 description 2
- DWJXYEABWRJFSP-XOBRGWDASA-N DAPT Chemical compound N([C@@H](C)C(=O)N[C@H](C(=O)OC(C)(C)C)C=1C=CC=CC=1)C(=O)CC1=CC(F)=CC(F)=C1 DWJXYEABWRJFSP-XOBRGWDASA-N 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- 230000033616 DNA repair Effects 0.000 description 2
- 230000007018 DNA scission Effects 0.000 description 2
- DLVJMFOLJOOWFS-UHFFFAOYSA-N Depudecin Natural products CC(O)C1OC1C=CC1C(C(O)C=C)O1 DLVJMFOLJOOWFS-UHFFFAOYSA-N 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 2
- 102000011787 Histone Methyltransferases Human genes 0.000 description 2
- 108010036115 Histone Methyltransferases Proteins 0.000 description 2
- 101000615488 Homo sapiens Methyl-CpG-binding domain protein 2 Proteins 0.000 description 2
- 101000984042 Homo sapiens Protein lin-28 homolog A Proteins 0.000 description 2
- 101000854931 Homo sapiens Visual system homeobox 2 Proteins 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 2
- 102100034343 Integrase Human genes 0.000 description 2
- 108010061833 Integrases Proteins 0.000 description 2
- 108091092195 Intron Proteins 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical group [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 102100025169 Max-binding protein MNT Human genes 0.000 description 2
- 201000009906 Meningitis Diseases 0.000 description 2
- 102100021299 Methyl-CpG-binding domain protein 2 Human genes 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 2
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 208000009869 Neu-Laxova syndrome Diseases 0.000 description 2
- REYJJPSVUYRZGE-UHFFFAOYSA-N Octadecylamine Chemical compound CCCCCCCCCCCCCCCCCCN REYJJPSVUYRZGE-UHFFFAOYSA-N 0.000 description 2
- 108010032788 PAX6 Transcription Factor Proteins 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 101710126211 POU domain, class 5, transcription factor 1 Proteins 0.000 description 2
- 102100037506 Paired box protein Pax-6 Human genes 0.000 description 2
- 102100025460 Protein lin-28 homolog A Human genes 0.000 description 2
- 101000902592 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) DNA polymerase Proteins 0.000 description 2
- 230000026279 RNA modification Effects 0.000 description 2
- 102000018120 Recombinases Human genes 0.000 description 2
- 108010091086 Recombinases Proteins 0.000 description 2
- 201000007737 Retinal degeneration Diseases 0.000 description 2
- 108091081024 Start codon Proteins 0.000 description 2
- 241000194020 Streptococcus thermophilus Species 0.000 description 2
- 206010043276 Teratoma Diseases 0.000 description 2
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 108091023045 Untranslated Region Proteins 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- 102100020676 Visual system homeobox 2 Human genes 0.000 description 2
- NRLNQCOGCKAESA-KWXKLSQISA-N [(6z,9z,28z,31z)-heptatriaconta-6,9,28,31-tetraen-19-yl] 4-(dimethylamino)butanoate Chemical compound CCCCC\C=C/C\C=C/CCCCCCCCC(OC(=O)CCCN(C)C)CCCCCCCC\C=C/C\C=C/CCCCC NRLNQCOGCKAESA-KWXKLSQISA-N 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- XVIYCJDWYLJQBG-UHFFFAOYSA-N acetic acid;adamantane Chemical compound CC(O)=O.C1C(C2)CC3CC1CC2C3 XVIYCJDWYLJQBG-UHFFFAOYSA-N 0.000 description 2
- DZBUGLKDJFMEHC-UHFFFAOYSA-N acridine Chemical compound C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 2
- 238000000246 agarose gel electrophoresis Methods 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 108010006523 asialoglycoprotein receptor Proteins 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- 229930189065 blasticidin Natural products 0.000 description 2
- GYKLFBYWXZYSOW-UHFFFAOYSA-N butanoyloxymethyl 2,2-dimethylpropanoate Chemical compound CCCC(=O)OCOC(=O)C(C)(C)C GYKLFBYWXZYSOW-UHFFFAOYSA-N 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 238000002659 cell therapy Methods 0.000 description 2
- 230000003833 cell viability Effects 0.000 description 2
- 238000012054 celltiter-glo Methods 0.000 description 2
- 230000033077 cellular process Effects 0.000 description 2
- 230000007541 cellular toxicity Effects 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 230000009920 chelation Effects 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- BHQCQFFYRZLCQQ-OELDTZBJSA-N cholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 BHQCQFFYRZLCQQ-OELDTZBJSA-N 0.000 description 2
- 235000019416 cholic acid Nutrition 0.000 description 2
- 229960002471 cholic acid Drugs 0.000 description 2
- 210000003161 choroid Anatomy 0.000 description 2
- 239000013611 chromosomal DNA Substances 0.000 description 2
- 238000012411 cloning technique Methods 0.000 description 2
- 238000012761 co-transfection Methods 0.000 description 2
- 239000003636 conditioned culture medium Substances 0.000 description 2
- 238000012350 deep sequencing Methods 0.000 description 2
- KXGVEGMKQFWNSR-UHFFFAOYSA-N deoxycholic acid Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 KXGVEGMKQFWNSR-UHFFFAOYSA-N 0.000 description 2
- DLVJMFOLJOOWFS-INMLLLKOSA-N depudecin Chemical compound C[C@@H](O)[C@@H]1O[C@H]1\C=C\[C@H]1[C@H]([C@H](O)C=C)O1 DLVJMFOLJOOWFS-INMLLLKOSA-N 0.000 description 2
- NIJJYAXOARWZEE-UHFFFAOYSA-N di-n-propyl-acetic acid Natural products CCCC(C(O)=O)CCC NIJJYAXOARWZEE-UHFFFAOYSA-N 0.000 description 2
- AAOVKJBEBIDNHE-UHFFFAOYSA-N diazepam Chemical compound N=1CC(=O)N(C)C2=CC=C(Cl)C=C2C=1C1=CC=CC=C1 AAOVKJBEBIDNHE-UHFFFAOYSA-N 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000011977 dual antiplatelet therapy Methods 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 238000012224 gene deletion Methods 0.000 description 2
- 235000021472 generally recognized as safe Nutrition 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 125000003827 glycol group Chemical group 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 125000001475 halogen functional group Chemical group 0.000 description 2
- 125000005842 heteroatom Chemical group 0.000 description 2
- 125000000623 heterocyclic group Chemical group 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 238000003365 immunocytochemistry Methods 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 230000015788 innate immune response Effects 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 229910021645 metal ion Inorganic materials 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 238000000386 microscopy Methods 0.000 description 2
- 238000009126 molecular therapy Methods 0.000 description 2
- 102000045246 noggin Human genes 0.000 description 2
- 108700007229 noggin Proteins 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 125000003835 nucleoside group Chemical group 0.000 description 2
- 238000011580 nude mouse model Methods 0.000 description 2
- 230000009437 off-target effect Effects 0.000 description 2
- 125000000913 palmityl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- ONTNXMBMXUNDBF-UHFFFAOYSA-N pentatriacontane-17,18,19-triol Chemical compound CCCCCCCCCCCCCCCCC(O)C(O)C(O)CCCCCCCCCCCCCCCC ONTNXMBMXUNDBF-UHFFFAOYSA-N 0.000 description 2
- RDOWQLZANAYVLL-UHFFFAOYSA-N phenanthridine Chemical compound C1=CC=C2C3=CC=CC=C3C=NC2=C1 RDOWQLZANAYVLL-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 150000004713 phosphodiesters Chemical group 0.000 description 2
- 229910052698 phosphorus Inorganic materials 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 150000003230 pyrimidines Chemical class 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 230000008263 repair mechanism Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 230000004258 retinal degeneration Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 229960003452 romidepsin Drugs 0.000 description 2
- 108010091666 romidepsin Proteins 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- VAZAPHZUAVEOMC-UHFFFAOYSA-N tacedinaline Chemical compound C1=CC(NC(=O)C)=CC=C1C(=O)NC1=CC=CC=C1N VAZAPHZUAVEOMC-UHFFFAOYSA-N 0.000 description 2
- XOAAWQZATWQOTB-UHFFFAOYSA-N taurine Chemical compound NCCS(O)(=O)=O XOAAWQZATWQOTB-UHFFFAOYSA-N 0.000 description 2
- 150000003568 thioethers Chemical class 0.000 description 2
- 108091006106 transcriptional activators Proteins 0.000 description 2
- 108091006107 transcriptional repressors Proteins 0.000 description 2
- 230000001052 transient effect Effects 0.000 description 2
- 229930185603 trichostatin Natural products 0.000 description 2
- ZMANZCXQSJIPKH-UHFFFAOYSA-O triethylammonium ion Chemical compound CC[NH+](CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-O 0.000 description 2
- 125000002948 undecyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- MSRILKIQRXUYCT-UHFFFAOYSA-M valproate semisodium Chemical compound [Na+].CCCC(C(O)=O)CCC.CCCC(C([O-])=O)CCC MSRILKIQRXUYCT-UHFFFAOYSA-M 0.000 description 2
- 229960000604 valproic acid Drugs 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- 230000000007 visual effect Effects 0.000 description 2
- 229960000237 vorinostat Drugs 0.000 description 2
- RAVVEEJGALCVIN-AGVBWZICSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-5-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-6-amino-2-[[(2s)-6-amino-2-[[(2s)-2-[[2-[[(2s)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]acetyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]hexanoyl]amino]hexanoyl]amino]-5-(diamino Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCN=C(N)N)NC(=O)CNC(=O)[C@@H](N)CC1=CC=C(O)C=C1 RAVVEEJGALCVIN-AGVBWZICSA-N 0.000 description 1
- JWOGUUIOCYMBPV-GMFLJSBRSA-N (3S,6S,9S,12R)-3-[(2S)-Butan-2-yl]-6-[(1-methoxyindol-3-yl)methyl]-9-(6-oxooctyl)-1,4,7,10-tetrazabicyclo[10.4.0]hexadecane-2,5,8,11-tetrone Chemical compound N1C(=O)[C@H](CCCCCC(=O)CC)NC(=O)[C@H]2CCCCN2C(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H]1CC1=CN(OC)C2=CC=CC=C12 JWOGUUIOCYMBPV-GMFLJSBRSA-N 0.000 description 1
- GNYCTMYOHGBSBI-SVZOTFJBSA-N (3s,6r,9s,12r)-6,9-dimethyl-3-[6-[(2s)-oxiran-2-yl]-6-oxohexyl]-1,4,7,10-tetrazabicyclo[10.3.0]pentadecane-2,5,8,11-tetrone Chemical compound C([C@H]1C(=O)N2CCC[C@@H]2C(=O)N[C@H](C(N[C@H](C)C(=O)N1)=O)C)CCCCC(=O)[C@@H]1CO1 GNYCTMYOHGBSBI-SVZOTFJBSA-N 0.000 description 1
- LLOKIGWPNVSDGJ-AFBVCZJXSA-N (3s,6s,9s,12r)-3,6-dibenzyl-9-[6-[(2s)-oxiran-2-yl]-6-oxohexyl]-1,4,7,10-tetrazabicyclo[10.3.0]pentadecane-2,5,8,11-tetrone Chemical compound C([C@H]1C(=O)N2CCC[C@@H]2C(=O)N[C@H](C(N[C@@H](CC=2C=CC=CC=2)C(=O)N1)=O)CCCCCC(=O)[C@H]1OC1)C1=CC=CC=C1 LLOKIGWPNVSDGJ-AFBVCZJXSA-N 0.000 description 1
- SGYJGGKDGBXCNY-QXUYBEEESA-N (3s,9s,12r)-3-benzyl-6,6-dimethyl-9-[6-[(2s)-oxiran-2-yl]-6-oxohexyl]-1,4,7,10-tetrazabicyclo[10.3.0]pentadecane-2,5,8,11-tetrone Chemical compound C([C@H]1C(=O)NC(C(N[C@@H](CC=2C=CC=CC=2)C(=O)N2CCC[C@@H]2C(=O)N1)=O)(C)C)CCCCC(=O)[C@@H]1CO1 SGYJGGKDGBXCNY-QXUYBEEESA-N 0.000 description 1
- QRPSQQUYPMFERG-LFYBBSHMSA-N (e)-5-[3-(benzenesulfonamido)phenyl]-n-hydroxypent-2-en-4-ynamide Chemical compound ONC(=O)\C=C\C#CC1=CC=CC(NS(=O)(=O)C=2C=CC=CC=2)=C1 QRPSQQUYPMFERG-LFYBBSHMSA-N 0.000 description 1
- FYADHXFMURLYQI-UHFFFAOYSA-N 1,2,4-triazine Chemical class C1=CN=NC=N1 FYADHXFMURLYQI-UHFFFAOYSA-N 0.000 description 1
- KILNVBDSWZSGLL-KXQOOQHDSA-N 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCC KILNVBDSWZSGLL-KXQOOQHDSA-N 0.000 description 1
- UHUHBFMZVCOEOV-UHFFFAOYSA-N 1h-imidazo[4,5-c]pyridin-4-amine Chemical compound NC1=NC=CC2=C1N=CN2 UHUHBFMZVCOEOV-UHFFFAOYSA-N 0.000 description 1
- LDGWQMRUWMSZIU-LQDDAWAPSA-M 2,3-bis[(z)-octadec-9-enoxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)C)OCCCCCCCC\C=C/CCCCCCCC LDGWQMRUWMSZIU-LQDDAWAPSA-M 0.000 description 1
- MUPNITTWEOEDNT-TWMSPMCMSA-N 2,3-bis[[(Z)-octadec-9-enoyl]oxy]propyl-trimethylazanium (3S,8S,9S,10R,13R,14S,17R)-10,13-dimethyl-17-[(2R)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-3-ol Chemical compound CC(C)CCC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CC=C4C[C@@H](O)CC[C@]4(C)[C@H]3CC[C@]12C.CCCCCCCC\C=C/CCCCCCCC(=O)OCC(C[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC MUPNITTWEOEDNT-TWMSPMCMSA-N 0.000 description 1
- KSXTUUUQYQYKCR-LQDDAWAPSA-M 2,3-bis[[(z)-octadec-9-enoyl]oxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCC(=O)OCC(C[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC KSXTUUUQYQYKCR-LQDDAWAPSA-M 0.000 description 1
- WALUVDCNGPQPOD-UHFFFAOYSA-M 2,3-di(tetradecoxy)propyl-(2-hydroxyethyl)-dimethylazanium;bromide Chemical compound [Br-].CCCCCCCCCCCCCCOCC(C[N+](C)(C)CCO)OCCCCCCCCCCCCCC WALUVDCNGPQPOD-UHFFFAOYSA-M 0.000 description 1
- VEPOHXYIFQMVHW-XOZOLZJESA-N 2,3-dihydroxybutanedioic acid (2S,3S)-3,4-dimethyl-2-phenylmorpholine Chemical compound OC(C(O)C(O)=O)C(O)=O.C[C@H]1[C@@H](OCCN1C)c1ccccc1 VEPOHXYIFQMVHW-XOZOLZJESA-N 0.000 description 1
- QSHACTSJHMKXTE-UHFFFAOYSA-N 2-(2-aminopropyl)-7h-purin-6-amine Chemical compound CC(N)CC1=NC(N)=C2NC=NC2=N1 QSHACTSJHMKXTE-UHFFFAOYSA-N 0.000 description 1
- PIINGYXNCHTJTF-UHFFFAOYSA-N 2-(2-azaniumylethylamino)acetate Chemical group NCCNCC(O)=O PIINGYXNCHTJTF-UHFFFAOYSA-N 0.000 description 1
- RNAMYOYQYRYFQY-UHFFFAOYSA-N 2-(4,4-difluoropiperidin-1-yl)-6-methoxy-n-(1-propan-2-ylpiperidin-4-yl)-7-(3-pyrrolidin-1-ylpropoxy)quinazolin-4-amine Chemical compound N1=C(N2CCC(F)(F)CC2)N=C2C=C(OCCCN3CCCC3)C(OC)=CC2=C1NC1CCN(C(C)C)CC1 RNAMYOYQYRYFQY-UHFFFAOYSA-N 0.000 description 1
- YNFSUOFXEVCDTC-UHFFFAOYSA-N 2-n-methyl-7h-purine-2,6-diamine Chemical compound CNC1=NC(N)=C2NC=NC2=N1 YNFSUOFXEVCDTC-UHFFFAOYSA-N 0.000 description 1
- OALHHIHQOFIMEF-UHFFFAOYSA-N 3',6'-dihydroxy-2',4',5',7'-tetraiodo-3h-spiro[2-benzofuran-1,9'-xanthene]-3-one Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC(I)=C(O)C(I)=C1OC1=C(I)C(O)=C(I)C=C21 OALHHIHQOFIMEF-UHFFFAOYSA-N 0.000 description 1
- HXVVOLDXHIMZJZ-UHFFFAOYSA-N 3-[2-[2-[2-[bis[3-(dodecylamino)-3-oxopropyl]amino]ethyl-[3-(dodecylamino)-3-oxopropyl]amino]ethylamino]ethyl-[3-(dodecylamino)-3-oxopropyl]amino]-n-dodecylpropanamide Chemical compound CCCCCCCCCCCCNC(=O)CCN(CCC(=O)NCCCCCCCCCCCC)CCN(CCC(=O)NCCCCCCCCCCCC)CCNCCN(CCC(=O)NCCCCCCCCCCCC)CCC(=O)NCCCCCCCCCCCC HXVVOLDXHIMZJZ-UHFFFAOYSA-N 0.000 description 1
- GBPSCCPAXYTNMB-UHFFFAOYSA-N 4-(1,3-dioxo-2-benzo[de]isoquinolinyl)-N-hydroxybutanamide Chemical compound C1=CC(C(N(CCCC(=O)NO)C2=O)=O)=C3C2=CC=CC3=C1 GBPSCCPAXYTNMB-UHFFFAOYSA-N 0.000 description 1
- GEBBCNXOYOVGQS-BNHYGAARSA-N 4-amino-1-[(2r,3r,4s,5s)-3,4-dihydroxy-5-(hydroxyamino)oxolan-2-yl]pyrimidin-2-one Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](NO)O1 GEBBCNXOYOVGQS-BNHYGAARSA-N 0.000 description 1
- OBKXEAXTFZPCHS-UHFFFAOYSA-N 4-phenylbutyric acid Chemical compound OC(=O)CCCC1=CC=CC=C1 OBKXEAXTFZPCHS-UHFFFAOYSA-N 0.000 description 1
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 1
- LQLQRFGHAALLLE-UHFFFAOYSA-N 5-bromouracil Chemical compound BrC1=CNC(=O)NC1=O LQLQRFGHAALLLE-UHFFFAOYSA-N 0.000 description 1
- JDBGXEHEIRGOBU-UHFFFAOYSA-N 5-hydroxymethyluracil Chemical compound OCC1=CNC(=O)NC1=O JDBGXEHEIRGOBU-UHFFFAOYSA-N 0.000 description 1
- JTDYUFSDZATMKU-UHFFFAOYSA-N 6-(1,3-dioxo-2-benzo[de]isoquinolinyl)-N-hydroxyhexanamide Chemical compound C1=CC(C(N(CCCCCC(=O)NO)C2=O)=O)=C3C2=CC=CC3=C1 JTDYUFSDZATMKU-UHFFFAOYSA-N 0.000 description 1
- KXBCLNRMQPRVTP-UHFFFAOYSA-N 6-amino-1,5-dihydroimidazo[4,5-c]pyridin-4-one Chemical compound O=C1NC(N)=CC2=C1N=CN2 KXBCLNRMQPRVTP-UHFFFAOYSA-N 0.000 description 1
- DCPSTSVLRXOYGS-UHFFFAOYSA-N 6-amino-1h-pyrimidine-2-thione Chemical compound NC1=CC=NC(S)=N1 DCPSTSVLRXOYGS-UHFFFAOYSA-N 0.000 description 1
- QNNARSZPGNJZIX-UHFFFAOYSA-N 6-amino-5-prop-1-ynyl-1h-pyrimidin-2-one Chemical compound CC#CC1=CNC(=O)N=C1N QNNARSZPGNJZIX-UHFFFAOYSA-N 0.000 description 1
- CKOMXBHMKXXTNW-UHFFFAOYSA-N 6-methyladenine Chemical compound CNC1=NC=NC2=C1N=CN2 CKOMXBHMKXXTNW-UHFFFAOYSA-N 0.000 description 1
- HRYKDUPGBWLLHO-UHFFFAOYSA-N 8-azaadenine Chemical compound NC1=NC=NC2=NNN=C12 HRYKDUPGBWLLHO-UHFFFAOYSA-N 0.000 description 1
- 208000035657 Abasia Diseases 0.000 description 1
- 102100036664 Adenosine deaminase Human genes 0.000 description 1
- 241000710929 Alphavirus Species 0.000 description 1
- 208000002267 Anti-neutrophil cytoplasmic antibody-associated vasculitis Diseases 0.000 description 1
- 241001550224 Apha Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000713826 Avian leukosis virus Species 0.000 description 1
- RFLHBLWLFUFFDZ-UHFFFAOYSA-N BML-210 Chemical compound NC1=CC=CC=C1NC(=O)CCCCCCC(=O)NC1=CC=CC=C1 RFLHBLWLFUFFDZ-UHFFFAOYSA-N 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 201000004569 Blindness Diseases 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- QCMYYKRYFNMIEC-UHFFFAOYSA-N COP(O)=O Chemical class COP(O)=O QCMYYKRYFNMIEC-UHFFFAOYSA-N 0.000 description 1
- 101100257372 Caenorhabditis elegans sox-3 gene Proteins 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 238000003734 CellTiter-Glo Luminescent Cell Viability Assay Methods 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- SGYJGGKDGBXCNY-UHFFFAOYSA-N Chlamydocin Natural products N1C(=O)C2CCCN2C(=O)C(CC=2C=CC=CC=2)NC(=O)C(C)(C)NC(=O)C1CCCCCC(=O)C1CO1 SGYJGGKDGBXCNY-UHFFFAOYSA-N 0.000 description 1
- 108091060290 Chromatid Proteins 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 102100026846 Cytidine deaminase Human genes 0.000 description 1
- 108010031325 Cytidine deaminase Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 101700026669 DACH1 Proteins 0.000 description 1
- 238000007400 DNA extraction Methods 0.000 description 1
- 230000008836 DNA modification Effects 0.000 description 1
- 230000004543 DNA replication Effects 0.000 description 1
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 101710096438 DNA-binding protein Proteins 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- XULFJDKZVHTRLG-JDVCJPALSA-N DOSPA trifluoroacetate Chemical compound [O-]C(=O)C(F)(F)F.CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)CCNC(=O)C(CCCNCCCN)NCCCN)OCCCCCCCC\C=C/CCCCCCCC XULFJDKZVHTRLG-JDVCJPALSA-N 0.000 description 1
- 102100028735 Dachshund homolog 1 Human genes 0.000 description 1
- 101100239628 Danio rerio myca gene Proteins 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 108010002156 Depsipeptides Proteins 0.000 description 1
- 102000001477 Deubiquitinating Enzymes Human genes 0.000 description 1
- 108010093668 Deubiquitinating Enzymes Proteins 0.000 description 1
- 108700029231 Developmental Genes Proteins 0.000 description 1
- 102000016680 Dioxygenases Human genes 0.000 description 1
- 108010028143 Dioxygenases Proteins 0.000 description 1
- 101100118093 Drosophila melanogaster eEF1alpha2 gene Proteins 0.000 description 1
- 241000709661 Enterovirus Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 1
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 1
- 108700042658 GAP-43 Proteins 0.000 description 1
- 102100027362 GTP-binding protein REM 2 Human genes 0.000 description 1
- 101000834253 Gallus gallus Actin, cytoplasmic 1 Proteins 0.000 description 1
- 208000003098 Ganglion Cysts Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 102000004064 Geminin Human genes 0.000 description 1
- 108090000577 Geminin Proteins 0.000 description 1
- 229940123611 Genome editing Drugs 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 1
- 102100021185 Guanine nucleotide-binding protein-like 3 Human genes 0.000 description 1
- 108010051041 HC toxin Proteins 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 208000028782 Hereditary disease Diseases 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102000008157 Histone Demethylases Human genes 0.000 description 1
- 108010074870 Histone Demethylases Proteins 0.000 description 1
- 102000003893 Histone acetyltransferases Human genes 0.000 description 1
- 108090000246 Histone acetyltransferases Proteins 0.000 description 1
- 102100030634 Homeobox protein OTX2 Human genes 0.000 description 1
- 102100025448 Homeobox protein SIX6 Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000581787 Homo sapiens GTP-binding protein REM 2 Proteins 0.000 description 1
- 101001040748 Homo sapiens Guanine nucleotide-binding protein-like 3 Proteins 0.000 description 1
- 101000584400 Homo sapiens Homeobox protein OTX2 Proteins 0.000 description 1
- 101000835956 Homo sapiens Homeobox protein SIX6 Proteins 0.000 description 1
- 101001046587 Homo sapiens Krueppel-like factor 1 Proteins 0.000 description 1
- 101001139146 Homo sapiens Krueppel-like factor 2 Proteins 0.000 description 1
- 101001139134 Homo sapiens Krueppel-like factor 4 Proteins 0.000 description 1
- 101001139130 Homo sapiens Krueppel-like factor 5 Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101001109685 Homo sapiens Nuclear receptor subfamily 5 group A member 2 Proteins 0.000 description 1
- 101000652321 Homo sapiens Protein SOX-15 Proteins 0.000 description 1
- 101000843449 Homo sapiens Transcription factor HES-5 Proteins 0.000 description 1
- 101000652332 Homo sapiens Transcription factor SOX-1 Proteins 0.000 description 1
- 101000652326 Homo sapiens Transcription factor SOX-18 Proteins 0.000 description 1
- 101000687911 Homo sapiens Transcription factor SOX-3 Proteins 0.000 description 1
- 206010020460 Human T-cell lymphotropic virus type I infection Diseases 0.000 description 1
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 108700000788 Human immunodeficiency virus 1 tat peptide (47-57) Proteins 0.000 description 1
- 108700003968 Human immunodeficiency virus 1 tat peptide (49-57) Proteins 0.000 description 1
- 241001562081 Ikeda Species 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 1
- JGFBQFKZKSSODQ-UHFFFAOYSA-N Isothiocyanatocyclopropane Chemical compound S=C=NC1CC1 JGFBQFKZKSSODQ-UHFFFAOYSA-N 0.000 description 1
- 101150072501 Klf2 gene Proteins 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- 102100022248 Krueppel-like factor 1 Human genes 0.000 description 1
- 102100020675 Krueppel-like factor 2 Human genes 0.000 description 1
- 102100020677 Krueppel-like factor 4 Human genes 0.000 description 1
- 102100020680 Krueppel-like factor 5 Human genes 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 229940124647 MEK inhibitor Drugs 0.000 description 1
- 101150039798 MYC gene Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000714177 Murine leukemia virus Species 0.000 description 1
- 101100446513 Mus musculus Fgf4 gene Proteins 0.000 description 1
- 101100310645 Mus musculus Sox15 gene Proteins 0.000 description 1
- 101100310650 Mus musculus Sox18 gene Proteins 0.000 description 1
- 101100257376 Mus musculus Sox3 gene Proteins 0.000 description 1
- 101100369076 Mus musculus Tdgf1 gene Proteins 0.000 description 1
- 108091057508 Myc family Proteins 0.000 description 1
- 241000713883 Myeloproliferative sarcoma virus Species 0.000 description 1
- HRNLUBSXIHFDHP-UHFFFAOYSA-N N-(2-aminophenyl)-4-[[[4-(3-pyridinyl)-2-pyrimidinyl]amino]methyl]benzamide Chemical compound NC1=CC=CC=C1NC(=O)C(C=C1)=CC=C1CNC1=NC=CC(C=2C=NC=CC=2)=N1 HRNLUBSXIHFDHP-UHFFFAOYSA-N 0.000 description 1
- BHUZLJOUHMBZQY-YXQOSMAKSA-N N-[4-[(2R,4R,6S)-4-[[(4,5-diphenyl-2-oxazolyl)thio]methyl]-6-[4-(hydroxymethyl)phenyl]-1,3-dioxan-2-yl]phenyl]-N'-hydroxyoctanediamide Chemical compound C1=CC(CO)=CC=C1[C@H]1O[C@@H](C=2C=CC(NC(=O)CCCCCCC(=O)NO)=CC=2)O[C@@H](CSC=2OC(=C(N=2)C=2C=CC=CC=2)C=2C=CC=CC=2)C1 BHUZLJOUHMBZQY-YXQOSMAKSA-N 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 108010070047 Notch Receptors Proteins 0.000 description 1
- 102000005650 Notch Receptors Human genes 0.000 description 1
- 102100022669 Nuclear receptor subfamily 5 group A member 2 Human genes 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- JWOGUUIOCYMBPV-UHFFFAOYSA-N OT-Key 11219 Natural products N1C(=O)C(CCCCCC(=O)CC)NC(=O)C2CCCCN2C(=O)C(C(C)CC)NC(=O)C1CC1=CN(OC)C2=CC=CC=C12 JWOGUUIOCYMBPV-UHFFFAOYSA-N 0.000 description 1
- 102000010175 Opsin Human genes 0.000 description 1
- 108050001704 Opsin Proteins 0.000 description 1
- 101710131038 Opsin-2 Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 241000710778 Pestivirus Species 0.000 description 1
- PCNDJXKNXGMECE-UHFFFAOYSA-N Phenazine Natural products C1=CC=CC2=NC3=CC=CC=C3N=C21 PCNDJXKNXGMECE-UHFFFAOYSA-N 0.000 description 1
- 102100028251 Phosphoglycerate kinase 1 Human genes 0.000 description 1
- 101710139464 Phosphoglycerate kinase 1 Proteins 0.000 description 1
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 description 1
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 description 1
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical class OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 102000015623 Polynucleotide Adenylyltransferase Human genes 0.000 description 1
- 108010024055 Polynucleotide adenylyltransferase Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 102100030244 Protein SOX-15 Human genes 0.000 description 1
- 101150010363 REM2 gene Proteins 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- 102000014450 RNA Polymerase III Human genes 0.000 description 1
- 108010078067 RNA Polymerase III Proteins 0.000 description 1
- 102000044126 RNA-Binding Proteins Human genes 0.000 description 1
- 108700020471 RNA-Binding Proteins Proteins 0.000 description 1
- 206010038910 Retinitis Diseases 0.000 description 1
- 108700038694 Retinitis Pigmentosa 4 Proteins 0.000 description 1
- 102000004389 Ribonucleoproteins Human genes 0.000 description 1
- 108010081734 Ribonucleoproteins Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 101150052594 SLC2A3 gene Proteins 0.000 description 1
- 101000661555 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 60S ribosomal protein L22-A Proteins 0.000 description 1
- 101000661557 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 60S ribosomal protein L22-B Proteins 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- 102000013275 Somatomedins Human genes 0.000 description 1
- 241000713896 Spleen necrosis virus Species 0.000 description 1
- UCKMPCXJQFINFW-UHFFFAOYSA-N Sulphide Chemical compound [S-2] UCKMPCXJQFINFW-UHFFFAOYSA-N 0.000 description 1
- 208000005400 Synovial Cyst Diseases 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 208000035199 Tetraploidy Diseases 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- RTAQQCXQSZGOHL-UHFFFAOYSA-N Titanium Chemical compound [Ti] RTAQQCXQSZGOHL-UHFFFAOYSA-N 0.000 description 1
- 102100030853 Transcription factor HES-5 Human genes 0.000 description 1
- 102100030248 Transcription factor SOX-1 Human genes 0.000 description 1
- 102100030249 Transcription factor SOX-18 Human genes 0.000 description 1
- 102100024276 Transcription factor SOX-3 Human genes 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 102000004357 Transferases Human genes 0.000 description 1
- 108090000992 Transferases Proteins 0.000 description 1
- LLOKIGWPNVSDGJ-UHFFFAOYSA-N Trapoxin B Natural products C1OC1C(=O)CCCCCC(C(NC(CC=1C=CC=CC=1)C(=O)N1)=O)NC(=O)C2CCCN2C(=O)C1CC1=CC=CC=C1 LLOKIGWPNVSDGJ-UHFFFAOYSA-N 0.000 description 1
- SHGAZHPCJJPHSC-NWVFGJFESA-N Tretinoin Chemical compound OC(=O)/C=C(\C)/C=C/C=C(C)C=CC1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-NWVFGJFESA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102000006275 Ubiquitin-Protein Ligases Human genes 0.000 description 1
- 108010083111 Ubiquitin-Protein Ligases Proteins 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 235000018936 Vitellaria paradoxa Nutrition 0.000 description 1
- 108091093126 WHP Posttrascriptional Response Element Proteins 0.000 description 1
- 101100459258 Xenopus laevis myc-a gene Proteins 0.000 description 1
- ISXSJGHXHUZXNF-LXZPIJOJSA-N [(3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-3-yl] n-[2-(dimethylamino)ethyl]carbamate;hydrochloride Chemical compound Cl.C1C=C2C[C@@H](OC(=O)NCCN(C)C)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 ISXSJGHXHUZXNF-LXZPIJOJSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 102000005421 acetyltransferase Human genes 0.000 description 1
- 108020002494 acetyltransferase Proteins 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 210000004504 adult stem cell Anatomy 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 150000001336 alkenes Chemical class 0.000 description 1
- 125000005083 alkoxyalkoxy group Chemical group 0.000 description 1
- 125000002877 alkyl aryl group Chemical group 0.000 description 1
- 125000005600 alkyl phosphonate group Chemical group 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 125000005122 aminoalkylamino group Chemical group 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- PYKYMHQGRFAEBM-UHFFFAOYSA-N anthraquinone Natural products CCC(=O)c1c(O)c2C(=O)C3C(C=CC=C3O)C(=O)c2cc1CC(=O)OC PYKYMHQGRFAEBM-UHFFFAOYSA-N 0.000 description 1
- 150000004056 anthraquinones Chemical class 0.000 description 1
- 230000002924 anti-infective effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 108010082820 apicidin Proteins 0.000 description 1
- 229930186608 apicidin Natural products 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 125000003710 aryl alkyl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 208000025261 autosomal dominant disease Diseases 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229940054066 benzamide antipsychotics Drugs 0.000 description 1
- 150000003936 benzamides Chemical class 0.000 description 1
- ZYGHJZDHTFUPRJ-UHFFFAOYSA-N benzo-alpha-pyrone Natural products C1=CC=C2OC(=O)C=CC2=C1 ZYGHJZDHTFUPRJ-UHFFFAOYSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000001775 bruch membrane Anatomy 0.000 description 1
- PWLNAUNEAKQYLH-UHFFFAOYSA-N butyric acid octyl ester Natural products CCCCCCCCOC(=O)CCC PWLNAUNEAKQYLH-UHFFFAOYSA-N 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 239000002771 cell marker Substances 0.000 description 1
- 210000003986 cell retinal photoreceptor Anatomy 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 108700023145 chlamydocin Proteins 0.000 description 1
- 150000001841 cholesterols Chemical class 0.000 description 1
- 210000004756 chromatid Anatomy 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 229960002424 collagenase Drugs 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 201000008710 congenital stationary night blindness autosomal dominant 1 Diseases 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 229910052802 copper Chemical group 0.000 description 1
- 239000010949 copper Chemical group 0.000 description 1
- 235000001671 coumarin Nutrition 0.000 description 1
- 125000000332 coumarinyl group Chemical class O1C(=O)C(=CC2=CC=CC=C12)* 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000000596 cyclohexenyl group Chemical group C1(=CCCCC1)* 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000000432 density-gradient centrifugation Methods 0.000 description 1
- 210000005258 dental pulp stem cell Anatomy 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- NAGJZTKCGNOGPW-UHFFFAOYSA-N dithiophosphoric acid Chemical class OP(O)(S)=S NAGJZTKCGNOGPW-UHFFFAOYSA-N 0.000 description 1
- 239000003968 dna methyltransferase inhibitor Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 230000002222 downregulating effect Effects 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 210000002308 embryonic cell Anatomy 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 230000001973 epigenetic effect Effects 0.000 description 1
- 210000003617 erythrocyte membrane Anatomy 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 230000002964 excitative effect Effects 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 229940014144 folate Drugs 0.000 description 1
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 230000022244 formylation Effects 0.000 description 1
- 238000006170 formylation reaction Methods 0.000 description 1
- 231100000221 frame shift mutation induction Toxicity 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 230000000799 fusogenic effect Effects 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 230000002518 glial effect Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000005090 green fluorescent protein Substances 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 125000001601 guanosyl group Chemical group 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- GNYCTMYOHGBSBI-UHFFFAOYSA-N helminthsporium carbonum toxin Natural products N1C(=O)C(C)NC(=O)C(C)NC(=O)C2CCCN2C(=O)C1CCCCCC(=O)C1CO1 GNYCTMYOHGBSBI-UHFFFAOYSA-N 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 125000000592 heterocycloalkyl group Chemical group 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 210000002287 horizontal cell Anatomy 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000012744 immunostaining Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 239000000138 intercalating agent Substances 0.000 description 1
- 210000002570 interstitial cell Anatomy 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 210000005229 liver cell Anatomy 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 238000010208 microarray analysis Methods 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 101150087532 mitF gene Proteins 0.000 description 1
- 230000000116 mitigating effect Effects 0.000 description 1
- 230000025608 mitochondrion localization Effects 0.000 description 1
- 239000002829 mitogen activated protein kinase inhibitor Substances 0.000 description 1
- GZCNJTFELNTSAB-UHFFFAOYSA-N n'-(7h-purin-6-yl)hexane-1,6-diamine Chemical compound NCCCCCCNC1=NC=NC2=C1NC=N2 GZCNJTFELNTSAB-UHFFFAOYSA-N 0.000 description 1
- QOSWSNDWUATJBJ-UHFFFAOYSA-N n,n'-diphenyloctanediamide Chemical compound C=1C=CC=CC=1NC(=O)CCCCCCC(=O)NC1=CC=CC=C1 QOSWSNDWUATJBJ-UHFFFAOYSA-N 0.000 description 1
- FMURUEPQXKJIPS-UHFFFAOYSA-N n-(1-benzylpiperidin-4-yl)-6,7-dimethoxy-2-(4-methyl-1,4-diazepan-1-yl)quinazolin-4-amine;trihydrochloride Chemical compound Cl.Cl.Cl.C=12C=C(OC)C(OC)=CC2=NC(N2CCN(C)CCC2)=NC=1NC(CC1)CCN1CC1=CC=CC=C1 FMURUEPQXKJIPS-UHFFFAOYSA-N 0.000 description 1
- 108091008800 n-Myc Proteins 0.000 description 1
- UUIQMZJEGPQKFD-UHFFFAOYSA-N n-butyric acid methyl ester Natural products CCCC(=O)OC UUIQMZJEGPQKFD-UHFFFAOYSA-N 0.000 description 1
- 210000005157 neural retina Anatomy 0.000 description 1
- 210000004498 neuroglial cell Anatomy 0.000 description 1
- 239000002858 neurotransmitter agent Substances 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 210000001328 optic nerve Anatomy 0.000 description 1
- 125000001181 organosilyl group Chemical group [SiH3]* 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 210000004197 pelvis Anatomy 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 229950009215 phenylbutanoic acid Drugs 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008298 phosphoramidates Chemical class 0.000 description 1
- 125000004437 phosphorous atom Chemical group 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000016732 phototransduction Effects 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 230000025540 plastid localization Effects 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920000570 polyether Polymers 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 210000002729 polyribosome Anatomy 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000001902 propagating effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 238000002331 protein detection Methods 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 108010049718 pseudouridine synthases Proteins 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 238000003762 quantitative reverse transcription PCR Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 125000006853 reporter group Chemical group 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000028396 retina morphogenesis in camera-type eye Effects 0.000 description 1
- 210000000964 retinal cone photoreceptor cell Anatomy 0.000 description 1
- 208000002852 retinitis pigmentosa 4 Diseases 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 108020004418 ribosomal RNA Proteins 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 235000021391 short chain fatty acids Nutrition 0.000 description 1
- 150000004666 short chain fatty acids Chemical class 0.000 description 1
- 230000003007 single stranded DNA break Effects 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 210000004927 skin cell Anatomy 0.000 description 1
- 210000001626 skin fibroblast Anatomy 0.000 description 1
- MFBOGIVSZKQAPD-UHFFFAOYSA-M sodium butyrate Chemical compound [Na+].CCCC([O-])=O MFBOGIVSZKQAPD-UHFFFAOYSA-M 0.000 description 1
- FHHPUSMSKHSNKW-SMOYURAASA-M sodium deoxycholate Chemical compound [Na+].C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 FHHPUSMSKHSNKW-SMOYURAASA-M 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229960002232 sodium phenylbutyrate Drugs 0.000 description 1
- VPZRWNZGLKXFOE-UHFFFAOYSA-M sodium phenylbutyrate Chemical compound [Na+].[O-]C(=O)CCCC1=CC=CC=C1 VPZRWNZGLKXFOE-UHFFFAOYSA-M 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 210000001988 somatic stem cell Anatomy 0.000 description 1
- 239000002594 sorbent Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 238000012289 standard assay Methods 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 230000004960 subcellular localization Effects 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- IIACRCGMVDHOTQ-UHFFFAOYSA-N sulfamic acid Chemical group NS(O)(=O)=O IIACRCGMVDHOTQ-UHFFFAOYSA-N 0.000 description 1
- 150000003456 sulfonamides Chemical group 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- 150000003457 sulfones Chemical group 0.000 description 1
- 150000003462 sulfoxides Chemical class 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- VAPNKLKDKUDFHK-UHFFFAOYSA-H suramin sodium Chemical compound [Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[O-]S(=O)(=O)C1=CC(S([O-])(=O)=O)=C2C(NC(=O)C3=CC=C(C(=C3)NC(=O)C=3C=C(NC(=O)NC=4C=C(C=CC=4)C(=O)NC=4C(=CC=C(C=4)C(=O)NC=4C5=C(C=C(C=C5C(=CC=4)S([O-])(=O)=O)S([O-])(=O)=O)S([O-])(=O)=O)C)C=CC=3)C)=CC=C(S([O-])(=O)=O)C2=C1 VAPNKLKDKUDFHK-UHFFFAOYSA-H 0.000 description 1
- 229960000621 suramin sodium Drugs 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 229960003080 taurine Drugs 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 108010060596 trapoxin B Proteins 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 125000000876 trifluoromethoxy group Chemical group FC(F)(F)O* 0.000 description 1
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 239000004034 viscosity adjusting agent Substances 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 150000003722 vitamin derivatives Chemical class 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1138—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
- C12N2320/34—Allele or polymorphism specific uses
Definitions
- RP Retinitis pigmentosa
- RHO Retinitis pigmentosa
- Rhodopsin is an essential photopigment expressed in retinal rod photoreceptor cells that is responsible for the conversion of light stimuli into electrical signals in the first step of phototransduction.
- Rhodopsin is expressed as a light-sensitive G-protein-coupled receptor that consists of an opsin protein moiety bound to a retinal chromophore, and represents the main component of the disk membranes of rod photoreceptor cell outer segments. Misfolded rhodopsin can contribute to rod photoreceptor cell degeneration and death, and can ultimately lead to blindness.
- RP caused by mutations in the RHO gene is typically caused by heterozygous, and rarely by homozygous, mutation in the RHO gene on chromosome 3q22.
- adRP autosomal dominant RP
- compositions and methods useful for altering RHO genes having pathogenic mutations for example, a mutation at P23, R135, or P347) in an allele specific manner.
- the disclosed compositions and methods are useful, for example, for cellular manipulations and subject treatments (e.g., of human subjects), particularly of RP subjects.
- the inventors have surprisingly discovered that allele specific editing of human RHO alleles having pathogenic mutations can be achieved using particular guide RNA (gRNA) molecules targeting the rs7984 SNP located in the 5’ untranslated region (UTR) of the RHO gene.
- gRNA guide RNA
- UTR untranslated region
- SNPs are very common in the human population, and a significant proportion of subjects are heterozygous for the rs7984 SNP.
- allele specific editing of the RHO allele having the pathogenic mutation can be achieved through the use of a gRNA targeting the SNP variant found in the subject’s RHO allele having the pathogenic mutation.
- This allele-specific editing strategy which does not directly target a specific pathogenic RHO gene mutation, advantageously allows editing of RHO genes having a variety of different pathogenic mutations.
- a rs7984 SNP targeting gRNA of the disclosure can be used in combination with a second gRNA targeting a second site in the RHO gene, for example a site in intron 1 , to promote two cuts in the RHO gene having the pathogenic mutation. Cleaving the RHO gene having the pathogenic mutation at two sites can promote a deletion in the RHO gene having the pathogenic mutation, which can result in reduced mutant RHO protein expression.
- the allele specific editing strategies described herein are illustrated in FIG. 1.
- FIG. 1 schematically shows two alleles for a hypothetical subject.
- “Mutated Allele” represents the subject’s first copy of a gene, which has a pathogenic mutation.
- WT Allele represents the subject’s second copy of the gene, which does not have a pathogenic mutation.
- the Mutated Allele and WT Allele are heterozygous with respect to the rs7984 SNP.
- a gRNA designed to target variant A of the SNP can be used to target a Cas9 protein to the Mutated Allele, allowing for allele-specific editing of the RHO allele having the pathogenic mutation.
- a gRNA designed to target variant G of the SNP can be used to target a Cas9 protein to the Mutated Allele.
- a subject can be genotyped to determine the phase between the subject’s rs7984 alleles and the pathogenic RHO mutation, with the results of the genotyping determining which SNP allele to target.
- the inventors have designed rs7984 SNP targeting gRNAs that show unexpectedly high allele specificity, RHO intron 1 targeting gRNAs that show unexpectedly high editing efficiency, and new Cas9 protein variants that are able to cleave RHO genes with unexpectedly high allele specificity when used with rs7984 SNP targeting gRNAs and, optionally, RHO intron 1 targeting gRNAs described herein.
- the disclosure provides guide RNA (gRNA) molecules, for example Cas9 gRNA molecules, targeting the rs7984 SNP in a human RHO gene.
- gRNA guide RNA
- the rs7984 SNP targeting gRNAs can comprise a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of the sequence GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2), CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3), or UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4), or a sequence having one or two mismatches with GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2),
- CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3), or UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4), wherein R is A or G.
- the position of the nucleotide represented by “R” corresponds to the position of the rs7984 SNP.
- a gRNA can be selected to target the rs7984 SNP variant in phase with the pathogenic mutation, thereby allowing editing of the RHO allele having the pathogenic mutation with allele-specificity.
- a gRNA can be selected where R is “A”.
- a gRNA can be selected where R is “G”.
- the disclosure provides gRNA molecules, for example Cas9 gRNA molecules, for targeting intron 1 of a human RHO gene.
- Intron 1 targeting gRNAs can be used, for example, in combination with a rs7984 SNP targeting gRNA of the disclosure and a Cas9 protein to edit (e.g., form a deletion in) a human RHO gene having a pathogenic mutation with allele specificity.
- the disclosure provides Cas9 variant proteins.
- the inventors have discovered that certain Cas9 variants used in combination with gRNAs of the disclosure are particularly effective at preferentially cleaving and/or introducing deletions in a target human RHO gene over a non-target human RHO gene.
- Exemplary features of the gRNAs of the disclosure are described in Section 6.2 and numbered embodiments 1 to 93 and 308 to 401, infra.
- Exemplary features of Cas9 proteins and Cas9 protein variants are described in Section 6.3 and numbered embodiments 418 to 473, infra.
- the disclosure further provides nucleic acids encoding gRNAs of the disclosure, nucleic acids encoding Cas9 proteins, pluralities of nucleic acids and host cells comprising the nucleic acids (including pluralities of nucleic acids) of the disclosure.
- Exemplary features of the nucleic acids and host cells are described in Section 6.4 and numbered embodiments 94 to 133, 402 to 407, and 474 to 478, infra.
- the disclosure further provides systems, particles, and pluralities of particles containing gRNAs, Cas9 proteins, and nucleic acids of the disclosure.
- Exemplary systems, particles, and pluralities of particles are described in Section 6.5 and numbered embodiments 134 to 204, 408 to 417, and 479 to 489, infra.
- the disclosure further provides pharmaceutical compositions comprising the gRNAs, Cas9 proteins, nucleic acids (including pluralities of nucleic acids), particles (including pluralities of particles), and systems the disclosure.
- Exemplary pharmaceutical compositions are described in Section 6.6 and numbered embodiments 205 and 490, infra.
- the disclosure further provides cells (e.g., from a subject having a RHO gene with a pathogenic mutation) and populations of cells comprising the gRNAs, Cas9 proteins, nucleic acids (including pluralities of nucleic acids), particles (including pluralities of particles), and systems of the disclosure.
- exemplary cells and populations of cells are described in Section 6.5 and numbered embodiments 206 to 222 and 491 to 510, infra.
- the disclosure further provides methods of using the gRNAs, Cas9 proteins, nucleic acids (including pluralities of nucleic acids), systems, and particles (including pluralities of particles) of the disclosure for altering cells, for example a human cell having a RHO allele with a pathogenic mutation.
- Methods of the disclosure can be used, for example, to treat subjects having a RP caused by a pathogenic mutation in a RHO allele.
- Exemplary methods of altering cells are described in Section 6.7 and numbered embodiments 223 to 307, infra.
- FIG. 1 Schematic showing mutation-independent, allele-specific targeted inactivation of RHO in adRP using a CRISPR-Cas system.
- the schematic shows two alleles for a hypothetical subject heterozygous for the rs7984 SNP and heterozygous for a pathogenic RHO mutation.
- a gRNA targeting the rs7984 SNP can be used to edit the RHO allele having the pathogenic mutation with allele-specificity.
- the schematic is intended to be merely illustrative and is not to be construed as limiting any invention described herein to a particular mechanism.
- FIGS. 2A-2B Guide RNAs for the allele-specific targeting of the rs7984 SNP.
- FIG. 2A Schematic representation of the RHO rs7984 locus genomic DNA sequence annotated with the position of the guide RNAs for SpCas9 spanning the rs7984 SNP (indicated in bold, major A allele shown). The RHO ATG initiation codon is indicated shaded in gray.
- FIG. 2A discloses SEQ ID NO:232.
- FIG. 2B Schematic representation of the location of candidate guide RNAs targeting the 5’-end of RHO intron 1 (first 600 bp are reported). The arrow at the end of each guide indicates the localization of the downstream PAM on the corresponding strand.
- FIG. 2B discloses SEQ ID NO:233.
- FIGS 3A-3C Evaluation of sgRNAs for allele-specific targeting of the RHO rs7984 SNP. Indel formation at the RHO rs7984A endogenous locus 3 days after transient transfection of HEK293T/17 cells with wt SpCas9 and three different sgRNAs targeting the rs7984A SNP sequence (FIG. 3A) or targeting either the rs7984 A or G allele (absent from the cellular genome and thus acting as a surrogate off-target model) (FIG. 3B), as indicated.
- FIG. 3A Indel formation at the RHO rs7984A endogenous locus 3 days after transient transfection of HEK293T/17 cells with wt SpCas9 and three different sgRNAs targeting the rs7984A SNP sequence
- FIG. 3B three different sgRNAs targeting the rs7984A SNP sequence
- 3C Indel formation at the RHO rs7984A locus 3 days after transient transfection of HEK293T/17 cells with wt SpCas9 or high-fidelity SpCas9 variants together with either the sg7984A-mm14 (on- target) or sg7984G-mm14 (off-target) sgRNAs, as indicated. Data are presented as mean ⁇ SEM for at least 2 biologically independent studies.
- FIGS. 4A-4B Evaluation of alternative sgRNAs to improve allele specificity at the RHO rs7984 locus.
- FIG. 4A Indel formation measured 3 days after transient transfection of HEK293T/17 cells with the high-fidelity K526E SpCas9 mutant together with sg7984A-mm14 (targeting the rs7984A locus) or alternative sgRNAs based on sg7984A-mm14 but containing a synthetic mismatch with the target site along the spacer sequence each, as indicated.
- FIG. 4A Indel formation measured 3 days after transient transfection of HEK293T/17 cells with the high-fidelity K526E SpCas9 mutant together with sg7984A-mm14 (targeting the rs7984A locus) or alternative sgRNAs based on sg7984A-mm14 but containing a synthetic mismatch with the target site along the spacer sequence each, as indicated.
- FIG. 5 Allele-specific gene editing of the rs7984 RHO SNP. Indel formation at the endogenous RHO rs7984A locus measured at 3 days after transient transfection of HEK293T/17 cells with wt SpCas9 or a selected panel of high performing high-fidelity SpCas9 variants together with sg7984A/G-mm14 or sg7984A/G-mm 14+20, as indicated.
- FIGS. 6A-6C Evaluation of the activity and the safety of sgRNAs targeting RHO intron 1.
- FIG. 6A Editing activity of sgRNAs targeting RHO intron 1 in combination with wt SpCas93 days after transient transfection of HEK293-TetP347L cells.
- FIGS. 7A-7C Allele-specific downregulation of RHO P23H by 5’-end gene deletions.
- FIG. 7A Evaluation of deletion formation by endpoint PCR after transient transfection of HEK293-TetP23H cells with the indicated SpCas9 variants and associated sgRNAs. The use of sgRNAs targeting the rs7984A allele allowed to evaluate the allele-specificity of the strategy. Genomic DNA was extracted 3 days post-transfection. Agarose gel from a representative study is shown.
- FIG. 7B Effect of RHO targeting on its mRNA levels.
- FIGS. 8A-8C Allele-specific downregulation of RHO P347L by 5’-end gene deletions.
- FIG. 8A Evaluation of deletion formation by endpoint PCR after transient transfection of HEK293-TetP347L cells with the indicated SpCas9 variants and associated sgRNAs targeting the rs7984G allele and RHO intron 1. Genomic DNA was extracted 3 days post- transfection. Agarose gel from a representative study is shown.
- FIG. 8B Effect of RHO targeting on its mRNA levels.
- FIGS. 9A-9C Evaluation of allele-specific inversions after dual-guide RHO targeting.
- FIG. 9A Schematic representation of the inversion event reporting the primer-design strategy to detect this specific editing outcome. Primers are indicated by black arrows. Letters are used to indicate the polarity of the edited fragment. Inversion events at the RHO targeted locus were detected by endpoint PCR with dedicated primers for the integrated P23H RHO minigene (FIG.
- FIG 9B or the endogenous RHO locus (FIG 9C) 3 days after transient transfection of HEK293- TetP23H cells with wt SpCas9, the DQNV or ESN variants together with guide RNA targeting the RHO locus (rs7984 SNP or intron 1), either alone or in combination, as indicated on the figure.
- a representative agarose gel is show for each set of samples.
- FIG. 10 Validation of GUIDE-seq identified off-targets by amplicon sequencing. Editing levels at 9 off-target sites (OT1 to OT9) detected by GUIDE-seq in association with the ESN and EMN SpCas9 variants and the sg7984A/G-mm 14+20 sgRNAs were evaluated by targeted amplicon sequencing after transient transfection of HEK293T cells. The background level of modification of each target locus was also measured (control). For the EMN variant, data were collected only for OT1, OT5, OT7 and OT8 since no other off-targets were captured by GUIDE- seq for this variant. Data are presented as mean ⁇ SEM for n32 biologically independent studies.
- FIGS. 11A-11B In vitro validation of AAV vectors for allele-specific targeting of the RHO gene.
- FIG. 11 A Schematic representation of the AAV vector genomes used in the in vitro validation studies to express the high-fidelity SpCas9 variants and the relative sgRNAs.
- FIG. 11 A Schematic representation of the AAV vector genomes used in the in vitro validation studies to express the high-fidelity SpCas9 variants and the relative sgRNAs.
- FIG. 12 Evaluation of the cellular toxicity of deleted RHO when expressed in HEK293T cells.
- the disclosure provides guide RNA (gRNA) molecules, which in combination with DNA endonucleases, e.g., Cas9 proteins, can be used, for example, to edit a human RHO gene having a pathogenic mutation, for example in a cell of a subject having a RHO gene with a pathogenic mutation.
- gRNA guide RNA
- a gRNA of the disclosure comprises a spacer corresponding to a target domain in the genomic DNA sequence of a RHO gene that includes the nucleotide position corresponding to the rs7984 SNP.
- a gRNA of the disclosure comprises a spacer corresponding to a target domain in intron 1 of a RHO gene.
- the target domains of gRNAs of the disclosure are adjacent to or near a protospacer-adjacent motif (PAM) of a Cas9 protein.
- PAM protospacer-adjacent motif
- Exemplary features of gRNAs of the disclosure are described in Section 6.2.
- the disclosure further provides Cas9 variant proteins. Exemplary Cas9 proteins of the disclosure, which can in some embodiments be used in conjunction with gRNAs of the disclosure, are described in Section 6.3.
- the disclosure further provides nucleic acids encoding gRNAs of the disclosure, nucleic acids encoding Cas9 proteins, pluralities of nucleic acids and host cells containing the nucleic acids.
- nucleic acids encoding gRNAs and Cas9 proteins and exemplary host cells are described in Section 6.4.
- the disclosure further provides systems, particles, and cells containing gRNAs and nucleic acids of the disclosure.
- Exemplary systems, particles, and cells are described in Section 6.5.
- the disclosure further provides pharmaceutical compositions comprising the gRNAs, nucleic acids, particles, and systems the disclosure.
- Exemplary pharmaceutical compositions are described in Section 6.6.
- the disclosure further provides methods of using the gRNAs, nucleic acids, systems, particles, and pharmaceutical compositions of the disclosure for altering cells.
- Methods of the disclosure can be useful, for example, for treating a subject having RP caused a pathogenic mutation in the subject’s RHO gene. Exemplary methods of altering cells are described in Section 6.7.
- a Cas9 protein refers to a wild-type or engineered Cas9 protein.
- Engineered Cas9 proteins can also be referred to as Cas9 variants.
- any disclosure pertaining to a “Cas9” or “Cas9 protein” pertains to wild-type Cas9 proteins and Cas9 variants, unless the context dictates otherwise.
- Identical or percent identity in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI web site or the like).
- This definition also refers to, or may be applied to, the complement of a test sequence.
- the definition also includes sequences that have deletions and/or additions, as well as those that have substitutions. As described below, the preferred algorithms can account for gaps and the like.
- identity exists over a region that is at least about 10 amino acids or 15 nucleotides in length, or more preferably over a region that is 10-50 amino acids or 20-50 nucleotides in length.
- percent (%) amino acid sequence identity is defined as the percentage of amino acids in a candidate sequence that are identical to the amino acids in a reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN- 2 or Megalign (DNASTAR) software. Appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared can be determined by known methods.
- sequence comparisons typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence algorithm program parameters Preferably, default program parameters can be used, or alternative parameters can be designated.
- sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
- HSPs high scoring sequence pairs
- T is referred to as the neighborhood word score threshold (Altschul et ai, (1990) J. Mol. Biol. 215:403-410). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score.
- Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul, 1993, Proc. Natl. Acad. Sci. USA 90:5873-5787).
- BLAST algorithm One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01.
- Pathogenic mutation in the context of this disclosure, refers to an alteration of a wild- type human RHO gene that is associated with a disease, for example retinitis pigmentosa.
- exemplary pathogenic mutations include mutations at the codons encoding P23, R135, and P347 of rhodopsin protein.
- a P23 mutation can be, for example, a P23H mutation.
- a R135 mutation can be, for example, a R135G mutation.
- a R135 mutation can be a R135W mutation.
- a R135 mutation can be a R135L mutation.
- a P347 mutation can be, for example, a P347L mutation.
- a P347 mutation can be a P347S mutation.
- a P347 mutation can be a P347R mutation.
- a P347 mutation can be a P347Q mutation.
- a P347 mutation can be a P347T mutation.
- a P347 mutation can be a P347A mutation.
- Peptide, protein, and polypeptide are used interchangeably to refer to a natural or synthetic molecule comprising two or more amino acids linked by the carboxyl group of one amino acid to the alpha amino group of another.
- the amino acids may be natural or synthetic, and can contain chemical modifications such as disulfide bridges, substitution of radioisotopes, phosphorylation, substrate chelation (e.g., chelation of iron or copper atoms), glycosylation, acetylation, formylation, amidation, biotinylation, and a wide range of other modifications.
- a polypeptide may be attached to other molecules, for instance molecules required for function. Examples of molecules which may be attached to a polypeptide include, without limitation, cofactors, polynucleotides, lipids, metal ions, phosphate, etc.
- Non-limiting examples of polypeptides include peptide fragments, denatured/unstructured polypeptides, polypeptides having quaternary or aggregated structures, etc. There is expressly no requirement that a polypeptide must contain an intended function; a polypeptide can be functional, non-functional, function for unexpected/unintended purposes, or have unknown function.
- a polypeptide is comprised of approximately twenty, standard naturally occurring amino acids, although natural and synthetic amino acids which are not members of the standard twenty amino acids may also be used.
- the standard twenty amino acids include alanine (Ala, A), arginine (Arg, R), asparagine (Asn, N), aspartic acid (Asp, D), cysteine (Cys, C), glutamine (Gin, Q), glutamic acid (Glu, E), glycine (Gly, G), histidine, (His, H), isoleucine (lie, I), leucine (Leu, L), lysine (Lys, K), methionine (Met, M), phenylalanine (Phe, F), proline (Pro, P), serine (Ser, S), threonine (Thr,
- polypeptide sequence or “amino acid sequence” are an alphabetical representation of a polypeptide molecule.
- Polynucleotide and oligonucleotide are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three-dimensional structure, and may perform any function, known or unknown.
- polynucleotides a gene or gene fragment, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, primers and gRNAs.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- a polynucleotide is composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); thymine (T); and uracil (U) for thymine (T) when the polynucleotide is RNA.
- A adenine
- C cytosine
- G guanine
- T thymine
- U uracil
- T thymine
- nucleotide sequence is the alphabetical representation of a polynucleotide molecule.
- Rhodopsin refers to either Rhodopsin polypeptide, also known as opsin 2, OPN2, retinitis pigmentosa 4, CSNBAD1, and RP4, or a polynucleotide encoding Rhodopsin polypeptide.
- rhodopsin polypeptide is encoded by the RHO gene.
- the Rhodopsin is a polypeptide or polynucleotide identified in one or more publicly available databases as follows: HGNC: 10012 Entrez Gene: 6010 Ensembl: ENSG00000163914 OMIM: 180380 UniProtKB: P08100. Table 1 shows exemplary rhodopsin sequences.
- rs7984 SNP refers to a single nucleotide polymorphism in the 5’ UTR of the human RHO gene assigned the identifier “rs7984” in the dsSNP database (ncbi.nlm.nih.gov/snp/).
- the nucleotide in the RHO nucleotide sequence shown in Table 1 corresponding to the rs7984 SNP is shown in bold underlined text.
- the dsSNP database identifies two alleles for the rs7984 SNP: “A”, which is identified in the database as the reference allele, and “G”, which is identified in the database as the alternative allele.
- a given allele of the rs7984 SNP is said to be “in phase” with a pathogenic RHO mutation when the allele of the rs7984 SNP and pathogenic mutation are located on the same copy of the RHO gene.
- Spacer refers to a region of a gRNA molecule which is partially or fully complementary to a target sequence found in the + or - strand of a RHO genomic DNA.
- a DNA endonuclease such as a Cas9 protein
- the gRNA directs the DNA endonuclease to the target sequence in the genomic DNA.
- a spacer of a Cas9 gRNA is typically 15 to 30 nucleotides in length (e.g., 20-25 nucleotides).
- the nucleotide sequence of a spacer can be, but is not necessarily, fully complementary to the target sequence.
- a spacer can contain one or more mismatches with a target sequence, e.g., the spacer can comprise one, two, or three mismatches with the target sequence.
- the terms treat, treating, treatment, and grammatical variations thereof as used herein, include partially or completely delaying, curing, healing, alleviating, relieving, altering, remedying, ameliorating, improving, stabilizing, mitigating, and/or reducing the intensity or frequency of one or more diseases or conditions, symptoms of a disease or condition, or underlying causes of a disease or condition.
- Treatments according to the disclosure may be applied prophylactically, palliatively or remedially.
- Prophylactic treatments can be administered to a subject prior to onset, during early onset (e.g., upon initial signs and symptoms of RP), or after an established development of RP. Prophylactic administration can occur for several days to years prior to the manifestation of symptoms.
- the terms treat, treating, treatment and grammatical variations thereof include reducing expression of a mutant rhodopsin ( RHO ) gene.
- the terms treat, treating, treatment and grammatical variations thereof can also include reducing RHO protein misfolding and/or mislocalization in retinal cells, e.g., epithelial cells.
- the terms treat, treating, treatment and grammatical variations thereof can also include decreasing retinal epithelial cell death and/or retinal degeneration.
- the terms treat, treating, treatment and grammatical variations thereof can also include increasing a ratio of expression of a wild-type rhodopsin allele to a rhodopsin mutant allele. Measurements of treatment can be compared with prior treatment(s) of the subject, inclusive of no treatment, or compared with the incidence of such symptom(s) in a general or study population.
- Wild-type in reference to a genomic DNA sequence or protein sequence, refers to a genomic DNA sequence or protein sequence, respectively, that predominates in a species, e.g., homo sapiens.
- the disclosure provides gRNA molecules that can be used with CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) endonucleases to edit a human RHO gene.
- CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
- gRNAs of the disclosure are typically Cas9 gRNAs and comprise a spacer of 15 to 30 nucleotides in length in length.
- gRNAs of the disclosure are in some embodiments single guide RNAs (sgRNAs), which typically comprise the spacer at the 5’ end of the molecule and a 3’ sgRNA segment. Further features of exemplary gRNA spacer sequences are described in Section 6.2.1 and further features of exemplary 3’ sgRNA segments are described in Section 6.2.2. 6.2.1. Spacers
- the spacer sequence of a gRNA of the disclosure is partially or fully complementary to a target sequence found in a human RHO gene.
- a 20 nucleotide spacer sequence can be partially or fully complementary to a 20 nucleotide sequence in the RHO gene.
- a spacer that is partially complementary to a target sequence can have, for example, one, two, or three mismatches with the target sequence.
- DNA endonucleases such as Cas9 require a specific sequence, called a protospacer adjacent motif (PAM) that is downstream (e.g., directly downstream) of the target sequence on the non-target strand.
- PAM protospacer adjacent motif
- Wild-type S. pyogenes Cas9 recognizes a PAM sequence of NGG that is found downstream of the target sequence in the genomic DNA on the non-target strand, wherein “N” refers to any nucleotide.
- the spacer sequences of the gRNAs of the disclosure are complementary to a target sequence that is adjacent to a PAM, for example NGG on the non-target strand.
- gRNAs of the disclosure can comprise a spacer that is 15 to 30 nucleotides in length (e.g., 15 to 25, 16 to 24, 17 to 23, 18 to 22, 19 to 21, 18 to 30, 20 to 28, 22 to 26, or 23 to 25 nucleotides in length).
- a spacer is 15 nucleotides in length.
- a spacer is 16 nucleotides in length.
- a spacer is 17 nucleotides in length.
- a spacer is 18 nucleotides in length.
- a spacer is 19 nucleotides in length.
- a spacer is 20 nucleotides in length.
- a spacer is 21 nucleotides in length. In other embodiments, a spacer is 22 nucleotides in length. In other embodiments, a spacer is 23 nucleotides in length. In other embodiments, a spacer is 24 nucleotides in length. In other embodiments, a spacer is 25 nucleotides in length. In other embodiments, a spacer is 26 nucleotides in length. In other embodiments, a spacer is 27 nucleotides in length. In other embodiments, a spacer is 28 nucleotides in length. In other embodiments, a spacer is 29 nucleotides in length. In other embodiments, a spacer is 30 nucleotides in length.
- the disclosure provides gRNAs that can be used to target the rs7984 SNP in a human RHO gene.
- This SNP is located in the 5’ untranslated region (UTR) of the RHO gene.
- the dsSNP database identifies two alleles for this SNP, “A” (identified in the database as the reference allele) and “G” (identified in the database as the alternative allele). Heterozygotes for the rs7984 SNP represent approximately 25% of the European and US population of Caucasian ancestry.
- guide RNAs targeting the rs7984 SNP can comprise a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2), where R is A or G (e.g., 15, 16, 17, 18, 19, or 20 consecutive nucleotides of the sequence). Nucleotide “R” corresponds to the rs7984 SNP.
- a gRNA targeting the rs7984 SNP can comprise a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of sequence having one or two mismatches with the sequence GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2), where R is A or G (e.g., 15, 16, 17, 18, 19, or 20 consecutive nucleotides of the sequence).
- the spacer comprises GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2).
- the spacer comprises a sequence having one mismatch with GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2), for example, a mismatch at position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 15, 16, 17, 18, 19, or 20 of GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2), where position 1 is the 3’ nucleotide of GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2).
- the mismatch is not at position 14 (corresponding to R), so that the allele specificity of the gRNA is maintained.
- An exemplary spacer sequence having one mismatch is ACAGCCRCGGGUCAGCCACA (SEQ ID NO:7).
- a mismatch can help to promote allele- specificity, as a gRNA having one mismatch with the target allele will have two mismatches with the off-target allele (the second mismatch being the nucleotide at the “R” position).
- R is A
- the gRNA can be used to target the A allele of the rs7984 SNP
- R is G
- the gRNA can be used to target the G allele of the rs7984 SNP.
- Exemplary spacer sequences for targeting the rs7984 SNP are shown in Table 2A.
- Lowercase nucleotides in Table 2A indicate a mismatch with the wild-type genomic RHO sequence.
- the position of the rs7984 SNP is shown in bold.
- mm14A and mm14A+20 can be used to target allele A of the rs7984 SNP
- mm14G and mm14G+20 can be used to target allele G of the rs7984 SNP.
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides from a sequence shown in Table 2A. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 16 or more consecutive nucleotides from a sequence shown in Table 2A. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 21 consecutive nucleotides from a sequence shown in Table 2A.
- the disclosure provides a gRNA whose spacer sequence comprises or consists of a spacer sequence shown in Table 5.
- the disclosure provides gRNAs to target intron 1 of the RHO gene.
- gRNAs can be used, for example, in combination with a rs7984 SNP targeting gRNA.
- Combinations of intron 1 targeting gRNAs and rs7984 SNP targeting gRNAs can be used, for example, to cause double cleavage of a human RHO gene (e.g., as shown schematically in FIG. 1).
- Exemplary spacer sequences are shown in Table 2B.
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides from a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 16 or more consecutive nucleotides from a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides from a sequence having one mismatch with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 16 or more consecutive nucleotides from a sequence having one mismatch with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 17 or more consecutive nucleotides from a sequence having one mismatch with a sequence shown in Table 2B.
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 18 or more consecutive nucleotides from a sequence having one mismatch with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 19 or more consecutive nucleotides from a sequence having one mismatch with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 20 consecutive nucleotides from a sequence having one mismatch with a sequence shown in Table 2B.
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 16 or more consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 17 or more consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B.
- a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 18 or more consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 19 or more consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 20 consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B.
- an intron 1 targeting gRNA of the disclosure comprises the 189fw spacer.
- an intron 1 targeting gRNA of the disclosure comprises the 189fw spacer.
- an intron 1 targeting gRNA of the disclosure comprises the 88fw spacer.
- an intron 1 targeting gRNA of the disclosure comprises the 109rev spacer.
- an intron 1 targeting gRNA of the disclosure comprises the 170rev spacer.
- an intron 1 targeting gRNA of the disclosure comprises the 352rev spacer. 6.2.2. sgRNA Molecules
- Guide RNAs of the disclosure can be single-guide RNA (sgRNA) molecules.
- a sgRNA in a Type II CRISPR system can comprise, in the 5' to 3' direction, an optional spacer extension sequence, a spacer sequence, a minimum CRISPR repeat sequence, a single-molecule guide linker, a minimum tracrRNA sequence, a 3’ tracrRNA sequence and an optional tracrRNA extension sequence.
- the optional tracrRNA extension can comprise elements that contribute additional functionality (e.g., stability) to the guide RNA.
- the single-molecule guide linker can link the minimum CRISPR repeat and the minimum tracrRNA sequence to form a hairpin structure.
- the optional tracrRNA extension can comprise one or more hairpins.
- the sgRNA can comprise a variable length spacer sequence (e.g., 15 to 30 nucleotides) at the 5’ end of the sgRNA sequence and a 3’ sgRNA segment.
- Various 3’ sgRNA segments are known in the art.
- Exemplary 3’ sgRNA sequences for SpCas9 sgRNAs are shown in Table 3.
- the sgRNA can comprise no uracil base at the 3’ end of the sgRNA sequence.
- the sgRNA can comprise one or more uracil bases at the 3’ end of the sgRNA sequence.
- the sgRNA can comprise 1 uracil (U) at the 3’ end of the sgRNA sequence.
- the sgRNA can comprise 2 uracil (UU) at the 3’ end of the sgRNA sequence.
- the sgRNA can comprise 3 uracil (UU) at the 3’ end of the sgRNA sequence.
- the sgRNA can comprise 4 uracil (UUUU) at the 3’ end of the sgRNA sequence.
- the sgRNA can comprise 5 uracil (UUUUU) at the 3’ end of the sgRNA sequence.
- the sgRNA can comprise 6 uracil (UUUUUU) at the 3’ end of the sgRNA sequence.
- the sgRNA can comprise 7 uracil (UUUUUUU) at the 3’ end of the sgRNA sequence.
- the sgRNA can comprise 8 uracil (UUUUUUUU) at the 3’ end of the sgRNA sequence.
- Different length stretches of uracil can be appended at the 3’end of a sgRNA as terminators.
- the 3’ sgRNA sequences set forth in Table 3 can be modified by adding or removing one or more uracils at the end of the sequence.
- Guide RNAs can be readily synthesized by chemical means, enabling a number of modifications to be readily incorporated, as described in the art.
- the disclosed gRNA (e.g., sgRNA) molecules can be unmodified or can contain any one or more of an array of chemical modifications.
- RNAs While chemical synthetic procedures are continually expanding, purifications of such RNAs by procedures such as high-performance liquid chromatography (HPLC, which avoids the use of gels such as PAGE) tends to become more challenging as polynucleotide lengths increase significantly beyond a hundred or so nucleotides.
- HPLC high-performance liquid chromatography
- One approach that can be used for generating chemically modified RNAs of greater length is to produce two or more molecules that are ligated together. Much longer RNAs, such as those encoding a Cas9 endonuclease, are more readily generated enzymatically.
- RNAs While fewer types of modifications are available for use in enzymatically produced RNAs, there are still modifications that can be used to, for instance, enhance stability, reduce the likelihood or degree of innate immune response, and/or enhance other attributes, as described herein and in the art.
- modifications can comprise one or more nucleotides modified at the 2' position of the sugar, for instance a 2'-0-alkyl, 2'-0-alkyl-0-alkyl, or 2'-fluoro- modified nucleotide.
- RNA modifications can comprise 2'-fluoro, 2'-amino or 2'-0-methyl modifications on the ribose of pyrimidines, abasic residues, or an inverted base at the 3' end of the RNA.
- modified oligonucleotides include those comprising modified backbones, for example, phosphorothioates, phosphotriesters, methyl phosphonates, short chain alkyl or cycloalkyl intersugar linkages or short chain heteroatomic or heterocyclic intersugar linkages.
- oligonucleotides are oligonucleotides with phosphorothioate backbones and those with heteroatom backbones, particularly CH2-NH-O-CH2, CH, ⁇ N(CH 3 )-0- CH2 (known as a methylene(methylimino) or MMI backbone), CH2-O-N (Chy-Chh, CH2 -N (CH3)-N (CH 3 )-CH 2 and O-N (CH3)- CH2 -CH2 backbones, wherein the native phosphodiester backbone is represented as O- P- O- CH,); amide backbones (see De Mesmaeker et al. 1995, Ace. Chem.
- morpholino backbone structures see U.S. Patent No. 5,034,506
- PNA peptide nucleic acid
- Phosphorus-containing linkages include, but are not limited to, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates comprising 3'alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates comprising 3'-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates having normal 3'-5' linkages, 2'-5' linked analogs of these, and those having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3'-5' to 5'-3' or 2'-5' to 5'-2'; see U.S. Patent Nos.
- Morpholino-based oligomeric compounds are described in Braasch and David Corey, 2002, Biochemistry, 41(14):4503-4510; Genesis, Volume 30, Issue 3, (2001); Heasman, 2002, Dev. Biol., 243: 209-214; Nasevicius etal., 2000, Nat. Genet., 26:216-220; Lacerra etal., 2000, Proc. Natl. Acad. Sci. , 97: 9591-9596; and U.S. Patent No. 5,034,506.
- Modified oligonucleotide backbones that do not include a phosphorus atom therein have backbones that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatom and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic intemucleoside linkages.
- These comprise those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones; formacetyl and thioformacetyl backbones; methylene formacetyl and thioformacetyl backbones; alkene containing backbones; sulfamate backbones; methyleneimino and methylenehydrazino backbones; sulfonate and sulfonamide backbones; amide backbones; and others having mixed N, O, S, and CH2 component parts; see U.S.
- One or more substituted sugar moieties can also be included, e.g., one of the following at the 2' position: OH, SH, SCH 3 , F, OCN, OCH 3 , OCH 3 0(CH 2 )n CH 3 , 0(CH 2 )n NH 2 , or 0(CH 2 )n CH3, where n is from 1 to about 10; Ci to C10 lower alkyl, alkoxyalkoxy, substituted lower alkyl, alkaryl or aralkyl; Cl; Br; CN; CF 3 ; OCF3; O-, S-, or bi- alkyl; O-, S-, or N-alkenyl; SOCH3; S0 2 CH3; ON0 2 ; N0 2 ; N 3 ; NH 2 ; heterocycloalkyl; heterocycloalkaryl; aminoalkylamino; polyalkylamino; substituted silyl; an RNA cleaving group; a reporter group
- a modification includes 2'-methoxyethoxy (2'-0- CH 2 CH 2 OCH3, also known as 2'-0-(2-methoxyethyl)) (Martin et al., 1995, Helv. Chim. Acta, 78, 486).
- Other modifications include 2'-methoxy (2'-0-CH 3 ), 2'-propoxy (2'- OCH 2 CH 2 CH3) and 2'- fluoro (2'-F).
- Similar modifications can also be made at other positions on the oligonucleotide, particularly the 3' position of the sugar on the 3' terminal nucleotide and the 5' position of 5' terminal nucleotide.
- Oligonucleotides can also have sugar mimetics, such as cyclobutyls in place of the pentofuranosyl group.
- both a sugar and an intemucleoside linkage (in the backbone) of the nucleotide units can be replaced with novel groups.
- the base units can be maintained for hybridization with an appropriate nucleic acid target compound.
- an oligomeric compound an oligonucleotide mimetic that has been shown to have excellent hybridization properties, is referred to as a peptide nucleic acid (PNA).
- PNA peptide nucleic acid
- the sugar- backbone of an oligonucleotide can be replaced with an amide containing backbone, for example, an aminoethylglycine backbone.
- the nucleobases can be retained and bound directly or indirectly to aza nitrogen atoms of the amide portion of the backbone.
- Representative U.S. patents that teach the preparation of PNA compounds include, but are not limited to, U.S.
- RNAs such as guide RNAs can also include, additionally or alternatively, nucleobase (often referred to in the art simply as “base”) modifications or substitutions.
- nucleobases include adenine (A), guanine (G), thymine (T), cytosine (C), and uracil (U).
- Modified nucleobases include nucleobases found only infrequently or transiently in natural nucleic acids, e.g., hypoxanthine, 6-methyladenine, 5-Me pyrimidines, particularly 5- methylcytosine (also referred to as 5-methyl-2' deoxy cytosine and often referred to in the art as 5-Me-C), 5-hydroxymethylcytosine (HMC), glycosyl HMC and gentobiosyl HMC, as well as synthetic nucleobases, e.g., 2-aminoadenine, 2-(methylamino) adenine, 2- (imidazolylalkyl)adenine, 2-(aminoalklyamino) adenine or other heterosub stituted alkyladenines, 2-thiouracil, 2-thiothymine, 5-bromouracil, 5-hydroxymethyluracil, 8-azaguanine, 7- deazaguanine, N6 (6-aminohexy
- Modified nucleobases can comprise other synthetic and natural nucleobases, such as 5- methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudo-uracil), 4-thiouracil, 8-halo, 8-amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8- substituted adenines and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and other nucleo
- nucleobases can comprise those disclosed in U.S. Patent No. 3,687,808, those disclosed in 'The Concise Encyclopedia of Polymer Science and Engineering', 858-859, Kroschwitz, J.I., ed. John Wiley & Sons, 1990, those disclosed by Englisch et al., Angewandle Chemie, International Edition', 1991, 30, p. 613, and those disclosed by Sanghvi, Y. S., Chapter 15, Antisense Research and Applications', 289-302, Crooke, S.T. and Lebleu, B. ea., CRC Press, 1993. Certain of these nucleobases can be useful for increasing the binding affinity of the oligomeric compounds of the invention.
- 5-substituted pyrimidines 6- azapyrimidines and N-2, N-6 and 0-6 substituted purines, comprising 2-aminopropyladenine, 5- propynyluracil and 5-propynylcytosine.
- 5-methylcytosine substitutions have been shown to increase nucleic acid duplex stability by about 0.6-1.2°C (Sanghvi, Y.S., Crooke, S.T. and Lebleu, B., eds, 'Antisense Research and Applications', CRC Press, Boca Raton, 1993, 276- 278) and are aspects of base substitutions, even more particularly when combined with 2'-0- methoxyethyl sugar modifications.
- Modified nucleobases are described in U.S. Patent No. 3,687,808, as well as 4,845,205; 5,130,302; 5,134,066; 5,175,273; 5,367,066; 5,432,272; 5,457,187; 5,459,255; 5,484,908; 5,502,177; 5,525,711; 5,552,540; 5,587,469; 5,596,091; 5,614,617; 5,681,941; 5,750,692; 5,763,588; 5,830,653; 6,005,096; and U.S. Patent Application Publication 2003/0158403.
- a modified gRNA can include, for example, one or more non-natural sugars, internucleotide linkages and/or bases. It is not necessary for all positions in a given gRNA to be uniformly modified, and in fact more than one of the aforementioned modifications can be incorporated in a single oligonucleotide, or even in a single nucleoside within an oligonucleotide.
- the guide RNAs and/or mRNA (or DNA) encoding an endonuclease can be chemically linked to one or more moieties or conjugates that enhance the activity, cellular distribution, or cellular uptake of the oligonucleotide.
- moieties comprise, but are not limited to, lipid moieties such as a cholesterol moiety (Letsinger et al. 1989, Proc. Natl. Acad. Sci. USA, 86:
- a phospholipid e.g., di-hexadecyl-rac-glycerol or triethylammonium 1,2-di-O- hexadecyl-rac-glycero-3-H-phosphonate (Manoharan et al., 1995, Tetrahedron Lett., 36: 3651-
- Sugars and other moieties can be used to target proteins and complexes comprising nucleotides, such as cationic polysomes and liposomes, to particular sites.
- nucleotides such as cationic polysomes and liposomes
- hepatic cell directed transfer can be mediated via asialoglycoprotein receptors (ASGPRs); see, e.g., Hu, et a!., 2014, Protein Pept Lett. 21(10):1025-30.
- ASGPRs asialoglycoprotein receptors
- Other systems known in the art and regularly developed can be used to target biomolecules of use in the present case and/or complexes thereof to particular target cells of interest.
- Targeting moieties or conjugates can include conjugate groups covalently bound to functional groups, such as primary or secondary hydroxyl groups.
- Conjugate groups of the present disclosure include intercalators, reporter molecules, polyamines, polyamides, polyethylene glycols, polyethers, groups that enhance the pharmacodynamic properties of oligomers, and groups that enhance the pharmacokinetic properties of oligomers.
- Typical conjugate groups include cholesterols, lipids, phospholipids, biotin, phenazine, folate, phenanthridine, anthraquinone, acridine, fluoresceins, rhodamines, coumarins, and dyes.
- Groups that enhance the pharmacodynamic properties include groups that improve uptake, enhance resistance to degradation, and/or strengthen sequence-specific hybridization with the target nucleic acid.
- Groups that enhance the pharmacokinetic properties include groups that improve uptake, distribution, metabolism or excretion of the compounds of the present disclosure.
- Conjugate moieties include, but are not limited to, lipid moieties such as a cholesterol moiety, cholic acid, a thioether, e.g., hexyl-5 -trityl thiol, a thiocholesterol, an aliphatic chain, e.g., dodecandiol or undecyl residues, a phospholipid, e.g., di-hexadecyl-rac- glycerol or triethylammonium 1,2-di-O-hexadecyl-rac- glycero-3-H-phosphonate, a polyamine or a polyethylene glycol chain, or adamantane acetic acid, a palmityl moiety, or an octadecylamine or hexylamino-carbonyl-oxy cholesterol moiety.
- lipid moieties such as a cholesterol moiety, cholic acid, a thi
- the disclosure provides novel modified Cas9 proteins (also referred to as Cas9 variants). Novel Cas9 proteins of the disclosure are described in Section 6.3.1.
- the novel Cas9 proteins of the disclosure can be used in combination with a gRNA to direct the Cas9 protein to a target DNA sequence.
- a novel Cas9 protein of the disclosure can be used in combination with one or more gRNAs (e.g., a rs7984 SNP targeting gRNA and/or a RHO intron 1 targeting gRNA) of the disclosure to direct the Cas9 protein to a RHO gene, and in particular RHO genes having pathogenic mutations.
- gRNAs e.g., a rs7984 SNP targeting gRNA and/or a RHO intron 1 targeting gRNA
- the gRNAs of the disclosure can be also be used in combination with DNA endonucleases beyond those described in Section 6.3.1 (e.g., wild-type Cas9 proteins and modified Cas9 proteins known in the art) to direct the DNA endonuclease to a RHO gene. Exemplary features of additional DNA nucleases are described in Section 6.3.2.
- the disclosure provides particular Cas9 variant proteins for use with particular gRNAs (and vice versa), for example in the combinations described in the Examples in Section 7.
- a DNA endonuclease e.g., as described in Section 6.3.1 or Section 6.3.2, can be provided to a cell or a subject as one or more polypeptides, or one or more nucleic acids (e.g., mRNAs) encoding the one or more polypeptides.
- Modified Cas9 proteins of the disclosure can comprise one or more mutations relative to a corresponding wild-type Cas9 protein.
- the position of the mutations described herein are identified by reference to the amino acid numbering in an unmodified mature Streptococcus pyogenes Cas9 (SpCas9) (NP_269215 (NCBI)) as set forth in SEQ ID NO: 1 :
- a SpCas9 protein having the amino acid sequence of SEQ ID NO:1 is sometimes referred to herein as wild-type (wt) SpCas9.
- the modified Cas9 proteins of the disclosure can have a single mutation alone, or can comprise one or more additional mutations.
- a mutation X1nnnX2 means that at position nnn the amino acid X2 is present in place of the amino acid X1 which is present in the wild-type polypeptide; so, for example, K526D means that the amino acid at position 526 corresponds to an Aspartic acid (Asp or D), in place of the amino acid lysine (Lys or K) which is present in the wild-type polypeptide.
- a modified Cas9 protein of the disclosure can be a S. pyogenes Cas9 proteins or an SpCas9 orthologue (e.g., S. thermophilus, S. aureus, or N. meningitides ).
- Exemplary mutations that can be included in modified Cas9 proteins of the disclosure include K526 mutations, R661 mutations, Y515 mutations, M495 mutations, H698 mutations, and combinations thereof.
- Specific K526 mutations that can be used in a Cas9 protein of the disclosure include K526A, K526D, K526E, and K526N.
- R661 mutations that can be used in a Cas9 protein of the disclosure include R661S, R661Q, R661L, R661D, R661E, R661F, R661M, R661W, R661Y, and R661A.
- Specific Y515 mutations that can be used in a Cas9 protein of the disclosure include Y515N.
- Specific M495 mutations that can be used in a Cas9 protein of the disclosure include M495V.
- Specific H698 mutations that can be used in a Cas9 protein of the disclosure include H698Q.
- a modified Cas9 protein comprises K526E+R661D+Y515N mutations.
- a modified Cas9 protein comprises K526E+R661E+Y515N mutations.
- a modified Cas9 protein comprises K526E+R661F+Y515N mutations.
- a modified Cas9 protein comprises K526E+R661M+Y515N mutations.
- a modified Cas9 protein comprises K526E+R661W+Y515N mutations.
- a modified Cas9 protein comprises K526E+R661Y+Y515N mutations.
- a modified Cas9 protein comprises K526D+R661Q+Y515N mutations.
- a modified Cas9 protein comprises K526D+R661L+Y515N mutations.
- a modified Cas9 protein comprises K526D+R661W+Y515N mutations.
- a modified Cas9 protein comprises K526D+R661Q+Y515N+M495V mutations.
- a modified Cas9 protein comprises K526A+R661Q+Y515N+M495V mutations.
- a modified Cas9 protein comprises K526E+R661A+Y515N+M495V mutations. [0110] In some embodiments, a modified Cas9 protein comprises K526D+R661D+Y515N mutations.
- a modified Cas9 protein comprises K526D+R661E+Y515N mutations.
- a modified Cas9 protein comprises K526D+R661F+Y515N mutations.
- a modified Cas9 protein comprises K526D+R661M+Y515N mutations.
- a modified Cas9 protein comprises K526D+R661Y+Y515N mutations.
- a modified Cas9 protein comprises K526E+R661Q+Y515N mutations.
- a modified Cas9 protein comprises K526E+R661Q+Y515N+M495V mutations.
- a modified Cas9 protein comprises K526D+R661A+Y515N+M495V mutations.
- the amino acid sequence of the modified Cas9 protein of the disclosure comprises an amino acid sequence which is at least 90% identical to SEQ ID NO:1. In other embodiments, the amino acid sequence of the modified Cas9 protein of the disclosure comprises an amino acid sequence which is at least 95% identical to SEQ ID NO:1. In other embodiments, the amino acid sequence of the modified Cas9 protein of the disclosure comprises an amino acid sequence which is at least 97% identical to SEQ ID NO:1. In other embodiments, the amino acid sequence of the modified Cas9 protein of the disclosure comprises an amino acid sequence which is at least 99% identical to SEQ ID NO:1. In other embodiments, the amino acid sequence of the modified Cas9 protein of the disclosure comprises an amino acid sequence which is identical to SEQ ID NO:1 other than one or more mutations described in this Section.
- the disclosure further provides Cas9 proteins in the form of a fusion protein with a second amino acid sequence, such as a nuclear localization signal, non-native tag, a transcriptional activator, a transcriptional repressor, a histone-modifying protein, an integrase, or a recombinase.
- a second amino acid sequence such as a nuclear localization signal, non-native tag, a transcriptional activator, a transcriptional repressor, a histone-modifying protein, an integrase, or a recombinase.
- Non-limiting examples of nuclear localization signals include PKKKRKV (SEQ ID NO:68), PKKKRRV (SEQ ID NO:69), KRPAATKKAGQAKKKK (SEQ ID NO:70), YGRKKRRQRRR (SEQ ID NO:71), RKKRRQRRR (SEQ ID NO:72), PAAKRVKLD (SEQ ID NO:73), RQRRNELKRSP (SEQ ID NO:74), VSRKRPRP (SEQ ID NO:75), PPKKARED (SEQ ID NO:76), PQPKKKPL (SEQ ID NO:77), SALIKKKKKMAP (SEQ ID NO:78), PKQKKRK (SEQ ID NO:79), RKLKKKIKKL (SEQ ID NO:80), REKKKFLKRR (SEQ ID N0:81), KRKGDEVDGVDEVAKKKSKK (SEQ ID NO:82), RKCLQAGMNLEARKTKK (SEQ ID NO:83), NQSSNFGPMKGGN
- Exemplary second amino acid sequences include protein tags (e.g., V5-tag, FI_AG-tag, myc-tag, HA-tag, GST-tag, polyHis-tag, MBP-tag), protein domains, transcription modulators, enzymes acting on small molecule substrates, DNA, RNA and protein modification enzymes (e.g., adenosine deaminase, cytidine deaminase, guanosyl transferase, DNA methyltransferase, RNA methyltransferases, DNA demethylases, RNA demethylases, dioxygenases, polyadenylate polymerases, pseudouridine synthases, acetyltransferases, deacetylase, ubiquitin-ligases, deubiquitinases, kinases, phosphatases, NEDD8-ligases, de- NEDDylases, SUMO-ligases, deSUMOylases, histone de
- the DNA endonuclease used in the compositions and methods of the disclosure is a Cas9 variant, for example, a SpCas9 variant.
- Cas9 variants described in WO 2018/149888, the contents of which are incorporated herein by reference in their entireties can be used.
- enzymes or orthologs listed as SEQ ID NOs. 1-612 of WO 2019/102381, the contents of which are incorporated herein by reference in their entireties, and variants thereof, can be utilized in the compositions and methods described herein.
- a Cas9 variant comprises a double mutation selected from K526E+Y450S, K526E+M495V, K526E+Y515N, K526E+R661X, K526E+N690I,
- a Cas9 variant comprises K526E+R661S substitutions. In some embodiments, a Cas9 variant comprises K526E+R661Q substitutions. In some embodiments, a Cas9 variant comprises K526E+R661L substitutions.
- a Cas9 variant comprises a triple mutation selected from M495V+ K526E+ R661 X, Y515N+K526E+R661X, K526E+R661X+H698Q and M495V+Y515N+K526E, where X is L, Q or S, preferably where X is Q or S.
- a Cas9 variant comprises K526E+R661S+Y515N substitutions.
- a Cas9 variant comprises K526E+R661Q+Y515N substitutions.
- a Cas9 variant comprises K526E+R661L+Y515N substitutions.
- a Cas9 variant comprises K526E+Y515N+M495V substitutions.
- a Cas9 variant comprises a quadruple mutation selected from M495V+Y515N+K526E+R661X and M495V+K526E+R661X+H698Q, where X is L, Q or S, preferably where X is Q or S.
- the Cas9 variant comprises the mutations K526E+R661 Q+H698Q+M495V.
- the Cas9 variant comprises the mutations M495V+Y515N+K526E+R661Q (hereinafter also named evoCas9). In other embodiments, the Cas9 variant comprises the mutations M495V+Y515N+K526E+R661S (hereinafter named evoCas9-ll).
- a Cas9 variant comprises a single mutation selected from D406Y, W464L, T474A, K526E, N612K, and L683P.
- a Cas9 variant comprises a double mutation selected from R400H+Y450S, D406V+E523K, A421V+R661W, R424G+Q739P, W476R+L738P, P449S+F704S, N522K+G658E, E523D+E617K, L540Q+L607P, W659R+R661W, S675C+Q695L and I679V+H723L.
- a Cas9 variant comprises three mutations selected from K377E+L598P+L651 H, D397E+Y430C+L666P, Q402R+V561M+Q695L, N407P+F498I+P509L, N407H+K637N+N690I, Y450H+F553L+Q716H, Y450N+H698P+Q739K,
- a Cas9 variant comprises four mutations selected from F405L+F518L+L651 P+I724V, L423P+M465R+Y515N+K673M,
- a Cas9 variant comprises the five mutations R403H+N612Y+L651P+K652E+G715S.
- a Cas9 variant comprises six mutations from
- a Cas9 variant comprises seven mutations selected from R403H+A456T+N612Y+L651 P+K652E+G715S+G728T,
- a Cas9 variant comprises the following eight mutations R403H+R442N+V452I+N609S+N612Y+R635G+L651P+K652E+F693Y+G715S.
- a Cas9 variant comprises the following nine mutations R403H+R457Q+F518I+N612Y+R635G+L651 P+K652E+F693Y+G715S.
- a Cas9 variant comprises at least one mutation selected from Y450S, M495V, Y515N, K526E, R661X, N690I, R691Q, Q695H, and H698Q, where X is L, Q or S, preferably where X is Q or S.
- a Cas9 variant comprises N692A, M694A, Q695A, and H698A mutations (see Ikeda etai, 2019, Commun Biol 2, 371, describing a Cas9 variant with these mutations identified as HypaCas9)
- a Cas9 variant comprises K848A, K1003A, and R1060A mutations (see Slaymaker etai, 2016, Science, 351 (6268): 84-88, describing a Cas9 variant with these mutations identified as eSpCas9(1.1)).
- a Cas9 variant comprises F539S, M763I, and K890N mutations (see Lee etai.., 2018, Nat Commun. 9:3048, describing a Cas9 variant with these mutations identified as Sniper-Cas).
- a Cas9 variant comprises N497A, R661A, Q695A, and Q926A mutations (see Kleinstiver etai. 2016, Nature, 529:490-495, describing a Cas9 variant with these mutations identified as SpCas9-HF1).
- a Cas9 variant comprises a R691A mutation (see Vakulskas et ai, 2018, Nat Med 24:1216-1224, describing a Cas9 variant with these mutations identified as HiFi Cas9).
- endonucleases that can be utilized in the present disclosure are provided in SEQ ID NOs: 1-612 of WO 2019/102381. These proteins, and any other described herein, can be modified before use or can be encoded in a nucleic acid sequence such as a DNA, RNA or mRNA or within a vector construct such as the plasmids or adeno-associated virus (AAV) vectors described herein. Further, they can be codon optimized.
- AAV adeno-associated virus
- the disclosure provides nucleic acids (e.g ., DNA or RNA) encoding the gRNAs of the disclosure, nucleic acids encoding a DNA endonuclease (e.g., a DNA endonuclease described in Section 6.3) and pluralities of nucleic acids, for example comprising a nucleic acid encoding a gRNA or more than one gRNA (e.g., two gRNAs) and a nucleic acid encoding a DNA endonuclease.
- nucleic acids e.g ., DNA or RNA
- nucleic acids encoding a DNA endonuclease e.g., a DNA endonuclease described in Section 6.3
- pluralities of nucleic acids for example comprising a nucleic acid encoding a gRNA or more than one gRNA (e.g., two gRNAs) and a nucleic acid encoding a DNA end
- a nucleic acid encoding a gRNA can be, for example, a plasmid or a viral genome (e.g., a lentivirus, retrovirus, adenovirus, or adeno-associated virus genome modified to encode the gRNA).
- Plasmids can be, for example, plasmids for producing virus particles, e.g., lentivirus particles, or plasmids for propagating the gRNA coding sequence in bacterial (e.g., E. coli) or eukaryotic (e.g., yeast) cells.
- a nucleic acid encoding a gRNA can, in some embodiments, further encode a DNA endonuclease protein, e.g., a Cas9 protein described in Section 6.3.
- a DNA endonuclease can be encoded by a separate nucleic acid (e.g., DNA or mRNA).
- plasmids encoding a Cas9 protein can be modified to encode a different Cas9 protein, e.g., a Cas9 variant as described in Section 6.3.
- Nucleic acids encoding a DNA endonuclease can be codon optimized, e.g., where at least one non-common codon or less-common codon has been replaced by a codon that is common in a host cell.
- a codon optimized nucleic acid can direct the synthesis of an optimized messenger mRNA, e.g., optimized for expression in a mammalian expression system.
- a human codon-optimized polynucleotide encoding Cas9 can be used for producing a Cas9 polypeptide.
- Nucleic acids of the disclosure can comprise one or more regulatory elements such as promoters, enhancers, and other expression control elements (e.g., transcription termination signals, such as polyadenylation signals and poly-U sequences).
- regulatory elements e.g., transcription termination signals, such as polyadenylation signals and poly-U sequences.
- Such regulatory elements are described, for example, in Goeddel, 1990, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif.
- Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences).
- a tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as retinal tissue (e.g., by using a RHO promoter), or in particular cell types (e.g., retinal photoreceptor cells). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific.
- a nucleic acid of the disclosure comprises one or more pol III promoter (e.g., 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g., 1, 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g., 1, 2, 3, 4, 5, or more pol I promoters), or combinations thereof, e.g., to express a gRNA and a Cas9 protein separately.
- pol III promoters include, but are not limited to, U6 and H1 promoters.
- pol II promoters include, but are not limited to, the retroviral Rous Sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) (see, e.g., Boshart et at, Cell, 1985, 41:521-530), the SV40 promoter, the dihydrofolate reductase promoter, the b-actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EF1a promoter.
- exemplary enhancer elements include WPRE; CMV enhancers; the R-U5' segment in LTR of HTLV-I;
- SV40 enhancer and the intron sequence between exons 2 and 3 of rabbit b-globin. It will be appreciated by those skilled in the art that the design of an expression vector can depend on such factors as the choice of the host cell, the level of expression desired, etc.
- a polynucleotide encoding a guide RNA, a DNA endonuclease, and/or any additional nucleic acid or proteinaceous molecule advantageous for carrying out the various aspects of the methods disclosed herein can be comprised within vector (e.g., a recombinant expression vector).
- vector refers to a polynucleotide molecule capable of transporting another nucleic acid to which it has been linked.
- polynucleotide vector includes a "plasmid”, which refers to a circular double-stranded DNA loop into which additional nucleic acid segments are or can be ligated.
- plasmid refers to a circular double-stranded DNA loop into which additional nucleic acid segments are or can be ligated.
- viral vector Another type of polynucleotide vector; wherein additional nucleic acid segments can be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- vectors can be capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors can be referred to herein as “recombinant expression vectors", or more simply “expression vectors”, which serve equivalent functions.
- operably linked means that the nucleotide sequence of interest is linked to regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence.
- regulatory sequence is intended to include, for example, promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are well known in the art and are described, for example, in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990).
- Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cells, and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the target cell, the level of expression desired, and the like.
- Vectors can include, but are not limited to, viral vectors based on vaccinia virus, poliovirus, adenovirus, adeno-associated virus (e.g., AAV2, AAV5, AAV7m8, AAV8) , SV40, herpes simplex virus, human immunodeficiency virus, retrovirus (e.g., Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a lentivirus, human immunodeficiency virus, myeloproliferative sarcoma virus, and mammary tumor virus) and other recombinant vectors.
- retrovirus e.g., Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a
- vectors contemplated for eukaryotic target cells include, but are not limited to, the vectors pXTI, pSG5, pSVK3, pBPV, pMSG, and pSVLSV40 (Pharmacia). Additional vectors contemplated for eukaryotic target cells include, but are not limited to, the vectors pCTx-l, pCTx-2, and pCTx-3. Other vectors can be used so long as they are compatible with the host cell.
- a vector can comprise one or more transcription and/or translation control elements.
- any of a number of suitable transcription and translation control elements including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc. can be used in the expression vector.
- the vector can be a self-inactivating vector that either inactivates the viral sequences or the components of the CRISPR machinery or other elements.
- Non-limiting examples of suitable eukaryotic promoters include those from cytomegalovirus (CMV) immediate early, herpes simplex virus (HSV) thymidine kinase, early and late SV40, long terminal repeats (LTRs) from retrovirus, human elongation factor-l promoter (EF1), e.g., EF1 alpha short promoter, a hybrid construct comprising the cytomegalovirus (CMV) enhancer fused to the chicken beta-actin promoter (CAG), murine stem cell virus promoter (MSCV), phosphoglycerate kinase-1 locus promoter (PGK), and mouse metallothionein-l.
- CMV cytomegalovirus
- HSV herpes simplex virus
- LTRs long terminal repeats
- EF1 human elongation factor-l promoter
- CAG chicken beta-actin promoter
- MSCV murine stem cell virus promoter
- PGK phosphoglycerate
- RNA polymerase III promoters for example U6 and H1
- U6 and H1 RNA polymerase III promoters
- Descriptions of and parameters for enhancing the use of such promoters are known in art; see, e.g., Ma, et. al., 2014, Molecular Therapy - Nucleic Acids 3, el 61.
- a U6 promoter is used to drive expression of a gRNA.
- a H1 promoter is used to drive expression a gRNA.
- An expression vector can also contain a ribosome binding site for translation initiation and a transcription terminator.
- the expression vector can also comprise appropriate sequences for amplifying expression.
- the expression vector can also include nucleotide sequences encoding non-native tags (e.g., histidine tag, hemagglutinin tag, green fluorescent protein, etc.) that are fused to the site-directed polypeptide, thus resulting in a fusion protein.
- non-native tags e.g., histidine tag, hemagglutinin tag, green fluorescent protein, etc.
- a promoter can be an inducible promoter (e.g., a heat shock promoter, tetracycline- regulated promoter, steroid-regulated promoter, metal-regulated promoter, estrogen receptor- regulated promoter, etc.).
- the promoter can be a constitutive promoter (e.g., CMV promoter, UBC promoter, an EF1 alpha promoter, e.g., EF1 alpha short (EFS) promoter).
- the promoter can be a spatially restricted and/or temporally restricted promoter (e.g., a tissue specific promoter, a cell type specific promoter, etc.).
- a RHO promoter is used to drive expression of a Cas9 protein.
- a hGRK1 promoter is used to drive expression of a Cas9 protein.
- the disclosure also provides a host cell comprising a nucleic acid of the disclosure.
- host cells can be used, for example, to produce virus particles encoding a gRNA of the disclosure and, optionally, a DNA endonuclease such as a Cas9 protein.
- host cells are used to produce virus particles encoding a gRNA (but no Cas9 protein) and to produce virus particles encoding a Cas9 protein (but no gRNA).
- the virus particles encoding a gRNA and the virus particles encoding a Cas9 can then be used together to deliver a gRNA and Cas9 to a cell (e.g., by combining the virus particles into a single composition which is then contacted with the cell or by separately contacting the cell with the different virus particles).
- Host cells can also be used to make vesicles containing a gRNA and, optionally, a DNA endonuclease such as a Cas9 protein (e.g., as described in Montagna eta!., 2018, Molecular Therapy: Nucleic Acids, 12:453-462).
- Exemplary host cells include eukaryotic cells, e.g., mammalian cells.
- Exemplary mammalian host cells include human cell lines such as BHK-21, BSRT7/5, VERO, WI38, MRC5, A549, HEK293, HEK293T, Caco-2, B-50 or any other HeLa cells, HepG2, Saos-2, HuH7, and HT1080 cell lines.
- Host cells can be engineered host cells, for example, host cells engineered to express a DNA binding protein such a repressor (e.g., TetR), to regulate virus or vesicle production (see Petris eta!., 2017, Nature Communications, 8:15334).
- a repressor e.g., TetR
- Host cells can also be used to propagate the gRNA coding sequences of the disclosure.
- the host cell can be a eukaryote or prokaryote and includes, for example, yeast (such as Pichia pastoris or Saccharomyces cerevisiae), bacteria (such as E. coli or Bacillus subtilis), insect Sf9 cells (such as baculovirus-infected SF9 cells) or mammalian cells (such as Human Embryonic Kidney (HEK) cells, Chinese hamster ovary cells, HeLa cells, human 293 cells and monkey COS-7 cells).
- yeast such as Pichia pastoris or Saccharomyces cerevisiae
- bacteria such as E. coli or Bacillus subtilis
- insect Sf9 cells such as baculovirus-infected SF9 cells
- mammalian cells such as Human Embryonic Kidney (HEK) cells, Chinese hamster ovary cells, HeLa cells, human 293 cells and
- the disclosure further provides systems comprising a gRNA of the disclosure and a DNA endonuclease such as a Cas9 protein.
- the systems can comprise a ribonucleoprotein particle (RNP) in which a gRNA as described herein is complexed with a DNA endonuclease such as a Cas9 protein.
- RNP ribonucleoprotein particle
- the Cas9 protein can be, for example, a Cas9 protein described in Section 6.3.
- Systems of the disclosure can further comprise genomic DNA complexed with the gRNA and the DNA endonuclease.
- the disclosure provides a system comprising a gRNA of the disclosure, a genomic DNA comprising a RHO gene, and a DNA endonuclease such as Cas9, all complexed with one another.
- Systems of the disclosure can further comprise a second gRNA.
- a system can comprise a first gRNA for targeting the rs7984 SNP and a second gRNA targeting intron 1 of the RHO gene.
- the systems of the disclosure can exist within a cell (whether the cell is in vivo, ex vivo, or in vitro) or outside a cell (e.g., in a particle our outside of a particle).
- the disclosure further provides particles comprising a gRNA of the disclosure and provides particles comprise a nucleic acid encoding a gRNA of the disclosure.
- the particles can further comprise a DNA endonuclease such as a Cas9 protein, e.g., a Cas9 protein described in Section 6.3, or a nucleic acid encoding the Cas9 protein (e.g., DNA or mRNA).
- Exemplary particles include lipid nanoparticles, vesicles, and gold nanoparticles.
- a particle contains only a single species of gRNA.
- the disclosure further provides particles (e.g., virus particles) comprising a nucleic acid encoding a gRNA of the disclosure.
- the particles can further comprise a nucleic acid encoding a Cas9 protein.
- the disclosure further provides pluralities of particles (e.g., pluralities of virus particles).
- Such pluralities can include a particle encoding one or more gRNAs (e.g., two) and a different particle encoding a Cas9 protein.
- a plurality of particles can comprise a virus particle (e.g., a AAV2, AAV5, AAV7m8, or AAV8 virus particle) encoding one or more gRNAs and a second virus particle (e.g., a AAV2, AAV5, AAV5, AAV7m8, or AAV8 virus particle) encoding a Cas9 protein.
- the virus particle encoding one or more gRNAs encodes a first gRNA targeting the rs7984 SNP and a second gRNA targeting intron 1 of the RHO gene.
- the disclosure further provides cells and populations of cells (e.g., a population comprising 10 or more, 50 or more 100 or more, 1,000 or more, or 100,000 thousand or more cells) comprising a gRNA of the disclosure.
- Such cells and populations can further comprise a DNA endonuclease such as a Cas9 protein or a nucleic acid encoding the Cas9 protein (e.g., DNA or mRNA).
- a DNA endonuclease such as a Cas9 protein or a nucleic acid encoding the Cas9 protein (e.g., DNA or mRNA).
- such cells and populations are isolated, e.g., isolated from cells not containing the gRNA.
- the cells and populations of cells can be, for example, human cells such as a iPSC, retinal cell, photoreceptor cell, retinal progenitor cell, etc.
- the cell populations of the disclosure can be cells in which gene editing by the systems of the disclosure has taken place, or cells in which the components of a system of the disclosure have been expressed but gene editing has not taken place, or a combination thereof.
- a cell population can comprise, for example, a population in which at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, or at least 70% of the cells have undergone gene editing by a system of the disclosure.
- the Cas9 protein should be a Cas9 protein capable of recognizing a PAM near (e.g., adjacent) to the target sequence corresponding to the gRNA’s spacer sequence.
- compositions and medicaments comprising a gRNA or plurality of gRNAs, Cas9 protein, nucleic acid or plurality of nucleic acids, system, particle, or plurality of particles of the disclosure together with a pharmaceutically acceptable excipient.
- Suitable excipients include, but are not limited to, salts, diluents, (e.g., Tris-HCI, acetate, phosphate), preservatives (e.g., Thimerosal, benzyl alcohol, parabens), binders, fillers, solubilizers, disintegrants, sorbents, solvents, pH modifying agents, antioxidants, antinfective agents, suspending agents, wetting agents, viscosity modifiers, tonicity agents, stabilizing agents, and other components and combinations thereof.
- Suitable pharmaceutically acceptable excipients can be selected from materials which are generally recognized as safe (GRAS), and may be administered to an individual without causing undesirable biological side effects or unwanted interactions.
- compositions can be complexed with polyethylene glycol (PEG), metal ions, or incorporated into polymeric compounds such as polyacetic acid, polyglycolic acid, hydrogels, etc., or incorporated into liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts or spheroblasts.
- PEG polyethylene glycol
- metal ions or incorporated into polymeric compounds such as polyacetic acid, polyglycolic acid, hydrogels, etc.
- liposomes such as polyacetic acid, polyglycolic acid, hydrogels, etc.
- Suitable dosage forms for administration include solutions, suspensions, and emulsions.
- the components of the pharmaceutical formulation can be dissolved or suspended in a suitable solvent such as, for example, water, Ringer's solution, phosphate buffered saline (PBS), or isotonic sodium chloride.
- a suitable solvent such as, for example, water, Ringer's solution, phosphate buffered saline (PBS), or isotonic sodium chloride.
- the formulation may also be a sterile solution, suspension, or emulsion in a nontoxic, parenterally acceptable diluent or solvent such as 1,3-butanediol.
- formulations can include one or more tonicity agents to adjust the isotonic range of the formulation. Suitable tonicity agents are well known in the art and include glycerin, mannitol, sorbitol, sodium chloride, and other electrolytes.
- the formulations can be buffered with an effective amount of buffer necessary to maintain a pH suitable for parenteral administration.
- Suitable buffers are well known by those skilled in the art and some examples of useful buffers are acetate, borate, carbonate, citrate, and phosphate buffers.
- the formulation can be distributed or packaged in a liquid form, or alternatively, as a solid, obtained, for example by lyophilization of a suitable liquid formulation, which can be reconstituted with an appropriate carrier or diluent prior to administration.
- the formulations can comprise one or more guide RNAs and a DNA endonuclease (or one or more nucleic acids encoding the gRNA(s) and DNA endonuclease, where such nucleic acids can be in one or more particles such as AAV particles) in a pharmaceutically effective amount sufficient to edit a RHO gene having a pathogenic mutation in a cell.
- the formulations can comprise one or more guide RNAs and a DNA endonuclease (or one or more nucleic acids encoding the gRNA(s) and DNA endonuclease, where such nucleic acids can be in one or more particles such as AAV particles) in a pharmaceutically effective amount sufficient to treat retinitis pigmentosa.
- the disclosure further provides methods of using the gRNAs, nucleic acids (including pluralities of nucleic acids), Cas9 proteins, systems, and particles (including pluralities of particles) of the disclosure for altering cells.
- Methods of the disclosure can be used, for example, to treat subjects having a RP caused by a pathogenic mutation in their RHO gene, for example a P23 or P347 mutation, and in particular subjects who are heterozygous for the rs7984 SNP.
- a method of altering a cell comprises contacting a human cell having a RHO gene with a pathogenic mutation with a nucleic acid (or plurality of nucleic acids), particle (or plurality of particles), system (or plurality of systems) or pharmaceutical composition (or plurality of pharmaceutical compositions) described herein.
- the cell is preferably heterozygous for the rs7984 SNP and heterozygous for the pathogenic mutation.
- Methods of the disclosure can comprise a genotyping step to determine whether the cell is heterozygous for the rs7984 SNP, and to determine which allele of the rs7984 SNP is in phase with the RHO allele having the pathogenic mutation (e.g., by genotyping the subject from which the cell is obtained or present in).
- a genotyping step to determine whether the cell is heterozygous for the rs7984 SNP, and to determine which allele of the rs7984 SNP is in phase with the RHO allele having the pathogenic mutation (e.g., by genotyping the subject from which the cell is obtained or present in).
- Contacting a cell with a disclosed nucleic acid, particle, system or pharmaceutical composition can be achieved by any method known in the art and can be performed in vivo, ex vivo, or in vitro.
- the methods can include obtaining one or more cells from a subject prior to contacting the cell(s) with a herein disclosed nucleic acid, particle, system or pharmaceutical composition.
- the methods can further comprise returning or implanting the contacted cell or a progeny thereof to the subject.
- Guide RNAs and endonucleases, as well as nucleic acids encoding gRNAs and nucleic acids encoding endonucleases can be delivered to a cell by any means known in the art, for example, by viral or non-viral delivery vehicles, electroporation or lipid nanoparticles.
- DNA endonucleases can be delivered to a cell as one or more polypeptides, either alone or pre- complexed with one or more guide RNAs, or as a nucleic acid (DNA or RNA) encoding the DNA endonuclease.
- Polynucleotides such as gRNA and/or a polynucleotide encoding an endonuclease, can be delivered to a cell (ex vivo or in vivo) by a lipid nanoparticle (LNP).
- LNPs can have, for example, a diameter of less than 1000 nm, 500 nm, 250 nm, 200 nm, 150 nm, 100 nm, 75 nm, 50 nm, or 25 nm.
- a nanoparticle can range in size from 1-1000 nm, 1-500 nm, 1- 250 nm, 25-200 nm, 25-100 nm, 35-75 nm, or 25-60 nm.
- LNPs can be made from cationic, anionic, neutral lipids, and combinations thereof.
- Neutral lipids such as the fusogenic phospholipid DOPE or the membrane component cholesterol, can be included in LNPs as 'helper lipids' to enhance transfection activity and nanoparticle stability.
- LNPs can also be comprised of hydrophobic lipids, hydrophilic lipids, or both hydrophobic and hydrophilic lipids. Lipids and combinations of lipids that are known in the art can be used to produce a LNP. Examples of lipids used to produce LNPs are: DOTMA,
- cationic lipids are: 98N12-5, C12-200, DLin-KC2- DMA (KC2), DLin-MC3-DMA (MC3), XTC, MD1, and 7C1.
- neutral lipids are: DPSC, DPPC, POPC, DOPE, and SM.
- PEG-modified lipids are: PEG-DMG, PEG- CerCI4, and PEG-CerC20.
- Lipids can be combined in any number of molar ratios to produce a LNP.
- the polynucleotide(s) can be combined with lipid(s) in a wide range of molar ratios to produce a LNP.
- Guide RNAs and/or DNA endonucleases can be delivered to a cell via an adeno- associated viral vector ⁇ e.g., of an AAV2, AAV5, AAV7m8, AAV8, AAV9, or AAVrh8r serotype), or by another viral vector.
- adeno-associated viral vector e.g., of an AAV2, AAV5, AAV7m8, AAV8, AAV9, or AAVrh8r serotype
- Other viral vectors include, but are not limited to lentivirus, adenovirus, alphavirus, enterovirus, pestivirus, baculovirus, herpesvirus, Epstein Barr virus, papovavirusr, poxvirus, vaccinia virus, and herpes simplex virus.
- a Cas9 mRNA is formulated in a lipid nanoparticle, while a sgRNA is delivered to a cell in an AAV or other viral vector.
- one or more AAV vectors e.g., one or more AAV2, AAV5, AAV7m8, or AAV8 viral vectors
- a sgRNA or combination of sgRNAs and a Cas9 are delivered using separate vectors.
- a first AAV vector encoding a sgRNA targeting the rs7984 SNP and a sgRNA targeting RHO intron 1 can be used to deliver the sgRNAs
- a second AAV vector encoding a Cas9 protein can be used to deliver the Cas9 protein.
- the first and second AAV vectors can be in a single composition. Alternatively, separate compositions of the first and second AAV vectors can be used.
- compositions and methods for administering gRNAs and endonucleases to a cell and/or subject are further described in PCT Patent Application Publication WO 2019/102381 , which is incorporated by reference herein in its entirety.
- DNA cleavage can result in a single-strand break (SSB) or double-strand break (DSB) at particular locations within the DNA molecule.
- SSB single-strand break
- DSB double-strand break
- Such breaks can be and regularly are repaired by natural, endogenous cellular processes, such as homology-dependent repair (HDR) and non- homologous end-joining (NHEJ).
- HDR homology-dependent repair
- NHEJ non- homologous end-joining
- These repair processes can edit the targeted polynucleotide by introducing a mutation, thereby resulting in a polynucleotide having a sequence which differs from the polynucleotide’s sequence prior to cleavage by a DNA endonuclease.
- NHEJ and HDR DNA repair processes consist of a family of alternative pathways.
- Non- homologous end-joining refers to the natural, cellular process in which a double- stranded DNA-break is repaired by the direct joining of two non-homologous DNA segments. See, e.g. Cahill etai, 2006, Front. Biosci. 11:1958-1976.
- DNA repair by non-homologous end joining is error-prone and frequently results in the untemplated addition or deletion of DNA sequences at the site of repair.
- NHEJ repair mechanisms can introduce mutations into the coding sequence which can disrupt gene function.
- NHEJ directly joins the DNA ends resulting from a double-strand break, sometimes with a modification of the polynucleotide sequence such as a loss of or addition of nucleotides in the polynucleotide sequence.
- the modification of the polynucleotide sequence can disrupt (or perhaps enhance) gene expression.
- Homology-dependent repair utilizes a homologous sequence, or donor sequence, as a template for inserting a defined DNA sequence at the break point.
- the homologous sequence can be in the endogenous genome, such as a sister chromatid.
- the donor can be an exogenous nucleic acid, such as a plasmid, a single-strand oligonucleotide, a double- stranded oligonucleotide, a duplex oligonucleotide or a virus, that has regions of high homology with the nuclease-cleaved locus, but which can also contain additional sequence or sequence changes including deletions that can be incorporated into the cleaved target locus.
- a third repair mechanism includes microhomology-mediated end joining (MMEJ), also referred to as “Alternative NHEJ (ANHEJ)”, in which the genetic outcome is similar to NHEJ in that small deletions and insertions can occur at the cleavage site.
- MMEJ can make use of homologous sequences of a few base pairs flanking the DNA break site to drive a more favored DNA end joining repair outcome. In some instances, it may be possible to predict likely repair outcomes based on analysis of potential microhomologies at the site of the DNA break.
- Modifications of a cleaved polynucleotide by HDR, NHEJ, and/or ANHEJ can result in, for example, mutations, deletions, alterations, integrations, gene correction, gene replacement, gene tagging, transgene insertion, nucleotide deletion, gene disruption, translocations and/or gene mutation.
- the aforementioned process outcomes are examples of editing a polynucleotide.
- the contacting step of the methods of the disclosure results in the editing of a RHO gene comprising a pathogenic mutation.
- the editing of the RHO gene comprising a pathogenic mutation can include deletion, insertion, or substitution of one or more nucleotides in the RHO gene.
- editing of the RHO gene comprising a pathogenic mutation results in a deletion of one or more nucleotides in the RHO gene.
- the methods can provide for advantageous and/or therapeutic results in the cell and/or the subject in which the cell is located.
- the methods can reduce expression of the RHO gene comprising a pathogenic mutation.
- the methods can reduce the amount of RHO protein comprising a pathogenic mutation within the contacted cell and/or progeny thereof.
- the methods can decrease the amount of misfolded RHO protein within the cell and/or progeny thereof.
- the methods can decrease the amount of mislocalized RHO protein within the cell and/or progeny thereof.
- the methods can decrease the rate of or amount of cell death.
- the methods can delay, slow progression, halt, or reverse onset of a RHO- associated disease such as retinitis pigmentosa (RP).
- RP retinitis pigmentosa
- the amount of a wild-type RHO protein is not significantly reduced.
- the disclosure provides methods for treating a subject having a pathogenic mutation using the gRNAs, nucleic acids, systems, and particles of the disclosure.
- the methods can comprise editing a RHO allele in one or more cells from the subject or one or more cells derived from a cell of the subject (e.g., an induced pluripotent stem cell (iPSC)).
- a cell of the subject e.g., an induced pluripotent stem cell (iPSC)
- iPSC induced pluripotent stem cell
- one or more cells from the subject or one or more cells derived from a cell of the subject can be contacted with a gRNA, nucleic acid, system, or particle of the disclosure ex vivo, and cells having an edited RHO gene or progeny thereof can subsequently be implanted into the subject.
- iPSCs can be generated from epithelial cells of a subject by technologies known to the skilled artisan.
- the chromosomal DNA of such iPSC cells can be edited using the materials and methods described herein. Repair of the cleaved DNA (e.g., by insertion, deletion, substitution, or frameshift mutations) can result in editing of the RHO gene at the site of the single- or double-strand break. Edited iPSCs can subsequently be differentiated, for instance into photoreceptor cells or retinal progenitor cells. In some embodiments, resultant differentiated cells can be implanted into the subject.
- differentiated cells of subject can be used.
- photoreceptor cells or retinal progenitor cells can be used (e.g., following isolation from the subject).
- implantation of edited cells can proceed without an intervening differentiation step.
- Advantages of ex vivo cell therapy approaches include the ability to conduct a comprehensive analysis of the therapeutic prior to administration.
- Nuclease-based therapeutics can have some level of off-target effects.
- Performing gene correction ex vivo allows a method user to characterize the corrected cell population prior to implantation, including identifying any undesirable off-target effects. Where undesirable effects are observed, a method user may opt not to implant the cells or cell progeny, may further edit the cells, or may select new cells for editing and analysis.
- Other advantages include ease of genetic correction in iPSCs compared to other primary cell sources. iPSCs are prolific, making it easy to obtain the large number of cells that will be required for a cell-based therapy. Furthermore, iPSCs are an ideal cell type for performing clonal isolations. This allows screening for the correct genomic correction, without risking a decrease in viability.
- the disclosure provides in vivo methods for treating a subject with a pathogenic RHO mutation.
- the method is an in vivo cell-based therapy.
- Chromosomal DNA of the cells in the subject can be edited using the materials and methods described herein.
- the in vivo method can comprise editing a RHO gene having a pathogenic mutation in a cell of a subject, such as photoreceptor cells or retinal progenitor cells.
- the in vivo methods comprise administering one or more pharmaceutical compositions of the disclosure to or near the eye of a subject, e.g., by sub-retinal injection or intravitreal injection.
- a single pharmaceutical composition comprising a first AAV encoding one or more gRNAs (e.g., a gRNA targeting the rs7984 SNP and a gRNA targeting RHO intron 1) and a second AAV encoding a Cas9 protein can be used; or alternatively, a first pharmaceutical composition comprising the first AAV and a second, separate pharmaceutical composition comprising the second AAV can be used.
- gRNAs e.g., a gRNA targeting the rs7984 SNP and a gRNA targeting RHO intron 1
- a first pharmaceutical composition comprising the first AAV and a second, separate pharmaceutical composition comprising the second AAV
- they are preferably administered sufficiently close in time so that the first and second AAVs and/or gRNA(s) and Cas9 protein(s) encoded thereby are present together in vivo.
- Additional promoters are inducible, and therefore can be temporally controlled if the nuclease is delivered as a plasmid.
- the amount of time that delivered RNA and protein remain in the cell can also be adjusted using treatments or domains added to change the half-life.
- In vivo treatment would eliminate a number of treatment steps, but a lower rate of delivery can require higher rates of editing.
- In vivo treatment can eliminate problems and losses from ex vivo treatment and engraftment.
- An advantage of in vivo gene therapy can be the ease of therapeutic production and administration.
- Administration can be, for example, by sub-retinal injection of one or more pharmaceutical composition.
- Administration can be alternatively be, for example, by intravitreal injection of one or more pharmaceutical compositions.
- the same therapeutic approach and therapy has the potential to be used to treat more than one patient, for example a number of patients who share the same or similar genotype or allele.
- ex vivo cell therapy typically requires using a subject’s own cells, which are isolated, manipulated and returned to the same patient.
- the principal targets for gene editing can be within a cell such as a human cell.
- a human cell can be somatic cells, which after being modified using techniques described herein, can give rise to differentiated cells, e.g., photoreceptor cells or retinal progenitor cells.
- differentiated cells e.g., photoreceptor cells or retinal progenitor cells.
- human cells can be photoreceptor cells or retinal progenitor cells.
- Progenitor cells are capable of both proliferation and giving rise to more progenitor cells, which in turn have the ability to generate a large number of cells that can in turn give rise to differentiated or differentiable daughter cells.
- the daughter cells themselves can be induced to proliferate and produce progeny that subsequently differentiate into one or more mature cell types, while also retaining one or more cells with parental developmental potential.
- stem cell refers then to a cell with the capacity or potential, under particular circumstances, to differentiate to a more specialized or differentiated phenotype, and which retains the capacity, under certain circumstances, to proliferate without substantially differentiating.
- progenitor or stem cell refers to a generalized mother cell whose descendants (progeny) specialize, often in different directions, by differentiation, e.g., by acquiring completely individual characters, as occurs in progressive diversification of embryonic cells and tissues.
- Cellular differentiation is a complex process typically occurring through many cell divisions.
- a differentiated cell can derive from a multipotent cell that itself is derived from a multipotent cell, and so on. While each of these multipotent cells can be considered stem cells, the range of cell types that each can give rise to can vary considerably.
- Some differentiated cells also have the capacity to give rise to cells of greater developmental potential. Such capacity can be natural or can be induced artificially upon treatment with various factors.
- stem cells can also be "multipotent" because they can produce progeny of more than one distinct cell type, but this is not required.
- Human cells described herein can be induced pluripotent stem cells (iPSCs).
- iPSCs induced pluripotent stem cells
- An advantage of using iPSCs in the methods of the disclosure is that the cells can be derived from the same subject to which the progenitor cells are to be administered. That is, a somatic cell can be obtained from a subject, reprogrammed to an induced pluripotent stem cell, and then differentiated into a progenitor cell to be administered to the subject (e.g., an autologous cell). Because progenitors are essentially derived from an autologous source, the risk of engraftment rejection or allergic response can be reduced compared to the use of cells from another subject or group of subjects. In addition, the use of iPSCs negates the need for cells obtained from an embryonic source. Thus, in one aspect, the stem cells used in the disclosed methods are not embryonic stem cells.
- Methods are known in the art that can be used to generate pluripotent stem cells from somatic cells.
- Pluripotent stem cells generated by such methods can be used in the method of the disclosure.
- Mouse somatic cells can be converted to ES cell-like cells with expanded developmental potential by the direct transduction of Oct4, Sox2, Klf4, and c-Myc; see, e.g., Takahashi and Yamanaka, 2006, Cell 126(4): 663-76.
- iPSCs resemble ES cells, as they restore the pluripotency-associated transcriptional circuitry and much of the epigenetic landscape.
- mouse iPSCs satisfy all the standard assays for pluripotency: specifically, in vitro differentiation into cell types of the three germ layers, teratoma formation, contribution to chimeras, germline transmission (see, e.g., Maherali and Hochedlinger, 2008, Cell Stem Cell. 3(6): 595-605), and tetraploid complementation.
- iPSCs can be obtained using similar transduction methods, and the transcription factor trio, OCT4, SOX2, and NANOG, has been established as the core set of transcription factors that govern pluripotency; see, e.g., 2014, Budniatzky and Gepstein, Stem Cells Transl Med. 3(4):448-57; Barrett etal, 2014, Stem Cells Trans Med 3: 1-6 sctm.2014-0121; Focosi et al, 2014, Blood Cancer Journal 4: e211.
- the production of iPSCs can be achieved by the introduction of nucleic acid sequences encoding stem cell-associated genes into an adult, somatic cell, historically using viral vectors.
- iPSCs can be generated or derived from terminally differentiated somatic cells, as well as from adult stem cells, or somatic stem cells. That is, a non-pluripotent progenitor cell can be rendered pluripotent or multipotent by reprogramming. In such instances, it may not be necessary to include as many reprogramming factors as required to reprogram a terminally differentiated cell.
- reprogramming can be induced by the non-viral introduction of reprogramming factors, e.g., by introducing the proteins themselves, or by introducing nucleic acids that encode the reprogramming factors, or by introducing messenger RNAs that upon translation produce the reprogramming factors (see e.g., Warren et al., 2010, Cell Stem Cell, 7(5):6I8- 30.
- Reprogramming can be achieved by introducing a combination of nucleic acids encoding stem cell-associated genes, including, for example, Oct-4 (also known as Oct-3/4 or Pouf5l), Soxl, Sox2, Sox3, Sox 15, Sox 18, NANOG, Klfl, Klf2, Klf4, Klf5, NR5A2, c-Myc, 1- Myc, n-Myc, Rem2, Tert, and LIN28.
- Reprogramming using the methods and compositions described herein can further comprise introducing one or more of Oct-3/4, a member of the Sox family, a member of the Klf family, and a member of the Myc family to a somatic cell.
- the methods and compositions described herein can further comprise introducing one or more of each of Oct-4, Sox2, Nanog, c-MYC and Klf4 for reprogramming.
- the exact method used for reprogramming is not necessarily critical to the methods and compositions described herein.
- the reprogramming is not affected by a method that alters the genome.
- reprogramming can be achieved, e.g., without the use of viral or plasmid vectors.
- Efficiency of reprogramming (the number of reprogrammed cells) derived from a population of starting cells can be enhanced by the addition of various agents, e.g., small molecules, as shown by Shi et al., 2008, Cell-Stem Cell 2:525-528; Huangfu et al., 2008,
- an agent or combination of agents that enhance the efficiency or rate of induced pluripotent stem cell production can be used in the production of patient-specific or disease-specific iPSCs.
- agents that enhance reprogramming efficiency include soluble
- MEK inhibitor DNA methyltransferase inhibitors
- HD AC histone deacetylase
- valproic acid 5'-azacytidine
- dexamethasone suberoylanilide
- SAHA hydroxamic acid
- reprogramming enhancing agents include: Suberoylanilide Hydroxamic Acid (SAHA (e.g MK0683, vorinostat) and other hydroxamic acids), BML-210, Depudecin (e.g., (-)-Depudecin), HC Toxin, Nullscript (4-(l,3-Dioxo-IH,3H-benzo[de]isoquinolin-2-yl)-N-hydroxybutanamide), Phenylbutyrate (e.g., sodium phenylbutyrate) and Valproic Acid ((VP A) and other short chain fatty acids), Scriptaid, Suramin Sodium, Trichostatin A (TSA), APHA Compound 8, Apicidin, Sodium Butyrate, pi valoyloxy methyl butyrate (Pivanex, AN-9), Trapoxin B, Chlamydocin, Depsi
- SAHA Suberoylanilide Hydroxamic Acid
- BML-210
- JNJ16241199 Tubacin, A-161906, proxamide, oxamflatin, 3-C1-UCHA (e.g., 6-(3- chlorophenylureido)caproic hydroxamic acid), AOE (2-amino-8-oxo-9, 10-epoxy decanoic acid), CHAP31 and CHAP 50.
- Other reprogramming enhancing agents include, for example, dominant negative forms of the HDACs (e.g, catalytically inactive forms), siRNA inhibitors of the HDACs, and antibodies that specifically bind to the HDACs. Such inhibitors are available, e.g., from BIOMOL International, Fukasawa, Merck Biosciences, Novartis, Gloucester Pharmaceuticals, Titan Pharmaceuticals, MethylGene, and Sigma Aldrich.
- isolated clones can be tested for the expression of a stem cell marker.
- a stem cell marker can be selected from the non-limiting group including SSEA3, SSEA4, CD9, Nanog, Fbxl5, Ecatl, Esgl, Eras, Gdfi, Fgf4, Cripto, Daxl, Zpf296, Slc2a3, Rexl, Utfl, and Natl.
- a cell that expresses Oct4 or Nanog is identified as pluripotent.
- Methods for detecting the expression of such markers can include, for example, RT-PCR and immunological methods that detect the presence of the encoded polypeptides, such as Western blots or flow cytometric analyses. Detection can involve not only RT-PCR, but also detection of protein markers. Intracellular markers can be best identified via RT-PCR, or protein detection methods such as immunocytochemistry, while cell surface markers are readily identified, e.g., by immunocytochemistry.
- Pluripotency of isolated cells can be confirmed by tests evaluating the ability of the iPSCs to differentiate into cells of each of the three germ layers.
- teratoma formation in nude mice can be used to evaluate the pluripotent character of the isolated clones.
- the cells can be introduced into nude mice and histology and/or immunohistochemistry can be performed on a tumor arising from the cells.
- the growth of a tumor comprising cells from all three germ layers, for example, further indicates that the cells are pluripotent stem cells.
- the cells used in the method described herein are photoreceptor cells or retinal progenitor cells (RPCs).
- RPCs are multipotent progenitor cells that can give rise to all the six neurons of the retina as well as the Muller glia.
- Muller glia are a type of retinal glial cells and are the major glial component of the retina. Their function is to support the neurons of the retina and to maintain retinal homeostasis and integrity. Muller glia isolated from adult human retinas have been shown to differentiate into rod photoreceptors.
- Muller glia-derived photoreceptors by patch-clamp recordings has revealed that their electrical properties are comparable to those of adult rods (Giannelli et at,, 2011, Stem Cells, (2):344-56).
- RPCs are gradually specified into lineage-restricted precursor cells during retinogenesis, which then maturate into the terminally differentiated neurons or Muller glia.
- Fetal-derived human retinal progenitor cells (hRPCs) exhibit molecular characteristics indicative of a retinal progenitor state up to the sixth passage. They demonstrate a gradual decrease in the percentages of KI67-, SOX2-, and vimentin-positive cells from passages 1 to 6, whereas a sustained expression of nestin and PAX6 is seen through passage 6.
- Microarray analysis of passage 1 hRPCs demonstrate the expression of early retinal developmental genes: VIM (vimentin), KI67, NES (nestin), PAX6, SOX2, HES5, GNL3, OTX2, DACH1, SIX6, and CHX10 (VSX2).
- the hRPCs are functional in nature and respond to excitatory neurotransmitters (Schmitt etai, 2009, Investigative Ophthalmology and Visual Sciences. 50(l2):590l-8).
- the outermost region of the retina contains a supportive retinal pigment epithelium (RPE) layer, which maintains photoreceptor health by transporting nutrients and recycling shed photoreceptor parts.
- RPE retinal pigment epithelium
- the RPE is attached to Bruch's membrane, an extracellular matrix structure at the interface between the choroid and retina.
- the cells described herein are photoreceptor cells, which are specialized types of neurons found in the retina. Photoreceptors convert light into signals that are able to stimulate biological processes and are responsible for sight. Rods and cones are the two classic photoreceptor cells that contribute information to the visual system.
- Retinal cells including progenitor cells may be isolated according to any method known in the art.
- retinal cells can be isolated from fresh surgical specimens.
- the retinal pigment epithelium (RPE) can be separated from the choroid by digesting the tissue with type IV collagenase and the retinal pigment epithelium patches can be cultured. Following the growth of 100-500 cells from the explant, the primary cultures can be passaged (Ishida M. et ai, 1998, Current Eye Research, 17(4): 392-402) and characterized for expression of RPE markers.
- Rods can be isolated by disruption of the biopsied retina using papain. Precautions can be taken to avoid a harsh disruption and improve cell yield.
- the isolated cells can be sorted to yield a population of pure rod cells and characterized further by immunostaining (Feodorova et al. , 2015, MethodsX, 2:39-46).
- the neural retina can be identified, cut-out, and placed on 10% gelatin.
- the inner retinal layers can be isolated using a laser.
- the isolated cone monolayers can be cultured for 18 hours and compared with untreated retinas by light microscopy and transmission microscopy to check for any structural damage.
- the cells can be characterized for expression of cone-specific markers (Salchow et al., 2001 , Current Eye Research, 22 (2):85-9).
- the biopsied retina can be minced with dual scalpels and digested enzymatically in an incubator at 37°C.
- the supernatants of the digested cells can be centrifuged and the cells can be resuspended in cell-free retinal progenitor-conditioned medium.
- the cells can be transferred to fibronectin-coated tissue culture flasks containing fresh media and cultured (Karteries et al., 2004, Journal of Neuroscience Research, 77:334-343).
- Patient-specific iPS cells or cell line can be created.
- the creating step can comprise: a) isolating a somatic cell, such as a skin cell or fibroblast, from the patient; and b) introducing a set of pluripotency-associated genes into the somatic cell in order to induce the cell to become a pluripotent stem cell.
- the set of pluripotency-associated genes can be one or more of the genes selected from the group consisting of OCT4, SOX1, SOX2, SOX3, SOX15, SOX18, NANOG, KLF1, KLF2, KLF4, KLF5, c-MYC, n-MYC, REM2, TERT and LIN28.
- a biopsy or aspirate of a subject’s bone marrow can be performed.
- a biopsy or aspirate is a sample of tissue or fluid taken from the body.
- biopsies or aspirates There are many different kinds of biopsies or aspirates. Nearly all of them involve using a sharp tool to remove a small amount of tissue. If the biopsy will be on the skin or other sensitive area, numbing medicine can be applied first.
- a biopsy or aspirate can be performed according to any of the known methods in the art. For example, in a bone marrow aspirate, a large needle is used to enter the pelvis bone to collect bone marrow.
- a mesenchymal stem cell can be isolated from a subject.
- Mesenchymal stem cells can be isolated according to any method known in the art, such as from a subject’s bone marrow or peripheral blood.
- marrow aspirate can be collected into a syringe with heparin.
- Cells can be washed and centrifuged on a PercollTM density gradient.
- Cells, such as blood cells, liver cells, interstitial cells, macrophages, mast cells, and thymocytes can be separated using density gradient centrifugation media, PercollTM.
- the cells can then be cultured in Dulbecco's modified Eagle's medium (DMEM) (low glucose) containing 10% fetal bovine serum (FBS) (Pittinger et.
- DMEM Dulbecco's modified Eagle's medium
- FBS fetal bovine serum
- the methods of the present disclosure can also comprise differentiating genome-edited iPSCs into photoreceptor cells or retinal progenitor cells.
- the differentiating step may be performed according to any method known in the art.
- iPSCs can be used to generate retinal organioids and photoreceptors as described in the art (Phillips et al. , 2014, Stem Cells, 32(6): pgs. 1480-1492; Zhong etal., 2014, Nat. Commun., 5:4047; Tucker et al., 2011, PLoS One, 6(4): e18992).
- hiPSC can be differentiated into retinal progenitor cells using various treatments, including Wnt, Nodal, and Notch pathway inhibitors (Noggin, Dkl, Lefty A, and DAPT) and other growth factors.
- the retinal progenitor cells can be further differentiated into photoreceptor cells, the treatment including: exposure to native retinal cells in coculture systems, RX+ or Mitf+ by subsequent treatment with retinoic acid and taurine, or exposure to several exogenous factors including Noggin, Dkkl, DAPT, and insulin-like growth factor (Yang et al., 2016, Stem Cells International 2016).
- the methods of the present disclosure can also comprise differentiating the genome- edited mesenchymal stem cells into photoreceptor cells or retinal progenitor cells.
- the differentiating step can be performed according to any method known in the art.
- the methods of the present disclosure can also comprise implanting the photoreceptor cells or retinal progenitor cells into a subject.
- This implanting step can be accomplished using any method of implantation known in the art.
- cells can be injected directly in the subject’s blood or otherwise administered to the subject.
- Another aspect of the methods can include implanting edited photoreceptor cells or retinal progenitor cells into a subject.
- the implanting step can be accomplished using any method of implantation known in the art.
- the genetically modified cells can be injected directly in the subject’s eye or otherwise administered to the patient.
- High-fidelity SpCas9 mutants were generated by site directed mutagenesis starting from the wt SpCas9 expression plasmid. All sgRNAs were expressed from a pUC19 plasmid containing U6-driven Pol III expression cassettes (pUC19-sgRNA). The spacer sequences of the sgRNAs and the oligonucleotides used to generate the expression constructs are reported in Table 5.
- Spacers were cloned as annealed oligonucleotides into a double Bbsl site of the pUC19-sgRNA plasmids containing the corresponding constant sgRNA region for SpCas9.
- RHO human rhodopsin
- This plasmid was further modified by site-directed mutagenesis to substitute the rs7984A allele in the 5’-UTR with the minor G allele (oligonucleotides Mut- rs7984G-F and Mut-rs7984G-R) and to introduce the P23H (oligonucleotides Mut-P23H-F and Mut-P23H-R) or P347L (oligonucleotides Mut-P347L-F and Mut-P347L-R) mutations, generating the pCMV_TO-RHO-P347L and pCMV_TO-RHO-P347L plasmids. These vectors contained an hygromycin selection marker.
- HEK293T/17 and HEK293 cells were obtained from ATCC.
- HEK293TetO cells were generated by stable transduction of parental HEK293 cells with a lentiviral vector expressing the tetracycline repressor (TetR) and were selected using blasticidin.
- TetR tetracycline repressor
- HEK293-TetP23H and HEK293-TetP347L cells expressing the two RHO mutants under a doxycycline-inducible promoter, were generated by stable transfection of parental HEK293TetO cells.
- Transduced cells were pool-selected with 5 mg/ml of hygromycin (Invivogen) and single clones with a unique integrated transgene copy were selected for following studies. All cells were cultured in a 37°C incubator with 5% CO2 using DMEM supplemented with 10% fetal bovine serum (FBS, Life Technologies), 2 mM L-Glutamine (Life Technologies), 10 U/ml penicillin and 10 mg/ml streptomycin (Life Technologies) and hygromycin and/or blasticidin as indicated above, when needed. All cell lines were verified mycoplasma-free (PlasmoTest, Invivogen).
- Genomic DNA was extracted from cell pellets using the QuickExtract solution (Lucigen) according to manufacturer’s instructions.
- the HOT FIREPol Multiplex Mix (Solis Biodyne) was used to amplify the endogenous RHO rs7984 locus using primers RH05end_endo-F and RH05end_endo-R (reported in Table 7) and the integrated mutated RHO using primers RH05end_Tg-F and RH05end_Tg-R (reported in Table 7), specifically detecting the integrated RHO gene.
- the amplicon pools were run on 1% agarose gel and Sanger sequenced (EasyRun service, Microsynth) using RH05end_endo-R for sequencing of the endogenous locus and either RH05end_Tg-R or RH05end_Tg_int_R (reported in Table 7) for sequencing of the integrated RHO gene.
- Indel levels were evaluated using either the TIDE (shinyapps.datacurators.nl/tide/), DECODR (decodr.org/) or the Synthego ICE (ice.synthego.com) webtools.
- RT-qPCR was performed with primers reported in Table 8 using the HOT FIREPol EvaGreen qPCR Supermix and the CFX96 detection system (Bio-Rad). Data were normalized on the expression of the reference gene GAPDH according to the AACt method.
- the membranes were incubated with mouse anti-Rhodopsin clone 4D2 antibody (MABN15, Sigma-Aldrich, dilution 1:500) or anti-Rhodopsin clone 1D4 antibody (sc-57432, Santa-Cruz Biotechnologies, dilution 1:1,000)and mouse anti-GAPDH 6C5 (sc-32233 Santa Cruz Biotechnology, dilution 1:4,000) and with the HRP conjugated mouse IgGK binding protein (sc-516102, Santa Cruz Biotechnology, 1:5,000) for ECL detection. Images were acquired using the UVItec Alliance detection system.
- Example 1 Design of a mutation-independent genome editing strategy to target mutated RHO in autosomal dominant retinitis pigmentosa
- the rs7984 SNP satisfies these requirements as it is located in the first exon of the RHO transcript (5’UTR) and its minor allele has a global frequency close to 0.28 as reported by the ALFA project on dbSNP (www.ncbi.nlm. nih.gov/snp/rs7984#frequency_tab).
- rs7984 falls outside the coding sequence of RHO (5’UTR)
- CRISPR nucleases in order to knock-out protein expression using CRISPR nucleases a strategy exploiting two different DNA cleavages to generate a deletion in the gene needs to be designed.
- the inventors have devised an approach which uses a first allele-specific cleavage at the level of the rs7984 SNP to select which of the two RHO alleles is inactivated and a second bi-allelic cut in a suitable position of RHO intron 1 (FIG. 1).
- This generates an allele-specific deletion that removes the majority of RHO exon 1, including the ATG translation start site, and should effectively knock-out mutant RHO expression sparing the wt RHO allele, as cleavage in selected positions of intron 1 should not have any detrimental consequences on protein expression.
- sgRNAs targeting the rs7984 SNP were designed. A clear requirement for those guides is that their spacer sequences span the rs7984 locus. Two sgRNAs meeting this requirement were identified (sg7984A/G-mm1 and sg7984A/G-mm14), as reported in FIG. 2A.
- sgRNAs targeting RHO intron 1 were designed. In order to limit the dimension of the deletion produced by the two cleavages ( ⁇ 1000bp), sgRNAs were designed considering approximately only the first 600bp of intron 1. In addition, to ensure maximum compatibility with high-fidelity SpCas9 variants, only spacers starting with a 5’-G, which are optimal for U6-driven Pol III transcription, were included. Selected guides are shown in FIG. 2B
- Example 2 rs7984 allele-specific targeting [0231]
- the editing activity of the two designed sgRNAs was evaluated in combination with wt SpCas9 against the endogenous RHO locus in HEK293T cells, which are homozygous for the rs7984A allele (FIG. 3A).
- sg7984A-mm1 guide two different designs were evaluated, one in which a 5’-G is appended to the spacer increasing its length to 21 nt (sg7984A-mm1-20G) and another in which the twentieth spacer nucleotide (counting from the PAM-side) was substituted with a non-matching G (sg7984A-mm1-19G). Both 5’-Gs were introduced to allow efficient Pol III transcription from a canonical U6 promoter. As shown in FIG. 3A, the sg7984A-mm14 sgRNA greatly outperformed both designs of the comparator sgRNA, demonstrating approximately twice the amount of indel formation.
- the allele-specificity of the candidate sgRNAs was evaluated in combination with wt SpCas9 by targeting the RHO locus in HEK293T cells using alternative versions of the guides perfectly matching the G allele of the rs7984 SNP, which is absent in the cell line genome. None of the evaluated combinations showed allele-specific editing, as wt SpCas9 was able to proficiently cleave the endogenous target even when using the mismatch-containing sgRNAs (FIG. 3B). [0232] Given its surprisingly superior editing activity, the sg7984A/G-mm14 guide design was selected for further studies.
- this spacer natively starts with a 5’-G which makes it fully compatible with high-fidelity SpCas9 variants, that when transcribed from a U6 promoter generally prefer a matching 5’-G at the beginning of the spacer sequence (Casini et ai, 2018, Nat. Biotechnol.; Kulcsar et ai, 2020, Nat. comms.). This is not the case for the sg7984A/G- mm1 guide RNA design.
- the sg7984A/G-mm14 was then evaluated for editing activity and allele-specificity in combination with a wide panel of SpCas9 variants characterized by increased editing specificity.
- the mutations included in each of the high-fidelity SpCas9 variants evaluated are reported in Table 4.
- a surrogate off- target model was used, where each SpCas9 variant was evaluated for indel formation at the endogenous RHO locus in HEK293T cells in combination with a guide RNA perfectly matching the G allele of the rs7984 SNP, which is absent in the cell’s genome. As shown in FIG.
- the modification in position 20 corresponds to a transition from G to A since it has been reported (Gao et a!., 2017, Transcription) that Pol III can initiate transcription from this nucleotide in the context of a U6 promoter.
- the sgRNA with a synthetic mismatch in position 20 was selected for further characterization.
- Example 3 sgRNAs targeting RHO intron 1 [0238] The generation of a genomic deletion at the 5’-end of the gene to knock-out mutant RHO expression requires simultaneous targeting of the locus using two different sgRNAs.
- the first guide sg7984A/G-mm14 and sg7984A/G-mm 14+20, characterized in detail above, should target the rs7984 SNP in an allele-specific manner; the second sgRNA should be selected among those targeting RHO intron 1 and should promote a bi-allelic cut in both RHO gene copies.
- sgRNAs targeting RHO intron 1 at a maximum distance of approximately 1 kb from the rs7984 SNP locus were designed using the CRISPOR web tool (crispor.tefor.net).
- the list of possible hits was reduced to 16 candidates by using the following criteria: the 5’-end nucleotide of the spacer should be a G, in order to increase the compatibility with high-fidelity SpCas9 variants; the guide should have a favorable profile in terms of off-targets as predicted by CRISPOR.
- the list of selected guides is reported in Table 5.
- the selected guides were evaluated for editing activity in combination with wt SpCas9 by transient transfection in HEK293 cells having stably integrated a single copy of the P347L/rs7984G (characterized by the P347L mutation and the G allele of the rs7984 SNP) RHO gene under the control of a tetracycline-inducible promoter (HEK293-TetP347L).
- HEK293-TetP347L tetracycline-inducible promoter
- SpCas9, ESN or DQNV together with the intron-targeting guide (sg189fw) and the corresponding sgRNA to target the rs7984 SNP alleles (sg7984A/G-mm 14+20 for ESN and sg7984A/G-mm14 for wt SpCas9 and DQNV), either alone or in combination.
- Deletion formation was evaluated by end-point PCR and agarose gel electrophoresis using primers specific for minigene amplification. While the deletion was readily detected in all samples transfected with both intron- and SNP-targeting sgRNAs, no product was detected when using single guides, as expected (FIG. 7A).
- Intracellular RHO P23H protein levels were then measured by Western blot after transfection of HEK293-TetP23H cells with wt SpCas9, the DQNV or the ESN variant together with the intron-targeting sgRNA sg189fw and the guides directed towards the rs7984 SNP alleles (A/G) either alone or in combination. Consistently with mRNA downregulation data, decrease in RHO P23H protein levels were observed in association with deletion formation through the dual-guide strategy (FIG. 7C). As before, RHO P23H protein reduction was allele- specific only when cells were treated with the high-fidelity SpCas9 variants DQNV and ESN.
- the inversion was detected at the integrated minigene when using sgRNAs targeting the rs7984G allele and at the endogenous RHO locus with the other set of guides directed towards rs7984A, as expected (FIG. 9B-C).
- wt SpCas9 was not able to discriminate among the endogenous and minigene targets with either of the sg7984A/G-mm14 guide RNAs, producing inversions at both loci with all the evaluated guides (FIGS. 9B-9C).
- GUIDE-seq was used to evaluate the genome-wide specificity of ESN, EMN, and DQNV SpCas9 variants.
- SpCas9 was used as a benchmark
- This Example was performed using wt HEK293T cells (homozygous for the rs7984A allele).
- Genome-wide off-targets were evaluated using the GUIDE-seq protocol (Tsai et ai, 2015, Nature Biotechnology 33:187-195) with some modifications (Casini etai, 2018, Nature Biotechnology 36:265-271). Briefly, 2x10 5 HEK293T cells were seeded in a 24-well plate the day before transfection.
- Cells were then transfected with 750 ng of each Cas9 together with 250 ng of the corresponding pUC-sgRNA plasmids, 10 pmol of bait dsODN (sequence reported in the cited publications) and 50 ng of a pEGFP-IRES-Puro plasmid, expressing the EGFP reporter and a puromycin resistance marker, using Lipofectamine 3000 (Thermo Scientific) according to manufacturer’s instructions.
- the day after transfection cells were detached and seeded in a 12-well plate under puromycin selection (1 pg/ml, Invivogen) in order to enrich for transfected cells and enhance off-target detection.
- Genomic DNA was then extracted using the Nucleospin Tissue kit (Macherey-Nagel) and libraries were prepared and sequenced according to previously published protocols (Tsai et al., 2015, Nature Biotechnology 33:187-195). A maximum of 5 different libraries were loaded on a single lllumina Miseq Reagent kit v2 - 300 cycles flow cell. Raw sequencing data were analyzed using an available dedicated computational pipeline (Tsai et al. , 2016, Nature Biotechnology 34:483).
- a panel of three candidate sgRNA-nuclease couples namely DQNV+sg7984A/G- mm14, ESN+sg7984A/G-mm14 and ESN+sg7984A/G-mm 14+20, were investigated for their genome-wide specificity profile using GUIDE-seq (Tsai et al., 2015, Nature Biotechnology 33:187-195) in order to exclude possible unwanted damage to the cell genome upon editing the RHO locus.
- the GUIDE-seq protocol allows tagging of genomic sites cleaved by SpCas9 in living cells in vitro for subsequent identification by NGS. This allows the unbiased detection of genomic loci which are targeted non-specifically, together with the intended target site.
- HEK293T cells were used (homozygous for the rs7984A allele) to generate GUIDE-seq profiles for the sg189fw, sg7984A/G-mm14 and sg7984A/Gmm 14+20 sgRNAs in combination with the three aforementioned high-fidelity SpCas9 variants (ESN, EMN, DQNV). Wt SpCas9 was evaluated in parallel to determine the baseline of off-target generation in combination with the all the sgRNAs.
- GUIDE-seq read counts below 20-30
- GUIDE-seq read counts below 20-30
- the majority of the detected sites were characterized by very low GUIDE-seq read counts (below 20-30), which generally correspond to the background noise associated to the assay without translating into measurable off-target editing in the cellular genome (Tsai etal., 2015, Nature Biotechnology 33:187-195; Maeder et al., 2019, Nat Med 25:229-233).
- Example 6 Targeting RHO rs7984 SNP with AAV vectors [0257] AAV vectors were constructed to deliver SpCas9 variants and sgRNAs to cells and introduce deletions in the target RHO gene. 7.1.7.1. Materials and Methods
- a dual AAV vector system was constructed to allow expression in target cells of the high-fidelity SpCas9 variants ESN and DQNV as well as of the two sgRNAs necessary to introduce deletions in the target RHO gene containing the pathogenic mutation of interest (sg7984G-mm14 and sg189fw). For these latter vectors two different design were evaluated which are different only for the orientation of one of the two sgRNA expression cassettes (the one expressing the sg189fw guide). A schematic representation of the viral vector genomes is reported in FIG. 11 A. All the reported vectors were obtained using standard restriction-based cloning techniques.
- AAV2 viral particles packaging the different genomes were produced and used to transduce HEK293-TetP23H cells: AAV2-ESN and AAV2-DGNV were each used in combination with AAV2-ATX001 and AAV2-ATX005, corresponding to two different designs of vectors expressing the guide RNAs of interest (see FIG. 11 A). Cells were then collected at 6 days post-transduction for the evaluation of deletion formation at the level of the target RHO gene by endpoint PCR. As shown in FIG.
- both the ESN and the DGNV variants were able to produce appreciable levels of deletion formation in RHO when delivered in combination with both sgRNA-expressing vectors (AAV2-ATX001 and AAV2-ATX005), independently of the design of the latter.
- 10 5 HEK293T cells were transfected in 96-well plates with 200 ng of an empty plasmid (pcDNA3), or expression vectors for RHO WT, RHO P23H or a RHO minigene containing a 560bp long deletion, corresponding to the most frequent editing outcome produced by the evaluated genome editing strategy (see Example 4) using the TranslT-LT1 transfection reagent (Mirus Bio), according to manufacturer’s instructions. Cells were collected 3 days after transfection to evaluate cell viability using the CellTiter-Glo luminescent cell viability assay (Promega).
- HEK293T cells were transfected with different expression vectors encoding either RHO WT, RHO P23H or a deleted version of the RHO gene.
- This deleted version was generated using standard cloning techniques to mimic the most prevalent editing product obtained by the simultaneous targeting of the RHO sequence with the guides targeting the rs7984 SNP in combination with sg189fw. Given the nature of this edit (deletion of the majority of RHO exon 1, including the ATG initiation codon), it is expected to abolish protein expression and thus consequent toxicities.
- Cell vitality was evaluated by using a standardized commercial assay (CellTiter-Glo from Promega).
- a guide RNA molecule (gRNA) for editing a human RHO gene comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence, wherein the reference sequence is: a) GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2); b) a sequence having one or two mismatches with the sequence GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2); c) CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3); d) a sequence having one or two mismatches with the sequence CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3); e) UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4); or f) a sequence having one or two mismatches with the sequence UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4); wherein R is A or G.
- the gRNA of embodiment 1 which comprises a spacer that is 15 to 30 nucleotides in length.
- the gRNA of embodiment 2 wherein the spacer is 25 nucleotides in length. 18. The gRNA of any one of embodiments 1 to 17, wherein the spacer comprises 16 or more consecutive nucleotides of the reference sequence.
- gRNA of any one of embodiments 1 to 23, wherein the reference sequence is GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2).
- gRNA of any one of embodiments 1 to 23, wherein the reference sequence is CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3).
- gRNA of any one of embodiments 1 to 23, wherein the reference sequence is UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4).
- nucleotide sequence of the spacer is GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2).
- nucleotide sequence of the spacer is ACAGCCRCGGGUCAGCCACA (SEQ ID NO:7).
- gRNA of embodiment 1 wherein the nucleotide sequence of the spacer is CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3).
- gRNA of embodiment 1 wherein the nucleotide sequence of the spacer is GCAGCCRCGGGUCAGCCACAA (SEQ ID NO:229).
- gRNA of embodiment 1 wherein the nucleotide sequence of the spacer is UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4).
- gRNA of embodiment 1 wherein the nucleotide sequence of the spacer is GCUUGGGUGGGAGCAGCCRC (SEQ ID NO:230).
- the gRNA of any one of embodiments 1 to 43 which is a Cas9 gRNA.
- the gRNA of embodiment 44 which is a Streptococcus pyogenes Cas9
- gRNA of any one of embodiments 1 to 45 which is a single guide RNA (sgRNA).
- the gRNA of embodiment 46 which comprises a 3’ sgRNA segment.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 1 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 2 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 3 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 4 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 5 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 6 as set forth in Table 3. 55. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 7 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 12 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 14 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 15 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 16 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 17 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 21 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 22 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 24 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 25 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 27 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 29 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 30 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 31 as set forth in Table 3.
- the gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 32 as set forth in Table 3.
- the gRNA of embodiment 81 wherein the 3’ sgRNA segment comprises eight uracils at its 3’ end.
- gRNA of any one of embodiments 1 to 90 which comprises one or more modifications.
- nucleic acid of embodiment 94 which further comprises a Pol III promoter sequence operably linked to the nucleotide sequence encoding the gRNA.
- nucleic acid of any one of embodiments 94 to 97 which further encodes a second gRNA.
- nucleic acid of embodiment 98 or embodiment 99 which further comprises a
- Pol III promoter sequence operably linked to the nucleotide sequence encoding the second gRNA.
- nucleic acid of embodiment 100, wherein the promoter sequence operably linked to the nucleotide sequence encoding the second gRNA is a U6 promoter sequence.
- nucleic acid of embodiment 100, wherein the promoter sequence operably linked to the nucleotide sequence encoding the second gRNA is a H1 promoter sequence.
- nucleic acid of embodiment 103, wherein the second gRNA comprises a spacer sequence that is partially or fully complementary to a target sequence in intron 1 of a human RHO gene.
- the spacer sequence of the second gRNA comprises 15 or more consecutive nucleotides of a reference sequence, wherein the reference sequence is: a) GCCGGGCUGCUGUUUGUGCA (SEQ ID NO:27); b) GCAGGAGCCCGGGAGCAUGG (SEQ ID NO:24); c) GUCUGGGAGAGUCCCGGGCU (SEQ ID NO:25); d) GAGAGUCCCGGGCUUGGCGG (SEQ ID NO:26); e) GCCCUGCUGGGGCGUCACAC (SEQ ID NO:28); f) GGACGGGUGCAGAGUUGAGU (SEQ ID NO:29); g) GUGCUGAGUCAGACCCAGGC (SEQ ID NQ:30); h) GCAAUGGGCUCGGUCCCCUC (SEQ ID NO:31); i) GUAUGAGCCGGGUGUGGGUG (SEQ ID NO:32); j) GCUUGGCGGUG
- nucleic acid of embodiment 105 wherein the nucleotide sequence of the spacer comprises 16 or more consecutive nucleotides from the reference sequence.
- nucleic acid of embodiment 105 wherein the nucleotide sequence of the spacer comprises 17 or more consecutive nucleotides from the reference sequence.
- nucleic acid of embodiment 105, wherein the nucleotide sequence of the spacer comprises 18 or more consecutive nucleotides from the reference sequence.
- nucleic acid of embodiment 105, wherein the nucleotide sequence of the spacer comprises 19 or more consecutive nucleotides from the reference sequence.
- nucleic acid of embodiment 105, wherein the nucleotide sequence of the spacer comprises the reference sequence.
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCCGGGCUGCUGUUUGUGCA (SEQ ID NO:27).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCAGGAGCCCGGGAGCAUGG (SEQ ID NO:24).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GUCUGGGAGAGUCCCGGGCU (SEQ ID NO:25).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GAGAGUCCCGGGCUUGGCGG (SEQ ID NO:26).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCCCUGCUGGGGCGUCACAC (SEQ ID NO:28).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GGACGGGUGCAGAGUUGAGU (SEQ ID NO:29).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GUGCUGAGUCAGACCCAGGC (SEQ ID NO:30).
- nucleic acid of any one of embodiments 105 to 110 wherein the reference sequence is GCAAUGGGCUCGGUCCCCUC (SEQ ID NO:31).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GUAUGAGCCGGGUGUGGGUG (SEQ ID NO:32).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCUUGGCGGUGGUGGCUGAG (SEQ ID NO:33).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GGGCUUUGGAUAACAUUGAC (SEQ ID NO:34).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GACUGAAUAUAUGAGGGCUU (SEQ ID NO:35).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCCCUGCACAAACAGCAGCC (SEQ ID NO:36).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCUGGGGCGUCACACAGGGA (SEQ ID NO:37).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GAGGCUUGGUGCUGCAAACA (SEQ ID NO:38).
- nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCCAGACCCCUCCUCUCUGG (SEQ ID NO:39).
- nucleic acid of any one of embodiments 94 to 126, wherein the nucleic acid is a viral genome is a viral genome.
- nucleic acid of embodiment 128, wherein the viral genome is an adeno- associated virus (AAV) genome.
- AAV adeno- associated virus
- nucleic acid of embodiment 129, wherein the viral genome is a AAV2 genome.
- nucleic acid of embodiment 129, wherein the viral genome is a AAV5 genome.
- nucleic acid of embodiment 129, wherein the viral genome is a AAV7m8 genome.
- nucleic acid of embodiment 129, wherein the viral genome is a AAV8 genome.
- a particle comprising the gRNA of any one of embodiments 1 to 93 or the nucleic acid of any one of embodiments 94 to 133.
- the particle of embodiment 134, wherein the particle is a viral particle, a lipid nanoparticle, a vesicle, or a gold nanoparticle.
- the particle of embodiment 135, wherein the particle is an adeno-associated virus (AAV) particle.
- AAV adeno-associated virus
- the particle of embodiment 137 which is a AAV2 particle.
- the particle of embodiment 137 which is a AAV5 particle.
- the particle of embodiment 137 which is a AAV7m8 particle.
- invention 137 which is a AAV8 particle.
- a plurality of particles comprising a first particle according to any one of embodiments 127 to 141 and a second particle comprising a nucleic acid encoding a Cas9 protein, optionally wherein the first particle and second particle are in a single container or wherein the first particle is in a first container and the second particle is in a second container.
- the plurality of particles of embodiment 143, wherein the promoter is an EF1 alpha promoter, e.g., an EF1 alpha short (EFS) promoter.
- the promoter is an EF1 alpha promoter, e.g., an EF1 alpha short (EFS) promoter.
- the plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526E, and R661W mutations.
- the plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526E, and R661Y mutations.
- AAV adeno-associated virus
- a plurality of nucleic acids comprising a first nucleic acid according to any one of embodiments 94 to 133 and a second nucleic acid encoding a Cas9 protein optionally wherein the first nucleic acid and second nucleic acid are in a single container or wherein the first nucleic acid is in a first container and the second nucleic acid is in a second container.
- a system comprising a Cas9 protein and the gRNA of any one of embodiments 1 to 93.
- a pharmaceutical composition comprising (i) the gRNA of any one of embodiments 1 to 93, the nucleic acid of any one of embodiments 94 to 133, the particle of any one of embodiments 134 to 141, the plurality of particles of any one of embodiments 142 to 198, the plurality of nucleic acids of any one of embodiments 199 to 200, or the system of any one of embodiments 201 to 204 and (ii) a pharmaceutically acceptable excipient.
- a cell comprising the gRNA of any one of embodiments 1 to 93.
- a cell comprising the nucleic acid of any one of embodiments 94 to 133.
- a cell comprising the particle of any one of embodiments 134 to 141.
- a cell comprising the plurality of particles of any one of embodiments 142 to 198.
- a cell comprising the plurality of nucleic acids of any one of embodiments 199 to
- a cell comprising the system of any one of embodiments 201 to 204.
- the cell of any one of embodiments 206 to 211 which is a human cell.
- the cell of embodiment 212 which is a human retinal cell.
- the cell of embodiment 212 which is a human retinal epithelial cell.
- the cell of embodiment 212 which is a human photoreceptor cell.
- the cell of embodiment 212 which is a human retinal progenitor cell.
- the cell of embodiment 212 which is a stem cell.
- the cell of embodiment 212 which is an iPS cell.
- the cell of embodiment 212 which is a HEK293T cell.
- invention 220 The cell of embodiment 219, which is a HEK293T/17 cell.
- the cell of any one of embodiments 206 to 220 which is an ex vivo cell.
- a population of cells according to any one of embodiments 206 to 221.
- a method of altering a human cell comprising a RHO allele having a pathogenic mutation comprising contacting the cell with the gRNA of any one of embodiments 1 to 93, the nucleic acid of any one of embodiments 94 to 133, the particle of any one of embodiments 134 to 141, the plurality of nucleic acids of any one of embodiments 142 to 198, the plurality of nucleic acids of any one of embodiments 199 to 200, the system of any one of embodiments 201 to 204, or the pharmaceutical composition of embodiment 205.
- a method of altering a human cell comprising a RHO allele having a pathogenic mutation and which is heterozygous for the rs7984 SNP comprising contacting the cell with the gRNA of any one of embodiments 1 to 93, the nucleic acid of any one of embodiments 94 to 133, the particle of any one of embodiments 134 to 141, the plurality of nucleic acids of any one of embodiments 142 to 198, the plurality of nucleic acids of any one of embodiments 199 to 200, the system of any one of embodiments 201 to 204 or the pharmaceutical composition of embodiment 205, provided that R is A when the RHO allele having the pathogenic mutation has an A at the nucleotide position corresponding to rs7984 SNP and R is G when the RHO allele having the pathogenic mutation has a G at nucleotide position corresponding to the rs7984 SNP.
- P347 mutation is a P347L mutation, a P347S mutation, a P347R mutation, a P347Q mutation, a P347T mutation, or a
- the one or more viral vectors comprise an adeno-associated virus (AAV), a lentivirus, or an adenovirus.
- AAV adeno-associated virus
- the one or more viral vectors comprise an adeno-associated virus (AAV).
- AAV adeno-associated virus
- the one or more viral vectors comprise one or more AAV2, AAV5, AAV7m8, or AAV8 vectors.
- the one or more viral vectors comprise a first AAV vector encoding the Cas9 protein and a second AAV vector encoding the gRNA(s).
- nucleic acid encoding the gRNA(s) is/are operably linker to a Pol III promoter.
- nucleic acid encoding the Cas9 protein is operably linked to a promoter, which is optionally a tissue specific promoter.
- invention 300 which further comprises a step of genotyping the subject to determine which allele of the rs7984 SNP is in phase with the pathogenic mutation.
- the method of embodiment 305, wherein the contacting comprises delivering the gRNA, nucleic acid, plurality of nucleic acids, particle, plurality of particles, system, or pharmaceutical composition to the eye by sub-retinal injection.
- a guide RNA molecule (gRNA) for editing a RHO gene comprising a spacer whose nucleic acid sequence comprises 15 or more consecutive nucleotides from a reference sequence or comprises a nucleotide sequence that is at least 85% identical to a reference sequence, wherein the reference sequence is: a) GCCGGGCUGCUGUUUGUGCA (SEQ ID NO:27); b) GCAGGAGCCCGGGAGCAUGG (SEQ ID NO:24); c) GUCUGGGAGAGUCCCGGGCU (SEQ ID NO:25); d) GAGAGUCCCGGGCUUGGCGG (SEQ ID NO:26); e) GCCCUGCUGGGGCGUCACAC (SEQ ID NO:28); f) GGACGGGUGCAGAGUUGAGU (SEQ ID NO:29); g) GUGCUGAGUCAGACCCAGGC (SEQ ID NO:30); h) GCAAUGGGCUCGGUCCCCUC (SEQ ID N0
- gRNA of embodiment 308, wherein the spacer comprises a nucleotide sequence that is at least 85% identical to the reference sequence.
- the gRNA of embodiment 308, wherein the spacer comprises a nucleotide sequence that is at least 90% identical to the reference sequence.
- the gRNA of embodiment 308, wherein the spacer comprises a nucleotide sequence that is at least 95% identical to the reference sequence.
- the gRNA of embodiment 308, wherein the spacer comprises a nucleotide sequence that has one mismatch relative to the reference sequence.
- gRNA of embodiment 308, wherein the spacer comprises a nucleotide sequence that has two mismatches relative to the reference sequence.
- nucleotide sequence of the spacer comprises 15 or more consecutive nucleotides from the reference sequence.
- the gRNA of embodiment 308, wherein the nucleotide sequence of the spacer comprises 16 or more consecutive nucleotides from the reference sequence.
- nucleotide sequence of the spacer comprises 17 or more consecutive nucleotides from the reference sequence.
- nucleotide sequence of the spacer comprises 18 or more consecutive nucleotides from the reference sequence. 318. The gRNA of embodiment 308, wherein the nucleotide sequence of the spacer comprises 19 or more consecutive nucleotides from the reference sequence.
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCCGGGCUGCUGUUUGUGCA (SEQ ID NO:27).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCAGGAGCCCGGGAGCAUGG (SEQ ID NO:24).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GUCUGGGAGAGUCCCGGGCU (SEQ ID NO:25).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GAGAGUCCCGGGCUUGGCGG (SEQ ID NO:26).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCCCUGCUGGGGCGUCACAC (SEQ ID NO:28).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GGACGGGUGCAGAGUUGAGU (SEQ ID NO:29).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GUGCUGAGUCAGACCCAGGC (SEQ ID NO:30).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCAAUGGGCUCGGUCCCCUC (SEQ ID NO:31).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GUAUGAGCCGGGUGUGGGUG (SEQ ID NO:32).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCUUGGCGGUGGUGGCUGAG (SEQ ID NO:33).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GGGCUUUGGAUAACAUUGAC (SEQ ID NO:34).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GACUGAAUAUAUGAGGGCUU (SEQ ID NO:35).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCCCUGCACAAACAGCAGCC (SEQ ID NO:36).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCUGGGGCGUCACACAGGGA (SEQ ID NO:37).
- gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GAGGCUUGGUGCUGCAAACA (SEQ ID NO:38).
- the gRNA of embodiment 336, wherein the spacer is 15 to 25 nucleotides in length.
- the gRNA of embodiment 336, wherein the spacer is 16 to 24 nucleotides in length.
- the gRNA of embodiment 336, wherein the spacer is 18 to 30 nucleotides in length.
- the gRNA of embodiment 336, wherein the spacer is 23 to 25 nucleotides in length.
- the gRNA of embodiment 336, wherein the spacer is 20 nucleotides in length.
- the gRNA of embodiment 336, wherein the spacer is 21 nucleotides in length.
- the gRNA of embodiment 336, wherein the spacer is 23 nucleotides in length.
- gRNA of embodiment 336, wherein the spacer is 24 nucleotides in length.
- the gRNA of any one of embodiments 308 to 351 which is a Cas9 gRNA.
- the gRNA of embodiment 352 which is a Streptococcus pyogenes Cas9 (SpCas9) gRNA.
- sgRNA single guide RNA
- the gRNA of embodiment 354 which comprises a 3’ sgRNA segment.
- the gRNA of embodiment 355, wherein the 3’ sgRNA segment has a nucleotide sequence comprising a sequence set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 1 as set forth in Table 3. 358. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 2 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 3 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 5 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 6 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 7 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 8 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 10 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 11 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 12 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 13 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 14 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 15 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 16 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 17 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 18 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 19 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 20 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 21 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 22 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 23 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 25 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 26 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 27 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 28 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 29 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 30 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 31 as set forth in Table 3.
- the gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 32 as set forth in Table 3.
- the gRNA of embodiment 389, wherein the 3’ sgRNA segment comprises three uracils at its 3’ end. 394. The gRNA of embodiment 389, wherein the 3’ sgRNA segment comprises four uracils at its 3’ end.
- gRNA of any one of embodiments 308 to 399 which comprises one or more modifications.
- the gRNA of embodiment 400, wherein the one or more modifications comprises one or more 2’-0-methyl phosphorothioate nucleotides.
- nucleic acid of embodiment 402 which further comprises a Pol III promoter sequence operably linked to the nucleotide sequence encoding the gRNA.
- nucleic acid of embodiment 403, wherein the promoter is a H1 promoter.
- a particle comprising the gRNA of any one of embodiments 308 to 401 or the nucleic acid of any one of embodiments 402 to 407.
- the particle of embodiment 408, wherein the particle is a viral particle, a lipid nanoparticle, a vesicle, or a gold nanoparticle.
- the particle of embodiment 410, wherein the particle is an adeno-associated virus (AAV) particle.
- AAV adeno-associated virus
- invention 411 which is a AAV2 particle.
- the particle of embodiment 411 which is a AAV5 particle.
- the particle of embodiment 411 which is a AAV7m8 particle.
- the particle of embodiment 411 which is a AAV8 particle. 416.
- a plurality of particles comprising a first particle according to any one of embodiments 408 to 415 and a second particle comprising a nucleic acid encoding a Cas9 protein.
- a modified Cas9 protein comprising one or more mutations, wherein the position of the one or more mutations is identified by reference to the amino acid numbering in an unmodified mature Streptococcus pyogenes Cas9 (SpCas9) as set forth in SEQ ID NO:1
- the modified Cas9 protein of embodiment 418 which comprises K526E and R661Q mutations.
- the modified Cas9 protein of embodiment 418 which comprises K526E and R661L mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526E, and R661S mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526E, and R661Q mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526E, and R661L mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526E, and R661D mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526E, and R661E mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526E, and R661F mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526E, and R661M mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526E, and R661W mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526E, and R661Y mutations. 452.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526E, and M495V mutations.
- the modified Cas9 protein of embodiment 418 which comprises M495V, K526E, R661Q, and H698Q mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526D, and R661Q mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526D, and R661L mutations.
- the modified Cas9 protein of embodiment 418 which comprises Y515N, K526D, and R661W mutations.
- the modified Cas9 protein of any one of embodiments 418 to 460 which is a modified S. pyogenes Cas9.
- modified Cas9 protein of any one of embodiments 418 to 461 wherein the amino acid sequence of the modified Cas9 protein comprises an amino acid sequence which is at least 90% identical to SEQ ID NO:1.
- modified Cas9 protein of any one of embodiments 418 to 461 wherein the amino acid sequence of the modified Cas9 protein comprises an amino acid sequence which is at least 95% identical to SEQ ID NO:1.
- modified Cas9 protein of any one of embodiments 418 to 461 wherein the amino acid sequence of the modified Cas9 protein comprises an amino acid sequence which is at least 97% identical to SEQ ID NO:1.
- modified Cas9 protein of any one of embodiments 418 to 461 wherein the amino acid sequence of the modified Cas9 protein comprises an amino acid sequence which is at least 99% identical to SEQ ID NO:1.
- the modified Cas9 protein of any one of embodiments 418 to 465 which is a modified S. pyogenes Cas9 orthologue.
- the modified Cas9 protein of embodiment 466, wherein the S. pyogenes Cas9 orthologue is S. aureus.
- the modified Cas9 protein of embodiment 466, wherein the S. pyogenes Cas9 orthologue is N. meningitides.
- a fusion protein comprising the modified Cas9 protein of any one of embodiments 418 to 469 fused to a second amino acid sequence.
- the fusion protein of embodiment 470, wherein the second amino acid sequence comprises a transcriptional activator, a transcriptional repressor, a histone-modifying protein, an integrase, or a recombinase.
- nucleic acid of embodiment 474 which is a plasmid.
- nucleic acid of embodiment 474 which is a viral genome.
- nucleic acid of embodiment 474, wherein the viral genome is an adeno- associated virus (AAV) genome.
- AAV adeno-associated virus
- AAV5, AAV7m8, or AAV8 genome AAV5, AAV7m8, or AAV8 genome.
- a particle comprising the modified Cas9 protein of any one of embodiments 418 to 469, the fusion protein of any one of embodiments 470 to 473 or the nucleic acid of any one of embodiments 474 to 478.
- the particle of embodiment 479, wherein the particle is a viral particle, a lipid nanoparticle, a vesicle, or a gold nanoparticle.
- AAV adeno-associated virus
- invention 483 The particle of embodiment 482, which is a AAV2 particle.
- a system comprising the modified Cas9 protein of any one of embodiments 418 to 469 or the fusion protein of any one of embodiments 470 to 473 and a gRNA.
- gRNA is a gRNA as described in any one of embodiments 1 to 93 and 308 to 401.
- a pharmaceutical composition comprising the gRNA of any one of embodiments 308 to 401 , the nucleic acid of any one of embodiments 402 to 407, the particle of any one of embodiments 408 to 415, the plurality of particles of any one of embodiments 416 to 417, the modified Cas9 protein of any one of embodiments 418 to 469, the fusion protein of any one of embodiments 470 to 473, the nucleic acid of any one of embodiments 474 to 478, the particle of any one of embodiments 479 to 486, or the system of any one of embodiments 487 to 489 and at least one pharmaceutically acceptable excipient.
- a cell comprising the gRNA of any one of embodiments 308 to 401.
- a cell comprising the nucleic acid of any one of embodiments 402 to 407.
- a cell comprising the particle of any one of embodiments 408 to 415.
- a cell comprising the plurality of particles of any one of embodiments 416 to 417.
- a cell comprising the modified Cas9 protein of any one of embodiments 418 to
- a cell comprising the fusion protein of any one of embodiments 470 to 473.
- a cell comprising the nucleic acid of any one of embodiments 474 to 478.
- a cell comprising the particle of any one of embodiments 479 to 486.
- a cell comprising the system of any one of embodiments 487 to 489.
- invention 500 which is a human retinal cell.
- the cell of embodiment 500 which is a human retinal epithelial cell.
- invention 500 which is a human photoreceptor cell.
- the cell of embodiment 500 which is a human retinal progenitor cell.
- the cell of embodiment 500 which is a stem cell.
- the cell of embodiment 500 which is an iPS cell.
- the cell of embodiment 500 which is a HEK293T cell.
- the cell of embodiment 500 which is a HEK293T/17 cell.
- the gRNA of embodiment 515 or embodiment 516 for use in combination with a Cas9 protein for use in a method of editing a human RHO allele optionally wherein the Cas9 protein is a Cas9 protein according to any one of embodiments 418 to 469, optionally wherein the method is a method according to any one of embodiments 223 to 307.
Abstract
Compositions and methods useful for altering RHO genes, for example guide (gRNA) molecules targeting a rs7984 SNP in a RHO gene, gRNA molecules targeting intron 1 of a RHO gene, Cas9 proteins, nucleic acids encoding gRNAs, nucleic acids encoding Cas9 proteins, particles, systems, and cells are provided.
Description
COMPOSITIONS AND METHODS FOR ALLELE SPECIFIC TREATMENT OF RETINITIS
PIGMENTOSA
1. CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the priority benefit of U.S. provisional application no. 63/220,876, filed July 12, 2021, the contents of which are incorporated herein in their entireties by reference thereto.
2. SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing XML which has been submitted electronically and is hereby incorporated by reference in its entirety. Said Sequence Listing XML, created on July 5, 2022, is named ALA-005WO_SL.xml and is 216,300 bytes in size.
3. BACKGROUND
[0003] Retinitis pigmentosa (RP) refers to a group of inherited diseases causing retinal degeneration. More than 60 genes have been identified that are associated with RP, some of which are autosomal recessive, autosomal dominant, orX-linked. In many cases, RP is caused by mutations in the RHO gene, which encodes the rhodopsin protein. Rhodopsin is an essential photopigment expressed in retinal rod photoreceptor cells that is responsible for the conversion of light stimuli into electrical signals in the first step of phototransduction. Rhodopsin is expressed as a light-sensitive G-protein-coupled receptor that consists of an opsin protein moiety bound to a retinal chromophore, and represents the main component of the disk membranes of rod photoreceptor cell outer segments. Misfolded rhodopsin can contribute to rod photoreceptor cell degeneration and death, and can ultimately lead to blindness.
[0004] RP caused by mutations in the RHO gene is typically caused by heterozygous, and rarely by homozygous, mutation in the RHO gene on chromosome 3q22. There are over one hundred naturally occurring mutations in the RHO gene that lead to autosomal dominant RP (adRP), including mutations of P23, R135, and P347. See, Dryja, et ai, 1990, N. Engl. J. Med. 323:1302-1307; Concepcion et ai, 2002, Vision Research, 42(4):417-426; Athanasiou etai, 2018, Prog Retin Eye Res. 62: 1-23. The use of CRISPR genome-editing for treating autosomal dominant RP caused by mutations at positions such as P23 and R135 has been proposed. See, WO 2019/102381 and WO 2018/009562. Methods of modifying autosomal dominant disease-related RHO genes using CRISPR technology in an allele specific manner by targeting single nucleotide polymorphisms (SNPs) found in RHO genes have also been proposed. See, WO 2019/183630. However, the allele-specificity of approaches described in WO 2019/183630 has been found to be poor.
[0005] Thus, there remains an unmet medical need for compositions and methods for treating autosomal dominant RP, and in particular treating autosomal dominant RP in an allele specific manner.
4. SUMMARY
[0006] The disclosure herein addresses needs in the art by providing compositions and methods useful for altering RHO genes having pathogenic mutations (for example, a mutation at P23, R135, or P347) in an allele specific manner. The disclosed compositions and methods are useful, for example, for cellular manipulations and subject treatments (e.g., of human subjects), particularly of RP subjects.
[0007] The inventors have surprisingly discovered that allele specific editing of human RHO alleles having pathogenic mutations can be achieved using particular guide RNA (gRNA) molecules targeting the rs7984 SNP located in the 5’ untranslated region (UTR) of the RHO gene. SNPs are very common in the human population, and a significant proportion of subjects are heterozygous for the rs7984 SNP. For a subject heterozygous for the rs7984 SNP and heterozygous for a pathogenic RHO gene mutation, allele specific editing of the RHO allele having the pathogenic mutation can be achieved through the use of a gRNA targeting the SNP variant found in the subject’s RHO allele having the pathogenic mutation. This allele-specific editing strategy, which does not directly target a specific pathogenic RHO gene mutation, advantageously allows editing of RHO genes having a variety of different pathogenic mutations. A rs7984 SNP targeting gRNA of the disclosure can be used in combination with a second gRNA targeting a second site in the RHO gene, for example a site in intron 1 , to promote two cuts in the RHO gene having the pathogenic mutation. Cleaving the RHO gene having the pathogenic mutation at two sites can promote a deletion in the RHO gene having the pathogenic mutation, which can result in reduced mutant RHO protein expression. The allele specific editing strategies described herein are illustrated in FIG. 1.
[0008] FIG. 1 schematically shows two alleles for a hypothetical subject. “Mutated Allele” represents the subject’s first copy of a gene, which has a pathogenic mutation. “WT Allele” represents the subject’s second copy of the gene, which does not have a pathogenic mutation. The Mutated Allele and WT Allele are heterozygous with respect to the rs7984 SNP. For example, for a subject whose Mutated Allele has “A” at the nucleotide position corresponding to the rs7984 SNP, a gRNA designed to target variant A of the SNP can be used to target a Cas9 protein to the Mutated Allele, allowing for allele-specific editing of the RHO allele having the pathogenic mutation. Conversely, for a subject whose Mutated Allele has “G” at the nucleotide position corresponding to the rs7984 SNP, a gRNA designed to target variant G of the SNP can be used to target a Cas9 protein to the Mutated Allele. A subject can be genotyped to
determine the phase between the subject’s rs7984 alleles and the pathogenic RHO mutation, with the results of the genotyping determining which SNP allele to target.
[0009] The inventors have designed rs7984 SNP targeting gRNAs that show unexpectedly high allele specificity, RHO intron 1 targeting gRNAs that show unexpectedly high editing efficiency, and new Cas9 protein variants that are able to cleave RHO genes with unexpectedly high allele specificity when used with rs7984 SNP targeting gRNAs and, optionally, RHO intron 1 targeting gRNAs described herein.
[0010] Accordingly, in one aspect, the disclosure provides guide RNA (gRNA) molecules, for example Cas9 gRNA molecules, targeting the rs7984 SNP in a human RHO gene. In some embodiments, the rs7984 SNP targeting gRNAs can comprise a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of the sequence GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2), CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3), or UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4), or a sequence having one or two mismatches with GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2),
CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3), or UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4), wherein R is A or G. The position of the nucleotide represented by “R” corresponds to the position of the rs7984 SNP. Thus, for example, if a subject heterozygous for a pathogenic RHO mutation is genotyped and found to be heterozygous for the rs7984 SNP, a gRNA can be selected to target the rs7984 SNP variant in phase with the pathogenic mutation, thereby allowing editing of the RHO allele having the pathogenic mutation with allele-specificity. For example, if the subject’s RHO allele having the pathogenic mutation has “A” at the nucleotide position corresponding to the rs7984 SNP, a gRNA can be selected where R is “A”. Conversely, if the subject’s RHO allele having the pathogenic mutation has “G” at the nucleotide position corresponding to the rs7984 SNP, a gRNA can be selected where R is “G”.
[0011] In further aspects, the disclosure provides gRNA molecules, for example Cas9 gRNA molecules, for targeting intron 1 of a human RHO gene. Intron 1 targeting gRNAs can be used, for example, in combination with a rs7984 SNP targeting gRNA of the disclosure and a Cas9 protein to edit (e.g., form a deletion in) a human RHO gene having a pathogenic mutation with allele specificity.
[0012] In further aspects, the disclosure provides Cas9 variant proteins. The inventors have discovered that certain Cas9 variants used in combination with gRNAs of the disclosure are particularly effective at preferentially cleaving and/or introducing deletions in a target human RHO gene over a non-target human RHO gene.
[0013] Exemplary features of the gRNAs of the disclosure are described in Section 6.2 and numbered embodiments 1 to 93 and 308 to 401, infra. Exemplary features of Cas9 proteins and
Cas9 protein variants are described in Section 6.3 and numbered embodiments 418 to 473, infra.
[0014] The disclosure further provides nucleic acids encoding gRNAs of the disclosure, nucleic acids encoding Cas9 proteins, pluralities of nucleic acids and host cells comprising the nucleic acids (including pluralities of nucleic acids) of the disclosure. Exemplary features of the nucleic acids and host cells are described in Section 6.4 and numbered embodiments 94 to 133, 402 to 407, and 474 to 478, infra.
[0015] The disclosure further provides systems, particles, and pluralities of particles containing gRNAs, Cas9 proteins, and nucleic acids of the disclosure. Exemplary systems, particles, and pluralities of particles are described in Section 6.5 and numbered embodiments 134 to 204, 408 to 417, and 479 to 489, infra.
[0016] The disclosure further provides pharmaceutical compositions comprising the gRNAs, Cas9 proteins, nucleic acids (including pluralities of nucleic acids), particles (including pluralities of particles), and systems the disclosure. Exemplary pharmaceutical compositions are described in Section 6.6 and numbered embodiments 205 and 490, infra.
[0017] The disclosure further provides cells (e.g., from a subject having a RHO gene with a pathogenic mutation) and populations of cells comprising the gRNAs, Cas9 proteins, nucleic acids (including pluralities of nucleic acids), particles (including pluralities of particles), and systems of the disclosure. Exemplary cells and populations of cells are described in Section 6.5 and numbered embodiments 206 to 222 and 491 to 510, infra.
[0018] The disclosure further provides methods of using the gRNAs, Cas9 proteins, nucleic acids (including pluralities of nucleic acids), systems, and particles (including pluralities of particles) of the disclosure for altering cells, for example a human cell having a RHO allele with a pathogenic mutation. Methods of the disclosure can be used, for example, to treat subjects having a RP caused by a pathogenic mutation in a RHO allele. Exemplary methods of altering cells are described in Section 6.7 and numbered embodiments 223 to 307, infra.
5. BRIEF DESCRIPTION OF THE FIGURES
[0019] FIG. 1: Schematic showing mutation-independent, allele-specific targeted inactivation of RHO in adRP using a CRISPR-Cas system. The schematic shows two alleles for a hypothetical subject heterozygous for the rs7984 SNP and heterozygous for a pathogenic RHO mutation. A gRNA targeting the rs7984 SNP can be used to edit the RHO allele having the pathogenic mutation with allele-specificity. The schematic is intended to be merely illustrative and is not to be construed as limiting any invention described herein to a particular mechanism.
[0020] FIGS. 2A-2B: Guide RNAs for the allele-specific targeting of the rs7984 SNP. FIG. 2A: Schematic representation of the RHO rs7984 locus genomic DNA sequence annotated with the
position of the guide RNAs for SpCas9 spanning the rs7984 SNP (indicated in bold, major A allele shown). The RHO ATG initiation codon is indicated shaded in gray. FIG. 2A discloses SEQ ID NO:232. FIG. 2B: Schematic representation of the location of candidate guide RNAs targeting the 5’-end of RHO intron 1 (first 600 bp are reported). The arrow at the end of each guide indicates the localization of the downstream PAM on the corresponding strand. FIG. 2B discloses SEQ ID NO:233.
[0021] FIGS 3A-3C: Evaluation of sgRNAs for allele-specific targeting of the RHO rs7984 SNP. Indel formation at the RHO rs7984A endogenous locus 3 days after transient transfection of HEK293T/17 cells with wt SpCas9 and three different sgRNAs targeting the rs7984A SNP sequence (FIG. 3A) or targeting either the rs7984 A or G allele (absent from the cellular genome and thus acting as a surrogate off-target model) (FIG. 3B), as indicated. FIG. 3C: Indel formation at the RHO rs7984A locus 3 days after transient transfection of HEK293T/17 cells with wt SpCas9 or high-fidelity SpCas9 variants together with either the sg7984A-mm14 (on- target) or sg7984G-mm14 (off-target) sgRNAs, as indicated. Data are presented as mean ± SEM for at least 2 biologically independent studies.
[0022] FIGS. 4A-4B: Evaluation of alternative sgRNAs to improve allele specificity at the RHO rs7984 locus. FIG. 4A: Indel formation measured 3 days after transient transfection of HEK293T/17 cells with the high-fidelity K526E SpCas9 mutant together with sg7984A-mm14 (targeting the rs7984A locus) or alternative sgRNAs based on sg7984A-mm14 but containing a synthetic mismatch with the target site along the spacer sequence each, as indicated. FIG. 4B: Indel formation measured 3 days after transient transfection of HEK293T/17 cells with SpCas9 wt or high-fidelity mutants in combination with the sg7984-mm14+20 sgRNA targeting the rs7984A (on-target) or G locus (off-target), as indicated in the graph. Data are presented as mean ± SEM for at least 2 biologically independent studies.
[0023] FIG. 5: Allele-specific gene editing of the rs7984 RHO SNP. Indel formation at the endogenous RHO rs7984A locus measured at 3 days after transient transfection of HEK293T/17 cells with wt SpCas9 or a selected panel of high performing high-fidelity SpCas9 variants together with sg7984A/G-mm14 or sg7984A/G-mm 14+20, as indicated. The rs7984A- targeting guide allows for measurement of on-target activity while the guide targeting the rs7984G measures the allele-specificity of each combination. Data are presented as mean ± SEM for n=3 biologically independent studies. Only indels reported as highly significant by the TIDE software were included in the calculations.
[0024] FIGS. 6A-6C: Evaluation of the activity and the safety of sgRNAs targeting RHO intron 1. FIG. 6A: Editing activity of sgRNAs targeting RHO intron 1 in combination with wt SpCas93 days after transient transfection of HEK293-TetP347L cells. FIGS. 6B-6C: RHO P347L mRNA levels measured by qPCR at 6 days post-transfection of HEK293-TetP347L cells with the
indicated sgRNAs targeting RHO intron 1 in combination with wt SpCas9. Data are presented as mean ± SEM for n=3 biologically independent studies.
[0025] FIGS. 7A-7C: Allele-specific downregulation of RHO P23H by 5’-end gene deletions. FIG. 7A: Evaluation of deletion formation by endpoint PCR after transient transfection of HEK293-TetP23H cells with the indicated SpCas9 variants and associated sgRNAs. The use of sgRNAs targeting the rs7984A allele allowed to evaluate the allele-specificity of the strategy. Genomic DNA was extracted 3 days post-transfection. Agarose gel from a representative study is shown. FIG. 7B: Effect of RHO targeting on its mRNA levels. Downregulation of RHO P23H mRNA evaluated by qPCR at 6 days after transient co-transfection of HEK293-TetP23H cells with wt SpCas9, the DQNV or ESN variants with sgRNAs targeting the rs7984 SNP (both alleles) or RHO intron 1 (sg189fw), either alone or in combination, as indicated on the graph. Data are presented as mean ± SEM for at least 3 biologically independent studies. *= p- value<0.05, ***= p-value <0.001. FIG. 7C:Evaluation of intracellular levels of RHO P23H by Western Blot at 6 days post-transfection of HEK293-TetP23H cells with wt SpCas9, the DQNV or ESN variants and sgRNAs targeting the rs7984 SNP or RHO intron 1 (sg189fw), either alone or in combination, as indicated in the panel. A representative blot image is shown.
[0026] FIGS. 8A-8C: Allele-specific downregulation of RHO P347L by 5’-end gene deletions. FIG. 8A: Evaluation of deletion formation by endpoint PCR after transient transfection of HEK293-TetP347L cells with the indicated SpCas9 variants and associated sgRNAs targeting the rs7984G allele and RHO intron 1. Genomic DNA was extracted 3 days post- transfection. Agarose gel from a representative study is shown. FIG. 8B: Effect of RHO targeting on its mRNA levels. Downregulation of RHO P347L mRNA evaluated by qPCR at 6 days after transient co-transfection of HEK293-TetP347L cells with wt SpCas9, the DQNV or ESN variants with sgRNAs targeting the rs7984G SNP or RHO intron 1 (sg189fw), either alone or in combination, as indicated on the graph. Data are presented as mean ± SEM for n=2 biologically independent studies. *= p-value<0.05, **= p-value <0.01 FIG. 8C: Evaluation of intracellular levels of RHO P347L by Western Blot at 6 days post-transfection of HEK293-TetP347L cells with wt SpCas9, the DQNV or ESN variants and sgRNAs targeting the rs7984G locus or RHO intron 1 (sg189fw), either alone or in combination, as indicated in the panel. A representative blot image is shown.
[0027] FIGS. 9A-9C: Evaluation of allele-specific inversions after dual-guide RHO targeting. FIG. 9A: Schematic representation of the inversion event reporting the primer-design strategy to detect this specific editing outcome. Primers are indicated by black arrows. Letters are used to indicate the polarity of the edited fragment. Inversion events at the RHO targeted locus were detected by endpoint PCR with dedicated primers for the integrated P23H RHO minigene (FIG. 9B) or the endogenous RHO locus (FIG 9C) 3 days after transient transfection of HEK293-
TetP23H cells with wt SpCas9, the DQNV or ESN variants together with guide RNA targeting the RHO locus (rs7984 SNP or intron 1), either alone or in combination, as indicated on the figure. A representative agarose gel is show for each set of samples.
[0028] FIG. 10: Validation of GUIDE-seq identified off-targets by amplicon sequencing. Editing levels at 9 off-target sites (OT1 to OT9) detected by GUIDE-seq in association with the ESN and EMN SpCas9 variants and the sg7984A/G-mm 14+20 sgRNAs were evaluated by targeted amplicon sequencing after transient transfection of HEK293T cells. The background level of modification of each target locus was also measured (control). For the EMN variant, data were collected only for OT1, OT5, OT7 and OT8 since no other off-targets were captured by GUIDE- seq for this variant. Data are presented as mean ± SEM for n³2 biologically independent studies.
[0029] FIGS. 11A-11B: In vitro validation of AAV vectors for allele-specific targeting of the RHO gene. FIG. 11 A: Schematic representation of the AAV vector genomes used in the in vitro validation studies to express the high-fidelity SpCas9 variants and the relative sgRNAs. FIG.
11 B: Deletion formation as detected by PCR amplification and agarose gel electrophoresis after transduction of HEK293-TetP23H cells with the indicated combinations of AAV vectors expressing each high-fidelity nuclease and its dedicated sgRNAs. A representative study is shown.
[0030] FIG. 12: Evaluation of the cellular toxicity of deleted RHO when expressed in HEK293T cells. The viability of HEK293T cells was evaluated after transfection with either wt RHO, RHO P23H or the RHO deletion product, which is the most common expected editing outcome of the editing strategy. Data reported as mean ± SEM for n=5 independed biological studies.
6. DETAILED DESCRIPTION
[0031] The disclosure provides guide RNA (gRNA) molecules, which in combination with DNA endonucleases, e.g., Cas9 proteins, can be used, for example, to edit a human RHO gene having a pathogenic mutation, for example in a cell of a subject having a RHO gene with a pathogenic mutation.
[0032] In one aspect, a gRNA of the disclosure comprises a spacer corresponding to a target domain in the genomic DNA sequence of a RHO gene that includes the nucleotide position corresponding to the rs7984 SNP. In other aspects, a gRNA of the disclosure comprises a spacer corresponding to a target domain in intron 1 of a RHO gene. Typically, the target domains of gRNAs of the disclosure are adjacent to or near a protospacer-adjacent motif (PAM) of a Cas9 protein. Exemplary features of gRNAs of the disclosure are described in Section 6.2.
[0033] The disclosure further provides Cas9 variant proteins. Exemplary Cas9 proteins of the disclosure, which can in some embodiments be used in conjunction with gRNAs of the disclosure, are described in Section 6.3.
[0034] The disclosure further provides nucleic acids encoding gRNAs of the disclosure, nucleic acids encoding Cas9 proteins, pluralities of nucleic acids and host cells containing the nucleic acids. Features of exemplary nucleic acids encoding gRNAs and Cas9 proteins and exemplary host cells are described in Section 6.4.
[0035] The disclosure further provides systems, particles, and cells containing gRNAs and nucleic acids of the disclosure. Exemplary systems, particles, and cells are described in Section 6.5.
[0036] The disclosure further provides pharmaceutical compositions comprising the gRNAs, nucleic acids, particles, and systems the disclosure. Exemplary pharmaceutical compositions are described in Section 6.6.
[0037] The disclosure further provides methods of using the gRNAs, nucleic acids, systems, particles, and pharmaceutical compositions of the disclosure for altering cells. Methods of the disclosure can be useful, for example, for treating a subject having RP caused a pathogenic mutation in the subject’s RHO gene. Exemplary methods of altering cells are described in Section 6.7.
[0038] Those skilled in the relevant art will recognize and appreciate that many changes can be made to the various embodiments described herein, while still obtaining the beneficial results of the present disclosure. It will also be apparent that some of the desired benefits of the present disclosure can be obtained by selecting some of the features of the present disclosure without utilizing other features. Accordingly, those who work in the art will recognize that many modifications and adaptations to the present disclosure are possible and can even be desirable in certain circumstances and are a part of the present disclosure. Thus, the following description is provided as illustrative of the principles of the present disclosure and not in limitation thereof.
6.1. Definitions
[0039] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention belongs. The following definitions are provided for the full understanding of terms used in this specification.
[0040] As used in the specification and claims, the singular form “a,” “an,” and “the” include plural references unless the context clearly dictates otherwise. For example, the term “an agent” includes a plurality of agents, including mixtures thereof.
[0041] A Cas9 protein refers to a wild-type or engineered Cas9 protein. Engineered Cas9 proteins can also be referred to as Cas9 variants. For the avoidance of doubt, any disclosure pertaining to a “Cas9” or “Cas9 protein” pertains to wild-type Cas9 proteins and Cas9 variants, unless the context dictates otherwise.
[0042] Identical or percent identity, in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI web site or the like). This definition also refers to, or may be applied to, the complement of a test sequence. The definition also includes sequences that have deletions and/or additions, as well as those that have substitutions. As described below, the preferred algorithms can account for gaps and the like. Preferably, identity exists over a region that is at least about 10 amino acids or 15 nucleotides in length, or more preferably over a region that is 10-50 amino acids or 20-50 nucleotides in length. As used herein, percent (%) amino acid sequence identity is defined as the percentage of amino acids in a candidate sequence that are identical to the amino acids in a reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN- 2 or Megalign (DNASTAR) software. Appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared can be determined by known methods.
[0043] For sequence comparisons, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Preferably, default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
[0044] One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. , 1977, Nuc. Acids Res. 25:3389-3402, and Altschul etal., 1990, J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short
words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et ai, (1990) J. Mol. Biol. 215:403-410). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) or 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands.
[0045] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul, 1993, Proc. Natl. Acad. Sci. USA 90:5873-5787).
One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01.
[0046] Pathogenic mutation, in the context of this disclosure, refers to an alteration of a wild- type human RHO gene that is associated with a disease, for example retinitis pigmentosa. Exemplary pathogenic mutations include mutations at the codons encoding P23, R135, and P347 of rhodopsin protein. A P23 mutation can be, for example, a P23H mutation. A R135 mutation can be, for example, a R135G mutation. As another example, a R135 mutation can be a R135W mutation. As another example, a R135 mutation can be a R135L mutation. A P347 mutation can be, for example, a P347L mutation. As another example, a P347 mutation can be a P347S mutation. As another example, a P347 mutation can be a P347R mutation. As another example, a P347 mutation can be a P347Q mutation. As another example, a P347 mutation can be a P347T mutation. As another example, a P347 mutation can be a P347A mutation.
[0047] Peptide, protein, and polypeptide are used interchangeably to refer to a natural or synthetic molecule comprising two or more amino acids linked by the carboxyl group of one amino acid to the alpha amino group of another. The amino acids may be natural or synthetic, and can contain chemical modifications such as disulfide bridges, substitution of radioisotopes, phosphorylation, substrate chelation (e.g., chelation of iron or copper atoms), glycosylation, acetylation, formylation, amidation, biotinylation, and a wide range of other modifications. A polypeptide may be attached to other molecules, for instance molecules required for function. Examples of molecules which may be attached to a polypeptide include, without limitation, cofactors, polynucleotides, lipids, metal ions, phosphate, etc. Non-limiting examples of polypeptides include peptide fragments, denatured/unstructured polypeptides, polypeptides having quaternary or aggregated structures, etc. There is expressly no requirement that a polypeptide must contain an intended function; a polypeptide can be functional, non-functional, function for unexpected/unintended purposes, or have unknown function. A polypeptide is comprised of approximately twenty, standard naturally occurring amino acids, although natural and synthetic amino acids which are not members of the standard twenty amino acids may also be used. The standard twenty amino acids include alanine (Ala, A), arginine (Arg, R), asparagine (Asn, N), aspartic acid (Asp, D), cysteine (Cys, C), glutamine (Gin, Q), glutamic acid (Glu, E), glycine (Gly, G), histidine, (His, H), isoleucine (lie, I), leucine (Leu, L), lysine (Lys, K), methionine (Met, M), phenylalanine (Phe, F), proline (Pro, P), serine (Ser, S), threonine (Thr,
T), tryptophan (Trp, W), tyrosine (Tyr, Y), and valine (Val, V). The terms “polypeptide sequence” or “amino acid sequence” are an alphabetical representation of a polypeptide molecule.
[0048] Polynucleotide and oligonucleotide are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three-dimensional structure, and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: a gene or gene fragment, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, primers and gRNAs. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component. A polynucleotide is composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); thymine (T); and uracil (U) for thymine (T) when the polynucleotide is RNA. Thus, the term “nucleotide sequence” is the alphabetical representation of a polynucleotide molecule.
[0049] Rhodopsin as used herein, refers to either Rhodopsin polypeptide, also known as opsin 2, OPN2, retinitis pigmentosa 4, CSNBAD1, and RP4, or a polynucleotide encoding Rhodopsin polypeptide. In humans, rhodopsin polypeptide is encoded by the RHO gene. In some embodiments, the Rhodopsin is a polypeptide or polynucleotide identified in one or more publicly available databases as follows: HGNC: 10012 Entrez Gene: 6010 Ensembl: ENSG00000163914 OMIM: 180380 UniProtKB: P08100. Table 1 shows exemplary rhodopsin sequences.
[0050] rs7984 SNP refers to a single nucleotide polymorphism in the 5’ UTR of the human RHO gene assigned the identifier “rs7984” in the dsSNP database (ncbi.nlm.nih.gov/snp/). The nucleotide in the RHO nucleotide sequence shown in Table 1 corresponding to the rs7984 SNP is shown in bold underlined text. The dsSNP database identifies two alleles for the rs7984 SNP: “A”, which is identified in the database as the reference allele, and “G”, which is identified in the database as the alternative allele. A given allele of the rs7984 SNP is said to be “in phase” with a pathogenic RHO mutation when the allele of the rs7984 SNP and pathogenic mutation are located on the same copy of the RHO gene.
[0051] Spacer refers to a region of a gRNA molecule which is partially or fully complementary to a target sequence found in the + or - strand of a RHO genomic DNA. When complexed with a DNA endonuclease such as a Cas9 protein, the gRNA directs the DNA endonuclease to the target sequence in the genomic DNA. A spacer of a Cas9 gRNA is typically 15 to 30 nucleotides in length (e.g., 20-25 nucleotides). The nucleotide sequence of a spacer can be, but is not necessarily, fully complementary to the target sequence. For example, a spacer can contain one or more mismatches with a target sequence, e.g., the spacer can comprise one, two, or three mismatches with the target sequence.
[0052] The terms treat, treating, treatment, and grammatical variations thereof as used herein, include partially or completely delaying, curing, healing, alleviating, relieving, altering, remedying, ameliorating, improving, stabilizing, mitigating, and/or reducing the intensity or frequency of one or more diseases or conditions, symptoms of a disease or condition, or underlying causes of a disease or condition. Treatments according to the disclosure may be applied prophylactically, palliatively or remedially. Prophylactic treatments can be administered to a subject prior to onset, during early onset (e.g., upon initial signs and symptoms of RP), or after an established development of RP. Prophylactic administration can occur for several days to years prior to the manifestation of symptoms.
[0053] In some instances, the terms treat, treating, treatment and grammatical variations thereof, include reducing expression of a mutant rhodopsin ( RHO ) gene. The terms treat, treating, treatment and grammatical variations thereof, can also include reducing RHO protein misfolding and/or mislocalization in retinal cells, e.g., epithelial cells. The terms treat, treating, treatment and grammatical variations thereof, can also include decreasing retinal epithelial cell death and/or retinal degeneration. The terms treat, treating, treatment and grammatical variations thereof, can also include increasing a ratio of expression of a wild-type rhodopsin allele to a rhodopsin mutant allele. Measurements of treatment can be compared with prior treatment(s) of the subject, inclusive of no treatment, or compared with the incidence of such symptom(s) in a general or study population.
[0054] Wild-type, in reference to a genomic DNA sequence or protein sequence, refers to a genomic DNA sequence or protein sequence, respectively, that predominates in a species, e.g., homo sapiens.
6.2. Guide RNA molecules
[0055] The disclosure provides gRNA molecules that can be used with CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) endonucleases to edit a human RHO gene. A review of CRISPR endonuclease systems, including Type II and Type V CRISPR systems is described in WO 2019/102381, the contents of which are incorporated herein by reference in their entireties.
[0056] gRNAs of the disclosure are typically Cas9 gRNAs and comprise a spacer of 15 to 30 nucleotides in length in length. gRNAs of the disclosure are in some embodiments single guide RNAs (sgRNAs), which typically comprise the spacer at the 5’ end of the molecule and a 3’ sgRNA segment. Further features of exemplary gRNA spacer sequences are described in Section 6.2.1 and further features of exemplary 3’ sgRNA segments are described in Section 6.2.2.
6.2.1. Spacers
[0057] The spacer sequence of a gRNA of the disclosure is partially or fully complementary to a target sequence found in a human RHO gene. For example, a 20 nucleotide spacer sequence can be partially or fully complementary to a 20 nucleotide sequence in the RHO gene. A spacer that is partially complementary to a target sequence can have, for example, one, two, or three mismatches with the target sequence.
[0058] DNA endonucleases such as Cas9 require a specific sequence, called a protospacer adjacent motif (PAM) that is downstream (e.g., directly downstream) of the target sequence on the non-target strand. Wild-type S. pyogenes Cas9 recognizes a PAM sequence of NGG that is found downstream of the target sequence in the genomic DNA on the non-target strand, wherein “N” refers to any nucleotide. In some embodiments, the spacer sequences of the gRNAs of the disclosure are complementary to a target sequence that is adjacent to a PAM, for example NGG on the non-target strand.
[0059] gRNAs of the disclosure can comprise a spacer that is 15 to 30 nucleotides in length (e.g., 15 to 25, 16 to 24, 17 to 23, 18 to 22, 19 to 21, 18 to 30, 20 to 28, 22 to 26, or 23 to 25 nucleotides in length). In some embodiments, a spacer is 15 nucleotides in length. In other embodiments, a spacer is 16 nucleotides in length. In other embodiments, a spacer is 17 nucleotides in length. In other embodiments, a spacer is 18 nucleotides in length. In other embodiments, a spacer is 19 nucleotides in length. In other embodiments, a spacer is 20 nucleotides in length. In other embodiments, a spacer is 21 nucleotides in length. In other embodiments, a spacer is 22 nucleotides in length. In other embodiments, a spacer is 23 nucleotides in length. In other embodiments, a spacer is 24 nucleotides in length. In other embodiments, a spacer is 25 nucleotides in length. In other embodiments, a spacer is 26 nucleotides in length. In other embodiments, a spacer is 27 nucleotides in length. In other embodiments, a spacer is 28 nucleotides in length. In other embodiments, a spacer is 29 nucleotides in length. In other embodiments, a spacer is 30 nucleotides in length.
[0060] In some aspects, the disclosure provides gRNAs that can be used to target the rs7984 SNP in a human RHO gene. This SNP is located in the 5’ untranslated region (UTR) of the RHO gene. The dsSNP database (ncbi.nlm.nih.gov/snp/) identifies two alleles for this SNP, “A” (identified in the database as the reference allele) and “G” (identified in the database as the alternative allele). Heterozygotes for the rs7984 SNP represent approximately 25% of the European and US population of Caucasian ancestry. Approximately 40% of the US population of non-Caucasian ancestry are heterozygous for the rs7984 SNP. It is estimated that approximately 4500-5500 RP patients in the US and five major EU economies are heterozygous for the rs7984 SNP. Thus, allele-specific targeting of RHO genes having a
pathogenic mutation using the rs7984 SNP represents a treatment strategy for significant number of subjects having RP.
[0061] In some embodiments, guide RNAs targeting the rs7984 SNP can comprise a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2), where R is A or G (e.g., 15, 16, 17, 18, 19, or 20 consecutive nucleotides of the sequence). Nucleotide “R” corresponds to the rs7984 SNP. In other embodiments, a gRNA targeting the rs7984 SNP can comprise a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of sequence having one or two mismatches with the sequence GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2), where R is A or G (e.g., 15, 16, 17, 18, 19, or 20 consecutive nucleotides of the sequence). In some embodiments, the spacer comprises GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2). In other embodiments, the spacer comprises a sequence having one mismatch with GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2), for example, a mismatch at position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 15, 16, 17, 18, 19, or 20 of GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2), where position 1 is the 3’ nucleotide of GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2). Preferably, the mismatch is not at position 14 (corresponding to R), so that the allele specificity of the gRNA is maintained. An exemplary spacer sequence having one mismatch is ACAGCCRCGGGUCAGCCACA (SEQ ID NO:7). A mismatch can help to promote allele- specificity, as a gRNA having one mismatch with the target allele will have two mismatches with the off-target allele (the second mismatch being the nucleotide at the “R” position). When R is A, the gRNA can be used to target the A allele of the rs7984 SNP, and when R is G, the gRNA can be used to target the G allele of the rs7984 SNP. Exemplary spacer sequences for targeting the rs7984 SNP are shown in Table 2A.
[0062] Lowercase nucleotides in Table 2A indicate a mismatch with the wild-type genomic RHO sequence. The position of the rs7984 SNP is shown in bold. Thus, for example, mm14A and mm14A+20 can be used to target allele A of the rs7984 SNP, and mm14G and mm14G+20 can be used to target allele G of the rs7984 SNP.
[0063] In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides from a sequence shown in Table 2A. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 16 or more consecutive nucleotides from a sequence shown in Table 2A. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
17 or more consecutive nucleotides from a sequence shown in Table 2A. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
18 or more consecutive nucleotides from a sequence shown in Table 2A. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
19 or more consecutive nucleotides from a sequence shown in Table 2A. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
20 consecutive nucleotides from a sequence shown in Table 2A.
[0064] In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 21 consecutive nucleotides from a sequence shown in Table 2A.
[0065] Further spacer sequences for targeting the rs7984 SNP are described in Section 7 and particular exemplary spacer sequences are shown in Table 5. Thus, in some embodiments, the disclosure provides a gRNA whose spacer sequence comprises or consists of a spacer sequence shown in Table 5.
[0066] In some aspects, the disclosure provides gRNAs to target intron 1 of the RHO gene. Such gRNAs can be used, for example, in combination with a rs7984 SNP targeting gRNA. Combinations of intron 1 targeting gRNAs and rs7984 SNP targeting gRNAs can be used, for
example, to cause double cleavage of a human RHO gene (e.g., as shown schematically in FIG. 1). Exemplary spacer sequences are shown in Table 2B.
[0067] In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides from a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 16 or more consecutive nucleotides from a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
17 or more consecutive nucleotides from a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
18 or more consecutive nucleotides from a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
19 or more consecutive nucleotides from a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises
20 consecutive nucleotides from a sequence shown in Table 2B.
[0068] In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides from a sequence having one
mismatch with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 16 or more consecutive nucleotides from a sequence having one mismatch with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 17 or more consecutive nucleotides from a sequence having one mismatch with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 18 or more consecutive nucleotides from a sequence having one mismatch with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 19 or more consecutive nucleotides from a sequence having one mismatch with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 20 consecutive nucleotides from a sequence having one mismatch with a sequence shown in Table 2B.
[0069] In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 16 or more consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 17 or more consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 18 or more consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 19 or more consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B. In some embodiments, a gRNA of the disclosure has a spacer whose nucleotide sequence comprises 20 consecutive nucleotides from a sequence having two mismatches with a sequence shown in Table 2B.
[0070] As shown in Section 7, gRNAs having the spacers 189fw, 88fw, 109rev, 170rev, and 352rev showed relatively high levels of RHO gene editing and/or low effect on RHO mRNA expression levels. Thus, in some embodiments, an intron 1 targeting gRNA of the disclosure comprises the 189fw spacer. In other embodiments, an intron 1 targeting gRNA of the disclosure comprises the 189fw spacer. In other embodiments, an intron 1 targeting gRNA of the disclosure comprises the 88fw spacer. In other embodiments, an intron 1 targeting gRNA of the disclosure comprises the 109rev spacer. In other embodiments, an intron 1 targeting gRNA of the disclosure comprises the 170rev spacer. In other embodiments, an intron 1 targeting gRNA of the disclosure comprises the 352rev spacer.
6.2.2. sgRNA Molecules
[0071] Guide RNAs of the disclosure can be single-guide RNA (sgRNA) molecules. A sgRNA in a Type II CRISPR system can comprise, in the 5' to 3' direction, an optional spacer extension sequence, a spacer sequence, a minimum CRISPR repeat sequence, a single-molecule guide linker, a minimum tracrRNA sequence, a 3’ tracrRNA sequence and an optional tracrRNA extension sequence. The optional tracrRNA extension can comprise elements that contribute additional functionality (e.g., stability) to the guide RNA. The single-molecule guide linker can link the minimum CRISPR repeat and the minimum tracrRNA sequence to form a hairpin structure. The optional tracrRNA extension can comprise one or more hairpins.
[0072] The sgRNA can comprise a variable length spacer sequence (e.g., 15 to 30 nucleotides) at the 5’ end of the sgRNA sequence and a 3’ sgRNA segment. Various 3’ sgRNA segments are known in the art. Exemplary 3’ sgRNA sequences for SpCas9 sgRNAs are shown in Table 3.
[0073] The sgRNA can comprise no uracil base at the 3’ end of the sgRNA sequence. The sgRNA can comprise one or more uracil bases at the 3’ end of the sgRNA sequence. For example, the sgRNA can comprise 1 uracil (U) at the 3’ end of the sgRNA sequence. The sgRNA can comprise 2 uracil (UU) at the 3’ end of the sgRNA sequence. The sgRNA can comprise 3 uracil (UUU) at the 3’ end of the sgRNA sequence. The sgRNA can comprise 4 uracil (UUUU) at the 3’ end of the sgRNA sequence. The sgRNA can comprise 5 uracil (UUUUU) at the 3’ end of the sgRNA sequence. The sgRNA can comprise 6 uracil (UUUUUU) at the 3’ end of the sgRNA sequence. The sgRNA can comprise 7 uracil (UUUUUUU) at the 3’ end of the sgRNA sequence. The sgRNA can comprise 8 uracil (UUUUUUUU) at the 3’ end of the sgRNA sequence. Different length stretches of uracil can be appended at the 3’end of a sgRNA as terminators. Thus, for example, the 3’ sgRNA sequences set forth in Table 3 can be modified by adding or removing one or more uracils at the end of the sequence.
6.2.3. Modified gRNA molecules
[0074] Guide RNAs can be readily synthesized by chemical means, enabling a number of modifications to be readily incorporated, as described in the art. The disclosed gRNA (e.g., sgRNA) molecules can be unmodified or can contain any one or more of an array of chemical modifications.
[0075] While chemical synthetic procedures are continually expanding, purifications of such RNAs by procedures such as high-performance liquid chromatography (HPLC, which avoids the use of gels such as PAGE) tends to become more challenging as polynucleotide lengths increase significantly beyond a hundred or so nucleotides. One approach that can be used for generating chemically modified RNAs of greater length is to produce two or more molecules that are ligated together. Much longer RNAs, such as those encoding a Cas9 endonuclease, are more readily generated enzymatically. While fewer types of modifications are available for use in enzymatically produced RNAs, there are still modifications that can be used to, for
instance, enhance stability, reduce the likelihood or degree of innate immune response, and/or enhance other attributes, as described herein and in the art.
[0076] By way of illustration of various types of modifications, especially those used frequently with smaller chemically synthesized RNAs, modifications can comprise one or more nucleotides modified at the 2' position of the sugar, for instance a 2'-0-alkyl, 2'-0-alkyl-0-alkyl, or 2'-fluoro- modified nucleotide. In some examples, RNA modifications can comprise 2'-fluoro, 2'-amino or 2'-0-methyl modifications on the ribose of pyrimidines, abasic residues, or an inverted base at the 3' end of the RNA. Such modifications can be routinely incorporated into oligonucleotides and these oligonucleotides have been shown to have a higher Tm (thus, higher target binding affinity) than 2'-deoxyoligonucleotides against a given target.
[0077] A number of nucleotide and nucleoside modifications have been shown to make the oligonucleotide into which they are incorporated more resistant to nuclease digestion than the native oligonucleotide; these modified oligos survive intact for a longer time than unmodified oligonucleotides. Specific examples of modified oligonucleotides include those comprising modified backbones, for example, phosphorothioates, phosphotriesters, methyl phosphonates, short chain alkyl or cycloalkyl intersugar linkages or short chain heteroatomic or heterocyclic intersugar linkages. Some oligonucleotides are oligonucleotides with phosphorothioate backbones and those with heteroatom backbones, particularly CH2-NH-O-CH2, CH,~N(CH3)-0- CH2 (known as a methylene(methylimino) or MMI backbone), CH2-O-N (Chy-Chh, CH2 -N (CH3)-N (CH3)-CH2 and O-N (CH3)- CH2 -CH2 backbones, wherein the native phosphodiester backbone is represented as O- P- O- CH,); amide backbones (see De Mesmaeker et al. 1995, Ace. Chem. Res., 28:366-374); morpholino backbone structures (see U.S. Patent No. 5,034,506); peptide nucleic acid (PNA) backbone (wherein the phosphodiester backbone of the oligonucleotide is replaced with a polyamide backbone, the nucleotides being bound directly or indirectly to the aza nitrogen atoms of the polyamide backbone, see Nielsen et al., 1991, Science 254:1497). Phosphorus-containing linkages include, but are not limited to, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates comprising 3'alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates comprising 3'-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates having normal 3'-5' linkages, 2'-5' linked analogs of these, and those having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3'-5' to 5'-3' or 2'-5' to 5'-2'; see U.S. Patent Nos.
3,687,808; 4,469,863; 4,476,301; 5,023,243; 5,177,196; 5,188,897; 5,264,423; 5,276,019; 5,278,302; 5,286,717; 5,321,131; 5,399,676; 5,405,939; 5,453,496; 5,455,233; 5,466,677;
5,476,925; 5,519,126; 5,536,821; 5,541,306; 5,550,111; 5,563,253; 5,571,799; 5,587,361; and
5,625,050.
[0078] Morpholino-based oligomeric compounds are described in Braasch and David Corey, 2002, Biochemistry, 41(14):4503-4510; Genesis, Volume 30, Issue 3, (2001); Heasman, 2002, Dev. Biol., 243: 209-214; Nasevicius etal., 2000, Nat. Genet., 26:216-220; Lacerra etal., 2000, Proc. Natl. Acad. Sci. , 97: 9591-9596; and U.S. Patent No. 5,034,506.
[0079] Cyclohexenyl nucleic acid oligonucleotide mimetics are described in Wang et al., 2000, J. Am. Chem. Soc., 122: 8595-8602.
[0080] Modified oligonucleotide backbones that do not include a phosphorus atom therein have backbones that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatom and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic intemucleoside linkages. These comprise those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones; formacetyl and thioformacetyl backbones; methylene formacetyl and thioformacetyl backbones; alkene containing backbones; sulfamate backbones; methyleneimino and methylenehydrazino backbones; sulfonate and sulfonamide backbones; amide backbones; and others having mixed N, O, S, and CH2 component parts; see U.S.
Patent Nos. 5,034,506; 5,166,315; 5,185,444; 5,214,134; 5,216,141; 5,235,033; 5,264,562; 5,264,564; 5,405,938; 5,434,257; 5,466,677; 5,470,967; 5,489,677; 5,541,307; 5,561,225; 5,596,086; 5,602,240; 5,610,289; 5,602,240; 5,608,046; 5,610,289; 5,618,704; 5,623,070; 5,663,312; 5,633,360; 5,677,437; and 5,677,439.
[0081] One or more substituted sugar moieties can also be included, e.g., one of the following at the 2' position: OH, SH, SCH3, F, OCN, OCH3, OCH30(CH2)n CH3, 0(CH2)n NH2, or 0(CH2)n CH3, where n is from 1 to about 10; Ci to C10 lower alkyl, alkoxyalkoxy, substituted lower alkyl, alkaryl or aralkyl; Cl; Br; CN; CF3; OCF3; O-, S-, or bi- alkyl; O-, S-, or N-alkenyl; SOCH3; S02 CH3; ON02; N02; N3; NH2; heterocycloalkyl; heterocycloalkaryl; aminoalkylamino; polyalkylamino; substituted silyl; an RNA cleaving group; a reporter group; an intercalator; a group for improving the pharmacokinetic properties of an oligonucleotide; or a group for improving the pharmacodynamic properties of an oligonucleotide and other substituents having similar properties. In some aspects, a modification includes 2'-methoxyethoxy (2'-0- CH2CH2OCH3, also known as 2'-0-(2-methoxyethyl)) (Martin et al., 1995, Helv. Chim. Acta, 78, 486). Other modifications include 2'-methoxy (2'-0-CH3), 2'-propoxy (2'- OCH2 CH2CH3) and 2'- fluoro (2'-F). Similar modifications can also be made at other positions on the oligonucleotide, particularly the 3' position of the sugar on the 3' terminal nucleotide and the 5' position of 5' terminal nucleotide. Oligonucleotides can also have sugar mimetics, such as cyclobutyls in place of the pentofuranosyl group.
[0082] In some examples, both a sugar and an intemucleoside linkage (in the backbone) of the nucleotide units can be replaced with novel groups. The base units can be maintained for
hybridization with an appropriate nucleic acid target compound. One such oligomeric compound, an oligonucleotide mimetic that has been shown to have excellent hybridization properties, is referred to as a peptide nucleic acid (PNA). In PNA compounds, the sugar- backbone of an oligonucleotide can be replaced with an amide containing backbone, for example, an aminoethylglycine backbone. The nucleobases can be retained and bound directly or indirectly to aza nitrogen atoms of the amide portion of the backbone. Representative U.S. patents that teach the preparation of PNA compounds include, but are not limited to, U.S.
Patent Nos. 5,539,082; 5,714,331; and 5,719,262. Further teaching of PNA compounds can be found in Nielsen et al., 1991, Science, 254: 1497-1500.
[0083] RNAs such as guide RNAs can also include, additionally or alternatively, nucleobase (often referred to in the art simply as "base") modifications or substitutions. As used herein, "unmodified" or "natural" nucleobases include adenine (A), guanine (G), thymine (T), cytosine (C), and uracil (U). Modified nucleobases include nucleobases found only infrequently or transiently in natural nucleic acids, e.g., hypoxanthine, 6-methyladenine, 5-Me pyrimidines, particularly 5- methylcytosine (also referred to as 5-methyl-2' deoxy cytosine and often referred to in the art as 5-Me-C), 5-hydroxymethylcytosine (HMC), glycosyl HMC and gentobiosyl HMC, as well as synthetic nucleobases, e.g., 2-aminoadenine, 2-(methylamino) adenine, 2- (imidazolylalkyl)adenine, 2-(aminoalklyamino) adenine or other heterosub stituted alkyladenines, 2-thiouracil, 2-thiothymine, 5-bromouracil, 5-hydroxymethyluracil, 8-azaguanine, 7- deazaguanine, N6 (6-aminohexyl) adenine, and 2,6-diaminopurine. Komberg, A., DNA Replication, W. H. Freeman & Co., San Francisco, pp. 75-77 (1980); Gebeyehu et al., Nucl. Acids Res. 15:4513 (1997). A "universal" base known in the art, e.g., inosine, can also be included. 5-Me-C substitutions have been shown to increase nucleic acid duplex stability by about 0.6-1.2 °C. (Sanghvi, Y. S., in Crooke, S. T. and Lebleu, B., eds., Antisense Research and Applications, CRC Press, Boca Raton, 1993, pp. 276-278) and are aspects of base substitutions.
[0084] Modified nucleobases can comprise other synthetic and natural nucleobases, such as 5- methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudo-uracil), 4-thiouracil, 8-halo, 8-amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8- substituted adenines and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and other 5- substituted uracils and cytosines, 7-methylquanine and 7-methyladenine, 8-azaguanine and 8- azaadenine, 7-deazaguanine and 7-deazaadenine, and 3-deazaguanine and 3-deazaadenine.
[0085] Further, nucleobases can comprise those disclosed in U.S. Patent No. 3,687,808, those disclosed in 'The Concise Encyclopedia of Polymer Science and Engineering', 858-859, Kroschwitz, J.I., ed. John Wiley & Sons, 1990, those disclosed by Englisch et al., Angewandle Chemie, International Edition', 1991, 30, p. 613, and those disclosed by Sanghvi, Y. S., Chapter 15, Antisense Research and Applications', 289-302, Crooke, S.T. and Lebleu, B. ea., CRC Press, 1993. Certain of these nucleobases can be useful for increasing the binding affinity of the oligomeric compounds of the invention. These include 5-substituted pyrimidines, 6- azapyrimidines and N-2, N-6 and 0-6 substituted purines, comprising 2-aminopropyladenine, 5- propynyluracil and 5-propynylcytosine. 5-methylcytosine substitutions have been shown to increase nucleic acid duplex stability by about 0.6-1.2°C (Sanghvi, Y.S., Crooke, S.T. and Lebleu, B., eds, 'Antisense Research and Applications', CRC Press, Boca Raton, 1993, 276- 278) and are aspects of base substitutions, even more particularly when combined with 2'-0- methoxyethyl sugar modifications. Modified nucleobases are described in U.S. Patent No. 3,687,808, as well as 4,845,205; 5,130,302; 5,134,066; 5,175,273; 5,367,066; 5,432,272; 5,457,187; 5,459,255; 5,484,908; 5,502,177; 5,525,711; 5,552,540; 5,587,469; 5,596,091; 5,614,617; 5,681,941; 5,750,692; 5,763,588; 5,830,653; 6,005,096; and U.S. Patent Application Publication 2003/0158403.
[0086] Thus, a modified gRNA can include, for example, one or more non-natural sugars, internucleotide linkages and/or bases. It is not necessary for all positions in a given gRNA to be uniformly modified, and in fact more than one of the aforementioned modifications can be incorporated in a single oligonucleotide, or even in a single nucleoside within an oligonucleotide.
[0087] The guide RNAs and/or mRNA (or DNA) encoding an endonuclease can be chemically linked to one or more moieties or conjugates that enhance the activity, cellular distribution, or cellular uptake of the oligonucleotide. Such moieties comprise, but are not limited to, lipid moieties such as a cholesterol moiety (Letsinger et al. 1989, Proc. Natl. Acad. Sci. USA, 86:
6553-6556); cholic acid (Manoharan et al, 1994, Bioorg. Med. Chem. Let., 4: 1053- 1060); a thioether, e.g., hexyl-S- tritylthiol (Manoharan et al, 1992, Ann. N. Y. Acad. Sci., 660: 306-309;
Manoharan etai, 1993, Bioorg. Med. Chem. Let., 3: 2765-2770); a thiocholesterol (Oberhauser et al., 1992, Nucl. Acids Res., 20: 533-538); an aliphatic chain, e.g., dodecandiol or undecyl residues (Kabanov et al, 1990, FEBS Lett., 259: 327-330; Svinarchuk etal, 1993, Biochimie,
75: 49- 54); a phospholipid, e.g., di-hexadecyl-rac-glycerol or triethylammonium 1,2-di-O- hexadecyl-rac-glycero-3-H-phosphonate (Manoharan et al., 1995, Tetrahedron Lett., 36: 3651-
3654; and Shea et al, 1990, Nucl. Acids Res., 18: 3777-3783); a polyamine ora polyethylene glycol chain (Manoharan et al, 1995, Nucleosides & Nucleotides, 14: 969-973); adamantane acetic acid (Manoharan et al, 1995, Tetrahedron Lett., 36: 3651-3654); a palmityl moiety
(Mishra etal., 1995, Biochim. Biophys. Acta, 1264: 229- 237); or an octadecylamine or
hexylamino-carbonyl-t oxycholesterol moiety (Crooke etal, 1996, J. Pharmacol. Exp. Ther.,
277: 923-937). See also U.S. Patent Nos. 4,828,979; 4,948,882; 5,218,105; 5,525,465; 5,541,313; 5,545,730; 5,552,538; 5,578,717; 5,580,731; 5,580,731; 5,591,584; 5,109,124; 5,118,802; 5,138,045; 5,414,077; 5,486,603; 5,512,439; 5,578,718; 5,608,046; 4,587,044; 4,605,735; 4,667,025; 4,762,779; 4,789,737; 4,824,941 ; 4,835,263; 4,876,335; 4,904,582; 4,958,013; 5,082,830; 5,112,963; 5,214,136; 5,082,830; 5,112,963; 5,214,136; 5,245,022; 5,254,469; 5,258,506; 5,262,536; 5,272,250; 5,292,873; 5,317,098; 5,371,241; 5,391,723; 5,416,203; 5,451,463; 5,510,475; 5,512,667; 5,514,785; 5,565,552; 5,567,810; 5,574,142; 5,585,481; 5,587,371; 5,595,726; 5,597,696; 5,599,923; 5,599, 928 and 5,688,941.
[0088] Sugars and other moieties can be used to target proteins and complexes comprising nucleotides, such as cationic polysomes and liposomes, to particular sites. For example, hepatic cell directed transfer can be mediated via asialoglycoprotein receptors (ASGPRs); see, e.g., Hu, et a!., 2014, Protein Pept Lett. 21(10):1025-30. Other systems known in the art and regularly developed can be used to target biomolecules of use in the present case and/or complexes thereof to particular target cells of interest.
[0089] Targeting moieties or conjugates can include conjugate groups covalently bound to functional groups, such as primary or secondary hydroxyl groups. Conjugate groups of the present disclosure include intercalators, reporter molecules, polyamines, polyamides, polyethylene glycols, polyethers, groups that enhance the pharmacodynamic properties of oligomers, and groups that enhance the pharmacokinetic properties of oligomers. Typical conjugate groups include cholesterols, lipids, phospholipids, biotin, phenazine, folate, phenanthridine, anthraquinone, acridine, fluoresceins, rhodamines, coumarins, and dyes.
Groups that enhance the pharmacodynamic properties, in the context of this present disclosure, include groups that improve uptake, enhance resistance to degradation, and/or strengthen sequence-specific hybridization with the target nucleic acid. Groups that enhance the pharmacokinetic properties, in the context of this disclosure, include groups that improve uptake, distribution, metabolism or excretion of the compounds of the present disclosure.
Representative conjugate groups are disclosed in International Patent Application Publication
WO1993007883, and U.S. Patent No. 6,287,860. Conjugate moieties include, but are not limited to, lipid moieties such as a cholesterol moiety, cholic acid, a thioether, e.g., hexyl-5 -trityl thiol, a thiocholesterol, an aliphatic chain, e.g., dodecandiol or undecyl residues, a phospholipid, e.g., di-hexadecyl-rac- glycerol or triethylammonium 1,2-di-O-hexadecyl-rac- glycero-3-H-phosphonate, a polyamine or a polyethylene glycol chain, or adamantane acetic acid, a palmityl moiety, or an octadecylamine or hexylamino-carbonyl-oxy cholesterol moiety.
See, e.g., U.S. Pat. Nos. 4,828,979; 4,948,882; 5,218,105; 5,525,465; 5,541,313; 5,545,730;
5,552,538; 5,578,717, 5,580,731; 5,580,731; 5,591,584; 5,109,124; 5,118,802; 5,138,045;
5,414,077; 5,486,603; 5,512,439; 5,578,718; 5,608,046; 4,587,044; 4,605,735; 4,667,025;
4,762,779; 4,789,737; 4,824,941 ; 4,835,263; 4,876,335; 4,904,582; 4,958,013; 5,082,830; 5,112,963; 5,214,136; 5,082,830; 5,112,963; 5,214,136; 5,245,022; 5,254,469; 5,258,506; 5,262,536; 5,272,250; 5,292,873; 5,317,098; 5,371,241; 5,391,723; 5,416,203, 5,451,463; 5,510,475; 5,512,667; 5,514,785; 5,565,552; 5,567,810; 5,574,142; 5,585,481; 5,587,371; 5,595,726; 5,597,696; 5,599,923; 5,599,928 and 5,688,941.
[0090] A large variety of modifications have been developed and applied to enhance RNA stability, reduce innate immune responses, and/or achieve other benefits that can be useful in connection with the introduction of polynucleotides into human cells, as described herein; see, e.g., the reviews by Whitehead KA etai, 2011, Annual Review of Chemical and Biomolecular Engineering, 2: 77-96; Gaglione and Messere, 2010, Mini Rev Med Chem, 10(7):578-95; Chernolovskaya et al, 2010, CurrOpin Mol Ther., 12(2): 158-67; Deleavey etai, 2009, Curr Protoc Nucleic Acid Chem Chapter 16: Unit 16.3; Behlke, 2008, Oligonucleotides 18(4):305-19; Fucini et al, 2012, Nucleic Acid Ther 22(3): 205-210; Bremsen et al, 2012, Front Genet 3: 154.
6.3. DNA Endonucleases
[0091] In some aspects, the disclosure provides novel modified Cas9 proteins (also referred to as Cas9 variants). Novel Cas9 proteins of the disclosure are described in Section 6.3.1. The novel Cas9 proteins of the disclosure can be used in combination with a gRNA to direct the Cas9 protein to a target DNA sequence. For example, a novel Cas9 protein of the disclosure can be used in combination with one or more gRNAs (e.g., a rs7984 SNP targeting gRNA and/or a RHO intron 1 targeting gRNA) of the disclosure to direct the Cas9 protein to a RHO gene, and in particular RHO genes having pathogenic mutations.
[0092] The gRNAs of the disclosure can be also be used in combination with DNA endonucleases beyond those described in Section 6.3.1 (e.g., wild-type Cas9 proteins and modified Cas9 proteins known in the art) to direct the DNA endonuclease to a RHO gene. Exemplary features of additional DNA nucleases are described in Section 6.3.2.
[0093] As shown in the Examples in Section 7, certain combinations of gRNAs and modified Cas9 proteins have unexpectedly superior allele-specificity and/or levels of RHO gene editing compared to other combinations. Thus, in some embodiments, the disclosure provides particular Cas9 variant proteins for use with particular gRNAs (and vice versa), for example in the combinations described in the Examples in Section 7.
[0094] A DNA endonuclease, e.g., as described in Section 6.3.1 or Section 6.3.2, can be provided to a cell or a subject as one or more polypeptides, or one or more nucleic acids (e.g., mRNAs) encoding the one or more polypeptides.
6.3.1. Modified Cas9 proteins
[0095] Modified Cas9 proteins of the disclosure can comprise one or more mutations relative to a corresponding wild-type Cas9 protein. The position of the mutations described herein are identified by reference to the amino acid numbering in an unmodified mature Streptococcus pyogenes Cas9 (SpCas9) (NP_269215 (NCBI)) as set forth in SEQ ID NO: 1 :
MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLK
RTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYH
EKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQL
FEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAED
AKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDE
H HQDLTLLKALVRQQLPEKYKEI FFDQSKNGYAGYI DGGASQEEFYKFI KPI LEKM DGTEELLVK
LNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARG
NSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVY
NELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVED
RFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQL
KRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSG
QGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRE
RMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVP
QSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERG
GLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQ
FYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAK
YFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEV
QTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELL
GITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPS
KYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYN
KHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDL
SQLGGD (SEQ ID NO:1).
[0096] A SpCas9 protein having the amino acid sequence of SEQ ID NO:1 is sometimes referred to herein as wild-type (wt) SpCas9. The modified Cas9 proteins of the disclosure can have a single mutation alone, or can comprise one or more additional mutations. A mutation X1nnnX2 means that at position nnn the amino acid X2 is present in place of the amino acid X1 which is present in the wild-type polypeptide; so, for example, K526D means that the amino acid at position 526 corresponds to an Aspartic acid (Asp or D), in place of the amino acid lysine (Lys or K) which is present in the wild-type polypeptide. A modified Cas9 protein of the disclosure can be a S. pyogenes Cas9 proteins or an SpCas9 orthologue (e.g., S. thermophilus, S. aureus, or N. meningitides ).
[0097] Exemplary mutations that can be included in modified Cas9 proteins of the disclosure include K526 mutations, R661 mutations, Y515 mutations, M495 mutations, H698 mutations, and combinations thereof. Specific K526 mutations that can be used in a Cas9 protein of the disclosure include K526A, K526D, K526E, and K526N. Specific R661 mutations that can be used in a Cas9 protein of the disclosure include R661S, R661Q, R661L, R661D, R661E, R661F, R661M, R661W, R661Y, and R661A. Specific Y515 mutations that can be used in a Cas9 protein of the disclosure include Y515N. Specific M495 mutations that can be used in a Cas9 protein of the disclosure include M495V. Specific H698 mutations that can be used in a Cas9 protein of the disclosure include H698Q.
[0098] In some embodiments, a modified Cas9 protein comprises K526E+R661D+Y515N mutations.
[0099] In some embodiments, a modified Cas9 protein comprises K526E+R661E+Y515N mutations.
[0100] In some embodiments, a modified Cas9 protein comprises K526E+R661F+Y515N mutations.
[0101] In some embodiments, a modified Cas9 protein comprises K526E+R661M+Y515N mutations.
[0102] In some embodiments, a modified Cas9 protein comprises K526E+R661W+Y515N mutations.
[0103] In some embodiments, a modified Cas9 protein comprises K526E+R661Y+Y515N mutations.
[0104] In some embodiments, a modified Cas9 protein comprises K526D+R661Q+Y515N mutations.
[0105] In some embodiments, a modified Cas9 protein comprises K526D+R661L+Y515N mutations.
[0106] In some embodiments, a modified Cas9 protein comprises K526D+R661W+Y515N mutations.
[0107] In some embodiments, a modified Cas9 protein comprises K526D+R661Q+Y515N+M495V mutations.
[0108] In some embodiments, a modified Cas9 protein comprises K526A+R661Q+Y515N+M495V mutations.
[0109] In some embodiments, a modified Cas9 protein comprises K526E+R661A+Y515N+M495V mutations.
[0110] In some embodiments, a modified Cas9 protein comprises K526D+R661D+Y515N mutations.
[0111] In some embodiments, a modified Cas9 protein comprises K526D+R661E+Y515N mutations.
[0112] In some embodiments, a modified Cas9 protein comprises K526D+R661F+Y515N mutations.
[0113] In some embodiments, a modified Cas9 protein comprises K526D+R661M+Y515N mutations.
[0114] In some embodiments, a modified Cas9 protein comprises K526D+R661Y+Y515N mutations.
[0115] In some embodiments, a modified Cas9 protein comprises K526E+R661Q+Y515N mutations.
[0116] In some embodiments, a modified Cas9 protein comprises K526E+R661Q+Y515N+M495V mutations.
[0117] In some embodiments, a modified Cas9 protein comprises K526D+R661A+Y515N+M495V mutations.
[0118] In some embodiments, the amino acid sequence of the modified Cas9 protein of the disclosure comprises an amino acid sequence which is at least 90% identical to SEQ ID NO:1. In other embodiments, the amino acid sequence of the modified Cas9 protein of the disclosure comprises an amino acid sequence which is at least 95% identical to SEQ ID NO:1. In other embodiments, the amino acid sequence of the modified Cas9 protein of the disclosure comprises an amino acid sequence which is at least 97% identical to SEQ ID NO:1. In other embodiments, the amino acid sequence of the modified Cas9 protein of the disclosure comprises an amino acid sequence which is at least 99% identical to SEQ ID NO:1. In other embodiments, the amino acid sequence of the modified Cas9 protein of the disclosure comprises an amino acid sequence which is identical to SEQ ID NO:1 other than one or more mutations described in this Section.
[0119] The disclosure further provides Cas9 proteins in the form of a fusion protein with a second amino acid sequence, such as a nuclear localization signal, non-native tag, a transcriptional activator, a transcriptional repressor, a histone-modifying protein, an integrase, or a recombinase. Non-limiting examples of nuclear localization signals include PKKKRKV (SEQ ID NO:68), PKKKRRV (SEQ ID NO:69), KRPAATKKAGQAKKKK (SEQ ID NO:70), YGRKKRRQRRR (SEQ ID NO:71), RKKRRQRRR (SEQ ID NO:72), PAAKRVKLD (SEQ ID NO:73), RQRRNELKRSP (SEQ ID NO:74), VSRKRPRP (SEQ ID NO:75), PPKKARED (SEQ
ID NO:76), PQPKKKPL (SEQ ID NO:77), SALIKKKKKMAP (SEQ ID NO:78), PKQKKRK (SEQ ID NO:79), RKLKKKIKKL (SEQ ID NO:80), REKKKFLKRR (SEQ ID N0:81), KRKGDEVDGVDEVAKKKSKK (SEQ ID NO:82), RKCLQAGMNLEARKTKK (SEQ ID NO:83), NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO:84), and RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO:85).
[0120] Exemplary second amino acid sequences include protein tags (e.g., V5-tag, FI_AG-tag, myc-tag, HA-tag, GST-tag, polyHis-tag, MBP-tag), protein domains, transcription modulators, enzymes acting on small molecule substrates, DNA, RNA and protein modification enzymes (e.g., adenosine deaminase, cytidine deaminase, guanosyl transferase, DNA methyltransferase, RNA methyltransferases, DNA demethylases, RNA demethylases, dioxygenases, polyadenylate polymerases, pseudouridine synthases, acetyltransferases, deacetylase, ubiquitin-ligases, deubiquitinases, kinases, phosphatases, NEDD8-ligases, de- NEDDylases, SUMO-ligases, deSUMOylases, histone deacetylases, histone acetyltransferases histone methyltransferases, histone demethylases), protein DNA binding domains, RNA binding proteins, polypeptide sequences with specific biological functions (e.g., nuclear localization signals, mitochondrial localization signals, plastid localization signals, subcellular localization signals, destabilizing signals, Geminin destruction box motifs), and biological tethering domains (e.g., MS2, Csy4 and lambda N protein). Various Cas9 fusion proteins are described in Ribeiro et ai, 2018, In. J. Genomics, Article ID: 1652567; Jayavaradhan, etai, 2019, Nat Commun 10:2866; Xiao et al., 2019, The CRISPR Journal, 2(1):51-63; Mali et ai, 2013, Nat Methods. 10(10): 957-63; US patent nos. 9,322,037, 9,388,430.
6.3.2. Additional DNA endonucleases
[0121] In some embodiments, the DNA endonuclease used in the compositions and methods of the disclosure is a Cas9 variant, for example, a SpCas9 variant. For example, Cas9 variants described in WO 2018/149888, the contents of which are incorporated herein by reference in their entireties, can be used. As another example, enzymes or orthologs listed as SEQ ID NOs. 1-612 of WO 2019/102381, the contents of which are incorporated herein by reference in their entireties, and variants thereof, can be utilized in the compositions and methods described herein.
[0122] In some embodiments, a Cas9 variant comprises a double mutation selected from K526E+Y450S, K526E+M495V, K526E+Y515N, K526E+R661X, K526E+N690I,
K526E+R691Q, K526E+Q695H and K526E+H698Q; wherein X is L, Q or S, preferably where X is Q or S. In some embodiments, a Cas9 variant comprises K526E+R661S substitutions. In some embodiments, a Cas9 variant comprises K526E+R661Q substitutions. In some embodiments, a Cas9 variant comprises K526E+R661L substitutions.
[0123] In some embodiments, a Cas9 variant comprises a triple mutation selected from M495V+ K526E+ R661 X, Y515N+K526E+R661X, K526E+R661X+H698Q and M495V+Y515N+K526E, where X is L, Q or S, preferably where X is Q or S. In some embodiments, a Cas9 variant comprises K526E+R661S+Y515N substitutions. In some embodiments, a Cas9 variant comprises K526E+R661Q+Y515N substitutions. In some embodiments, a Cas9 variant comprises K526E+R661L+Y515N substitutions. In some embodiments, a Cas9 variant comprises K526E+Y515N+M495V substitutions.
[0124] In some embodiments, a Cas9 variant comprises a quadruple mutation selected from M495V+Y515N+K526E+R661X and M495V+K526E+R661X+H698Q, where X is L, Q or S, preferably where X is Q or S. In some embodiments, the Cas9 variant comprises the mutations K526E+R661 Q+H698Q+M495V.
[0125] In some embodiments, the Cas9 variant comprises the mutations M495V+Y515N+K526E+R661Q (hereinafter also named evoCas9). In other embodiments, the Cas9 variant comprises the mutations M495V+Y515N+K526E+R661S (hereinafter named evoCas9-ll).
[0126] In some embodiments, a Cas9 variant comprises a single mutation selected from D406Y, W464L, T474A, K526E, N612K, and L683P.
[0127] In some embodiments, a Cas9 variant comprises a double mutation selected from R400H+Y450S, D406V+E523K, A421V+R661W, R424G+Q739P, W476R+L738P, P449S+F704S, N522K+G658E, E523D+E617K, L540Q+L607P, W659R+R661W, S675C+Q695L and I679V+H723L.
[0128] In some embodiments, a Cas9 variant comprises three mutations selected from K377E+L598P+L651 H, D397E+Y430C+L666P, Q402R+V561M+Q695L, N407P+F498I+P509L, N407H+K637N+N690I, Y450H+F553L+Q716H, Y450N+H698P+Q739K,
T 472 A+ P475H + A488 V, I473F+D550N+Q739E, F478Y+N522I+L727H,
K484M+Q695H+Q712R, S487Y+N504S+E573D, T496A+N609D+A728G,
R654H+R691 Q+H698Q and R691L+H721R+I733V.
[0129] In some embodiments, a Cas9 variant comprises four mutations selected from F405L+F518L+L651 P+I724V, L423P+M465R+Y515N+K673M,
R457P+ K468N+R661 W+G715S, E470D+1548V+A589T+Q695H ,
A488 V+ D605 V+ R629G+T 657A and M495V+K526N+S541P+K562E.
[0130] In some embodiments, a Cas9 variant comprises the five mutations R403H+N612Y+L651P+K652E+G715S.
[0131] In some embodiments, a Cas9 variant comprises six mutations from
E387V+V561 A+D618N+D628G+L680P+S701 F,
R403H+K526E+N612Y+L651 P+K652E+G715S,
R403H+M495T+N612Y+L651 P+K652E+G715S, R403H+L502P+N612Y+L651P+K652E+G715S, R403H+K506N+N612Y+L651P+K652E+G715S, and R403H+N612Y+L651P+K652E+N692I+G715S.
[0132] In some embodiments, a Cas9 variant comprises seven mutations selected from R403H+A456T+N612Y+L651 P+K652E+G715S+G728T,
R403H+ F498Y+ N612Y+ L651 P+ K652E+ R661 L+G715S, and R403H+Q426R+F478V+N612Y+L651P+K652E+G715S.
[0133] In some embodiments, a Cas9 variant comprises the following eight mutations R403H+R442N+V452I+N609S+N612Y+R635G+L651P+K652E+F693Y+G715S.
[0134] In some embodiments, a Cas9 variant comprises the following nine mutations R403H+R457Q+F518I+N612Y+R635G+L651 P+K652E+F693Y+G715S.
[0135] In some embodiments a Cas9 variant comprises at least one mutation selected from Y450S, M495V, Y515N, K526E, R661X, N690I, R691Q, Q695H, and H698Q, where X is L, Q or S, preferably where X is Q or S.
[0136] In some embodiments, a Cas9 variant comprises N692A, M694A, Q695A, and H698A mutations (see Ikeda etai, 2019, Commun Biol 2, 371, describing a Cas9 variant with these mutations identified as HypaCas9)
[0137] In some embodiments, a Cas9 variant comprises K848A, K1003A, and R1060A mutations (see Slaymaker etai, 2016, Science, 351 (6268): 84-88, describing a Cas9 variant with these mutations identified as eSpCas9(1.1)).
[0138] In some embodiments, a Cas9 variant comprises F539S, M763I, and K890N mutations (see Lee etai.., 2018, Nat Commun. 9:3048, describing a Cas9 variant with these mutations identified as Sniper-Cas).
[0139] In some embodiments, a Cas9 variant comprises N497A, R661A, Q695A, and Q926A mutations (see Kleinstiver etai. 2016, Nature, 529:490-495, describing a Cas9 variant with these mutations identified as SpCas9-HF1).
[0140] In some embodiments, a Cas9 variant comprises a R691A mutation (see Vakulskas et ai, 2018, Nat Med 24:1216-1224, describing a Cas9 variant with these mutations identified as HiFi Cas9).
[0141] Further examples of endonucleases that can be utilized in the present disclosure are provided in SEQ ID NOs: 1-612 of WO 2019/102381. These proteins, and any other described herein, can be modified before use or can be encoded in a nucleic acid sequence such as a
DNA, RNA or mRNA or within a vector construct such as the plasmids or adeno-associated virus (AAV) vectors described herein. Further, they can be codon optimized.
6.4. Nucleic Acids and Host Cells
[0142] The disclosure provides nucleic acids ( e.g ., DNA or RNA) encoding the gRNAs of the disclosure, nucleic acids encoding a DNA endonuclease (e.g., a DNA endonuclease described in Section 6.3) and pluralities of nucleic acids, for example comprising a nucleic acid encoding a gRNA or more than one gRNA (e.g., two gRNAs) and a nucleic acid encoding a DNA endonuclease.
[0143] A nucleic acid encoding a gRNA can be, for example, a plasmid or a viral genome (e.g., a lentivirus, retrovirus, adenovirus, or adeno-associated virus genome modified to encode the gRNA). Plasmids can be, for example, plasmids for producing virus particles, e.g., lentivirus particles, or plasmids for propagating the gRNA coding sequence in bacterial (e.g., E. coli) or eukaryotic (e.g., yeast) cells.
[0144] A nucleic acid encoding a gRNA can, in some embodiments, further encode a DNA endonuclease protein, e.g., a Cas9 protein described in Section 6.3. Alternatively, a DNA endonuclease can be encoded by a separate nucleic acid (e.g., DNA or mRNA). Those of skill in the art will appreciate that plasmids encoding a Cas9 protein can be modified to encode a different Cas9 protein, e.g., a Cas9 variant as described in Section 6.3.
[0145] Nucleic acids encoding a DNA endonuclease (e.g., a Cas9 protein) can be codon optimized, e.g., where at least one non-common codon or less-common codon has been replaced by a codon that is common in a host cell. For example, a codon optimized nucleic acid can direct the synthesis of an optimized messenger mRNA, e.g., optimized for expression in a mammalian expression system. As an example, if the intended target nucleic acid is within a human cell, a human codon-optimized polynucleotide encoding Cas9 can be used for producing a Cas9 polypeptide.
[0146] Nucleic acids of the disclosure, e.g., plasmids and viral vectors, can comprise one or more regulatory elements such as promoters, enhancers, and other expression control elements (e.g., transcription termination signals, such as polyadenylation signals and poly-U sequences). Such regulatory elements are described, for example, in Goeddel, 1990, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). A tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as retinal tissue (e.g., by using a RHO promoter), or in particular cell types (e.g., retinal photoreceptor cells). Regulatory elements may also direct expression in a temporal-dependent
manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific. In some embodiments, a nucleic acid of the disclosure comprises one or more pol III promoter (e.g., 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g., 1, 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g., 1, 2, 3, 4, 5, or more pol I promoters), or combinations thereof, e.g., to express a gRNA and a Cas9 protein separately. Examples of pol III promoters include, but are not limited to, U6 and H1 promoters. Examples of pol II promoters include, but are not limited to, the retroviral Rous Sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) (see, e.g., Boshart et at, Cell, 1985, 41:521-530), the SV40 promoter, the dihydrofolate reductase promoter, the b-actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EF1a promoter. Exemplary enhancer elements include WPRE; CMV enhancers; the R-U5' segment in LTR of HTLV-I;
SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit b-globin. It will be appreciated by those skilled in the art that the design of an expression vector can depend on such factors as the choice of the host cell, the level of expression desired, etc.
[0147] A polynucleotide encoding a guide RNA, a DNA endonuclease, and/or any additional nucleic acid or proteinaceous molecule advantageous for carrying out the various aspects of the methods disclosed herein can be comprised within vector (e.g., a recombinant expression vector).
[0148] The term "vector" refers to a polynucleotide molecule capable of transporting another nucleic acid to which it has been linked. One type of polynucleotide vector includes a "plasmid", which refers to a circular double-stranded DNA loop into which additional nucleic acid segments are or can be ligated. Another type of polynucleotide vector is a viral vector; wherein additional nucleic acid segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
[0149] In some examples, vectors can be capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors can be referred to herein as "recombinant expression vectors", or more simply "expression vectors", which serve equivalent functions.
[0150] The term "operably linked" means that the nucleotide sequence of interest is linked to regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence. The term "regulatory sequence" is intended to include, for example, promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are well known in the art and are described, for example, in Goeddel; Gene Expression
Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cells, and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the target cell, the level of expression desired, and the like.
[0151] Vectors can include, but are not limited to, viral vectors based on vaccinia virus, poliovirus, adenovirus, adeno-associated virus (e.g., AAV2, AAV5, AAV7m8, AAV8) , SV40, herpes simplex virus, human immunodeficiency virus, retrovirus (e.g., Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a lentivirus, human immunodeficiency virus, myeloproliferative sarcoma virus, and mammary tumor virus) and other recombinant vectors. Other vectors contemplated for eukaryotic target cells include, but are not limited to, the vectors pXTI, pSG5, pSVK3, pBPV, pMSG, and pSVLSV40 (Pharmacia). Additional vectors contemplated for eukaryotic target cells include, but are not limited to, the vectors pCTx-l, pCTx-2, and pCTx-3. Other vectors can be used so long as they are compatible with the host cell.
[0152] In some examples, a vector can comprise one or more transcription and/or translation control elements. Depending on the host/vector system utilized, any of a number of suitable transcription and translation control elements, including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc. can be used in the expression vector. The vector can be a self-inactivating vector that either inactivates the viral sequences or the components of the CRISPR machinery or other elements.
[0153] Non-limiting examples of suitable eukaryotic promoters (promoters functional in a eukaryotic cell) include those from cytomegalovirus (CMV) immediate early, herpes simplex virus (HSV) thymidine kinase, early and late SV40, long terminal repeats (LTRs) from retrovirus, human elongation factor-l promoter (EF1), e.g., EF1 alpha short promoter, a hybrid construct comprising the cytomegalovirus (CMV) enhancer fused to the chicken beta-actin promoter (CAG), murine stem cell virus promoter (MSCV), phosphoglycerate kinase-1 locus promoter (PGK), and mouse metallothionein-l.
[0154] For expressing guide RNAs, various promoters such as RNA polymerase III promoters, including for example U6 and H1, can be advantageous. Descriptions of and parameters for enhancing the use of such promoters are known in art; see, e.g., Ma, et. al., 2014, Molecular Therapy - Nucleic Acids 3, el 61. In some embodiments, a U6 promoter is used to drive expression of a gRNA. In other embodiments, a H1 promoter is used to drive expression a gRNA.
[0155] An expression vector can also contain a ribosome binding site for translation initiation and a transcription terminator. The expression vector can also comprise appropriate sequences for amplifying expression. The expression vector can also include nucleotide sequences encoding non-native tags (e.g., histidine tag, hemagglutinin tag, green fluorescent protein, etc.) that are fused to the site-directed polypeptide, thus resulting in a fusion protein.
[0156] A promoter can be an inducible promoter (e.g., a heat shock promoter, tetracycline- regulated promoter, steroid-regulated promoter, metal-regulated promoter, estrogen receptor- regulated promoter, etc.). The promoter can be a constitutive promoter (e.g., CMV promoter, UBC promoter, an EF1 alpha promoter, e.g., EF1 alpha short (EFS) promoter). In some cases, the promoter can be a spatially restricted and/or temporally restricted promoter (e.g., a tissue specific promoter, a cell type specific promoter, etc.). In some embodiments, a RHO promoter is used to drive expression of a Cas9 protein. In other embodiments, a hGRK1 promoter is used to drive expression of a Cas9 protein.
[0157] The disclosure also provides a host cell comprising a nucleic acid of the disclosure.
Such host cells can be used, for example, to produce virus particles encoding a gRNA of the disclosure and, optionally, a DNA endonuclease such as a Cas9 protein. In some embodiments, host cells are used to produce virus particles encoding a gRNA (but no Cas9 protein) and to produce virus particles encoding a Cas9 protein (but no gRNA). The virus particles encoding a gRNA and the virus particles encoding a Cas9 can then be used together to deliver a gRNA and Cas9 to a cell (e.g., by combining the virus particles into a single composition which is then contacted with the cell or by separately contacting the cell with the different virus particles). Host cells can also be used to make vesicles containing a gRNA and, optionally, a DNA endonuclease such as a Cas9 protein (e.g., as described in Montagna eta!., 2018, Molecular Therapy: Nucleic Acids, 12:453-462). Exemplary host cells include eukaryotic cells, e.g., mammalian cells. Exemplary mammalian host cells include human cell lines such as BHK-21, BSRT7/5, VERO, WI38, MRC5, A549, HEK293, HEK293T, Caco-2, B-50 or any other HeLa cells, HepG2, Saos-2, HuH7, and HT1080 cell lines. Host cells can be engineered host cells, for example, host cells engineered to express a DNA binding protein such a repressor (e.g., TetR), to regulate virus or vesicle production (see Petris eta!., 2017, Nature Communications, 8:15334).
[0158] Host cells can also be used to propagate the gRNA coding sequences of the disclosure. The host cell can be a eukaryote or prokaryote and includes, for example, yeast (such as Pichia pastoris or Saccharomyces cerevisiae), bacteria (such as E. coli or Bacillus subtilis), insect Sf9 cells (such as baculovirus-infected SF9 cells) or mammalian cells (such as Human Embryonic Kidney (HEK) cells, Chinese hamster ovary cells, HeLa cells, human 293 cells and monkey COS-7 cells).
6.5. Systems, Particles, and Cells
[0159] The disclosure further provides systems comprising a gRNA of the disclosure and a DNA endonuclease such as a Cas9 protein. The systems can comprise a ribonucleoprotein particle (RNP) in which a gRNA as described herein is complexed with a DNA endonuclease such as a Cas9 protein. The Cas9 protein can be, for example, a Cas9 protein described in Section 6.3. Systems of the disclosure can further comprise genomic DNA complexed with the gRNA and the DNA endonuclease. Accordingly, the disclosure provides a system comprising a gRNA of the disclosure, a genomic DNA comprising a RHO gene, and a DNA endonuclease such as Cas9, all complexed with one another. Systems of the disclosure can further comprise a second gRNA. For example, a system can comprise a first gRNA for targeting the rs7984 SNP and a second gRNA targeting intron 1 of the RHO gene.
[0160] The systems of the disclosure can exist within a cell (whether the cell is in vivo, ex vivo, or in vitro) or outside a cell (e.g., in a particle our outside of a particle).
[0161] The disclosure further provides particles comprising a gRNA of the disclosure and provides particles comprise a nucleic acid encoding a gRNA of the disclosure. The particles can further comprise a DNA endonuclease such as a Cas9 protein, e.g., a Cas9 protein described in Section 6.3, or a nucleic acid encoding the Cas9 protein (e.g., DNA or mRNA). Exemplary particles include lipid nanoparticles, vesicles, and gold nanoparticles. In some embodiments, a particle contains only a single species of gRNA.
[0162] The disclosure further provides particles (e.g., virus particles) comprising a nucleic acid encoding a gRNA of the disclosure. The particles can further comprise a nucleic acid encoding a Cas9 protein.
[0163] The disclosure further provides pluralities of particles (e.g., pluralities of virus particles). Such pluralities can include a particle encoding one or more gRNAs (e.g., two) and a different particle encoding a Cas9 protein. For example, a plurality of particles can comprise a virus particle (e.g., a AAV2, AAV5, AAV7m8, or AAV8 virus particle) encoding one or more gRNAs and a second virus particle (e.g., a AAV2, AAV5, AAV5, AAV7m8, or AAV8 virus particle) encoding a Cas9 protein. In some embodiments, the virus particle encoding one or more gRNAs encodes a first gRNA targeting the rs7984 SNP and a second gRNA targeting intron 1 of the RHO gene.
[0164] The disclosure further provides cells and populations of cells (e.g., a population comprising 10 or more, 50 or more 100 or more, 1,000 or more, or 100,000 thousand or more cells) comprising a gRNA of the disclosure. Such cells and populations can further comprise a DNA endonuclease such as a Cas9 protein or a nucleic acid encoding the Cas9 protein (e.g., DNA or mRNA). In some embodiments, such cells and populations are isolated, e.g., isolated
from cells not containing the gRNA. The cells and populations of cells can be, for example, human cells such as a iPSC, retinal cell, photoreceptor cell, retinal progenitor cell, etc.
[0165] The cell populations of the disclosure can be cells in which gene editing by the systems of the disclosure has taken place, or cells in which the components of a system of the disclosure have been expressed but gene editing has not taken place, or a combination thereof. A cell population can comprise, for example, a population in which at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, or at least 70% of the cells have undergone gene editing by a system of the disclosure.
[0166] In the systems, particles, cells and cell populations of the disclosure comprising a Cas9 protein, the Cas9 protein should be a Cas9 protein capable of recognizing a PAM near (e.g., adjacent) to the target sequence corresponding to the gRNA’s spacer sequence.
6.6. Pharmaceutical Compositions
[0167] Also disclosed herein are pharmaceutical formulations and medicaments comprising a gRNA or plurality of gRNAs, Cas9 protein, nucleic acid or plurality of nucleic acids, system, particle, or plurality of particles of the disclosure together with a pharmaceutically acceptable excipient.
[0168] Suitable excipients include, but are not limited to, salts, diluents, (e.g., Tris-HCI, acetate, phosphate), preservatives (e.g., Thimerosal, benzyl alcohol, parabens), binders, fillers, solubilizers, disintegrants, sorbents, solvents, pH modifying agents, antioxidants, antinfective agents, suspending agents, wetting agents, viscosity modifiers, tonicity agents, stabilizing agents, and other components and combinations thereof. Suitable pharmaceutically acceptable excipients can be selected from materials which are generally recognized as safe (GRAS), and may be administered to an individual without causing undesirable biological side effects or unwanted interactions. Suitable excipients and their formulations are described in Remington's Pharmaceutical Sciences, 16th ed. 1980, Mack Publishing Co. In addition, such compositions can be complexed with polyethylene glycol (PEG), metal ions, or incorporated into polymeric compounds such as polyacetic acid, polyglycolic acid, hydrogels, etc., or incorporated into liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts or spheroblasts. Suitable dosage forms for administration, e.g., parenteral administration, include solutions, suspensions, and emulsions.
[0169] The components of the pharmaceutical formulation can be dissolved or suspended in a suitable solvent such as, for example, water, Ringer's solution, phosphate buffered saline (PBS), or isotonic sodium chloride. The formulation may also be a sterile solution, suspension, or emulsion in a nontoxic, parenterally acceptable diluent or solvent such as 1,3-butanediol.
[0170] In some cases, formulations can include one or more tonicity agents to adjust the isotonic range of the formulation. Suitable tonicity agents are well known in the art and include glycerin, mannitol, sorbitol, sodium chloride, and other electrolytes. In some cases, the formulations can be buffered with an effective amount of buffer necessary to maintain a pH suitable for parenteral administration. Suitable buffers are well known by those skilled in the art and some examples of useful buffers are acetate, borate, carbonate, citrate, and phosphate buffers.
[0171] In some embodiments, the formulation can be distributed or packaged in a liquid form, or alternatively, as a solid, obtained, for example by lyophilization of a suitable liquid formulation, which can be reconstituted with an appropriate carrier or diluent prior to administration. In some embodiments, the formulations can comprise one or more guide RNAs and a DNA endonuclease (or one or more nucleic acids encoding the gRNA(s) and DNA endonuclease, where such nucleic acids can be in one or more particles such as AAV particles) in a pharmaceutically effective amount sufficient to edit a RHO gene having a pathogenic mutation in a cell. In some embodiments, the formulations can comprise one or more guide RNAs and a DNA endonuclease (or one or more nucleic acids encoding the gRNA(s) and DNA endonuclease, where such nucleic acids can be in one or more particles such as AAV particles) in a pharmaceutically effective amount sufficient to treat retinitis pigmentosa.
6.7. Methods of Altering a Cell
[0172] The disclosure further provides methods of using the gRNAs, nucleic acids (including pluralities of nucleic acids), Cas9 proteins, systems, and particles (including pluralities of particles) of the disclosure for altering cells. Methods of the disclosure can be used, for example, to treat subjects having a RP caused by a pathogenic mutation in their RHO gene, for example a P23 or P347 mutation, and in particular subjects who are heterozygous for the rs7984 SNP.
[0173] In one aspect, a method of altering a cell comprises contacting a human cell having a RHO gene with a pathogenic mutation with a nucleic acid (or plurality of nucleic acids), particle (or plurality of particles), system (or plurality of systems) or pharmaceutical composition (or plurality of pharmaceutical compositions) described herein. The cell is preferably heterozygous for the rs7984 SNP and heterozygous for the pathogenic mutation. Methods of the disclosure can comprise a genotyping step to determine whether the cell is heterozygous for the rs7984 SNP, and to determine which allele of the rs7984 SNP is in phase with the RHO allele having the pathogenic mutation (e.g., by genotyping the subject from which the cell is obtained or present in). By using a gRNA targeting the allele of the rs7984 SNP that is in phase with the RHO allele having the pathogenic mutation, the RHO allele having the pathogenic mutation can be targeted for editing in an allele specific manner.
[0174] Contacting a cell with a disclosed nucleic acid, particle, system or pharmaceutical composition can be achieved by any method known in the art and can be performed in vivo, ex vivo, or in vitro. In some embodiments, the methods can include obtaining one or more cells from a subject prior to contacting the cell(s) with a herein disclosed nucleic acid, particle, system or pharmaceutical composition. In some embodiments, the methods can further comprise returning or implanting the contacted cell or a progeny thereof to the subject.
[0175] Guide RNAs and endonucleases, as well as nucleic acids encoding gRNAs and nucleic acids encoding endonucleases can be delivered to a cell by any means known in the art, for example, by viral or non-viral delivery vehicles, electroporation or lipid nanoparticles. DNA endonucleases can be delivered to a cell as one or more polypeptides, either alone or pre- complexed with one or more guide RNAs, or as a nucleic acid (DNA or RNA) encoding the DNA endonuclease.
[0176] Polynucleotides, such as gRNA and/or a polynucleotide encoding an endonuclease, can be delivered to a cell (ex vivo or in vivo) by a lipid nanoparticle (LNP). LNPs can have, for example, a diameter of less than 1000 nm, 500 nm, 250 nm, 200 nm, 150 nm, 100 nm, 75 nm, 50 nm, or 25 nm. Alternatively, a nanoparticle can range in size from 1-1000 nm, 1-500 nm, 1- 250 nm, 25-200 nm, 25-100 nm, 35-75 nm, or 25-60 nm. LNPs can be made from cationic, anionic, neutral lipids, and combinations thereof. Neutral lipids, such as the fusogenic phospholipid DOPE or the membrane component cholesterol, can be included in LNPs as 'helper lipids' to enhance transfection activity and nanoparticle stability.
[0177] LNPs can also be comprised of hydrophobic lipids, hydrophilic lipids, or both hydrophobic and hydrophilic lipids. Lipids and combinations of lipids that are known in the art can be used to produce a LNP. Examples of lipids used to produce LNPs are: DOTMA,
DOSPA, DOTAP, DMRIE, DC- cholesterol, DOTAP-cholesterol, GAP-DMORIE-DPyPE, and GL67A-DOPE-DMPE- polyethylene glycol (PEG). Examples of cationic lipids are: 98N12-5, C12-200, DLin-KC2- DMA (KC2), DLin-MC3-DMA (MC3), XTC, MD1, and 7C1. Examples of neutral lipids are: DPSC, DPPC, POPC, DOPE, and SM. Examples of PEG-modified lipids are: PEG-DMG, PEG- CerCI4, and PEG-CerC20. Lipids can be combined in any number of molar ratios to produce a LNP. In addition, the polynucleotide(s) can be combined with lipid(s) in a wide range of molar ratios to produce a LNP.
[0178] Guide RNAs and/or DNA endonucleases can be delivered to a cell via an adeno- associated viral vector {e.g., of an AAV2, AAV5, AAV7m8, AAV8, AAV9, or AAVrh8r serotype), or by another viral vector. Other viral vectors include, but are not limited to lentivirus, adenovirus, alphavirus, enterovirus, pestivirus, baculovirus, herpesvirus, Epstein Barr virus, papovavirusr, poxvirus, vaccinia virus, and herpes simplex virus. In some embodiments, a Cas9 mRNA is formulated in a lipid nanoparticle, while a sgRNA is delivered to a cell in an AAV or
other viral vector. In some embodiments, one or more AAV vectors (e.g., one or more AAV2, AAV5, AAV7m8, or AAV8 viral vectors) are used to deliver both a sgRNA and a Cas9. In some embodiments, a sgRNA or combination of sgRNAs and a Cas9 are delivered using separate vectors. For example, a first AAV vector encoding a sgRNA targeting the rs7984 SNP and a sgRNA targeting RHO intron 1 can be used to deliver the sgRNAs, and a second AAV vector encoding a Cas9 protein can be used to deliver the Cas9 protein. The first and second AAV vectors can be in a single composition. Alternatively, separate compositions of the first and second AAV vectors can be used.
[0179] Compositions and methods for administering gRNAs and endonucleases to a cell and/or subject are further described in PCT Patent Application Publication WO 2019/102381 , which is incorporated by reference herein in its entirety.
[0180] DNA cleavage can result in a single-strand break (SSB) or double-strand break (DSB) at particular locations within the DNA molecule. Such breaks can be and regularly are repaired by natural, endogenous cellular processes, such as homology-dependent repair (HDR) and non- homologous end-joining (NHEJ). These repair processes can edit the targeted polynucleotide by introducing a mutation, thereby resulting in a polynucleotide having a sequence which differs from the polynucleotide’s sequence prior to cleavage by a DNA endonuclease.
[0181] NHEJ and HDR DNA repair processes consist of a family of alternative pathways. Non- homologous end-joining (NHEJ) refers to the natural, cellular process in which a double- stranded DNA-break is repaired by the direct joining of two non-homologous DNA segments. See, e.g. Cahill etai, 2006, Front. Biosci. 11:1958-1976. DNA repair by non-homologous end joining is error-prone and frequently results in the untemplated addition or deletion of DNA sequences at the site of repair. Thus, NHEJ repair mechanisms can introduce mutations into the coding sequence which can disrupt gene function. NHEJ directly joins the DNA ends resulting from a double-strand break, sometimes with a modification of the polynucleotide sequence such as a loss of or addition of nucleotides in the polynucleotide sequence. The modification of the polynucleotide sequence can disrupt (or perhaps enhance) gene expression.
[0182] Homology-dependent repair (HDR) utilizes a homologous sequence, or donor sequence, as a template for inserting a defined DNA sequence at the break point. The homologous sequence can be in the endogenous genome, such as a sister chromatid. Alternatively, the donor can be an exogenous nucleic acid, such as a plasmid, a single-strand oligonucleotide, a double- stranded oligonucleotide, a duplex oligonucleotide or a virus, that has regions of high homology with the nuclease-cleaved locus, but which can also contain additional sequence or sequence changes including deletions that can be incorporated into the cleaved target locus.
[0183] A third repair mechanism includes microhomology-mediated end joining (MMEJ), also referred to as “Alternative NHEJ (ANHEJ)”, in which the genetic outcome is similar to NHEJ in that small deletions and insertions can occur at the cleavage site. MMEJ can make use of homologous sequences of a few base pairs flanking the DNA break site to drive a more favored DNA end joining repair outcome. In some instances, it may be possible to predict likely repair outcomes based on analysis of potential microhomologies at the site of the DNA break.
[0184] Modifications of a cleaved polynucleotide by HDR, NHEJ, and/or ANHEJ can result in, for example, mutations, deletions, alterations, integrations, gene correction, gene replacement, gene tagging, transgene insertion, nucleotide deletion, gene disruption, translocations and/or gene mutation. The aforementioned process outcomes are examples of editing a polynucleotide.
[0185] Accordingly, in some embodiments, the contacting step of the methods of the disclosure results in the editing of a RHO gene comprising a pathogenic mutation. For example, the editing of the RHO gene comprising a pathogenic mutation can include deletion, insertion, or substitution of one or more nucleotides in the RHO gene. In some embodiments, editing of the RHO gene comprising a pathogenic mutation results in a deletion of one or more nucleotides in the RHO gene.
[0186] The methods can provide for advantageous and/or therapeutic results in the cell and/or the subject in which the cell is located. In some embodiments, the methods can reduce expression of the RHO gene comprising a pathogenic mutation. Thus, the methods can reduce the amount of RHO protein comprising a pathogenic mutation within the contacted cell and/or progeny thereof. In some embodiments, the methods can decrease the amount of misfolded RHO protein within the cell and/or progeny thereof. In some embodiments, the methods can decrease the amount of mislocalized RHO protein within the cell and/or progeny thereof. In some embodiments, the methods can decrease the rate of or amount of cell death. In some embodiments, the methods can delay, slow progression, halt, or reverse onset of a RHO- associated disease such as retinitis pigmentosa (RP). In some embodiments, the amount of a wild-type RHO protein is not significantly reduced.
[0187] In one aspect, the disclosure provides methods for treating a subject having a pathogenic mutation using the gRNAs, nucleic acids, systems, and particles of the disclosure. The methods can comprise editing a RHO allele in one or more cells from the subject or one or more cells derived from a cell of the subject (e.g., an induced pluripotent stem cell (iPSC)). For example, one or more cells from the subject or one or more cells derived from a cell of the subject can be contacted with a gRNA, nucleic acid, system, or particle of the disclosure ex vivo, and cells having an edited RHO gene or progeny thereof can subsequently be implanted into the subject. iPSCs can be generated from epithelial cells of a subject by technologies
known to the skilled artisan. The chromosomal DNA of such iPSC cells can be edited using the materials and methods described herein. Repair of the cleaved DNA (e.g., by insertion, deletion, substitution, or frameshift mutations) can result in editing of the RHO gene at the site of the single- or double-strand break. Edited iPSCs can subsequently be differentiated, for instance into photoreceptor cells or retinal progenitor cells. In some embodiments, resultant differentiated cells can be implanted into the subject.
[0188] In some aspects of the methods, differentiated cells of subject can be used. For example, photoreceptor cells or retinal progenitor cells can be used (e.g., following isolation from the subject). In such methods, implantation of edited cells can proceed without an intervening differentiation step.
[0189] Advantages of ex vivo cell therapy approaches include the ability to conduct a comprehensive analysis of the therapeutic prior to administration. Nuclease-based therapeutics can have some level of off-target effects. Performing gene correction ex vivo allows a method user to characterize the corrected cell population prior to implantation, including identifying any undesirable off-target effects. Where undesirable effects are observed, a method user may opt not to implant the cells or cell progeny, may further edit the cells, or may select new cells for editing and analysis. Other advantages include ease of genetic correction in iPSCs compared to other primary cell sources. iPSCs are prolific, making it easy to obtain the large number of cells that will be required for a cell-based therapy. Furthermore, iPSCs are an ideal cell type for performing clonal isolations. This allows screening for the correct genomic correction, without risking a decrease in viability.
[0190] In another aspect, the disclosure provides in vivo methods for treating a subject with a pathogenic RHO mutation. In some aspects, the method is an in vivo cell-based therapy. Chromosomal DNA of the cells in the subject can be edited using the materials and methods described herein. For example, the in vivo method can comprise editing a RHO gene having a pathogenic mutation in a cell of a subject, such as photoreceptor cells or retinal progenitor cells. In some embodiments, the in vivo methods comprise administering one or more pharmaceutical compositions of the disclosure to or near the eye of a subject, e.g., by sub-retinal injection or intravitreal injection. For example, a single pharmaceutical composition comprising a first AAV encoding one or more gRNAs (e.g., a gRNA targeting the rs7984 SNP and a gRNA targeting RHO intron 1) and a second AAV encoding a Cas9 protein can be used; or alternatively, a first pharmaceutical composition comprising the first AAV and a second, separate pharmaceutical composition comprising the second AAV can be used. When multiple pharmaceutical compositions are used, they are preferably administered sufficiently close in time so that the first and second AAVs and/or gRNA(s) and Cas9 protein(s) encoded thereby are present together in vivo.
[0191] Although certain cells present an attractive target for ex vivo treatment and therapy, increased efficacy in delivery may permit direct in vivo delivery to such cells. Ideally the targeting and editing is directed to the relevant cells. Cleavage in other cells can also be prevented by the use of promoters only active in certain cell types and/or developmental stages.
[0192] Additional promoters are inducible, and therefore can be temporally controlled if the nuclease is delivered as a plasmid. The amount of time that delivered RNA and protein remain in the cell can also be adjusted using treatments or domains added to change the half-life. In vivo treatment would eliminate a number of treatment steps, but a lower rate of delivery can require higher rates of editing. In vivo treatment can eliminate problems and losses from ex vivo treatment and engraftment.
[0193] An advantage of in vivo gene therapy can be the ease of therapeutic production and administration. Administration can be, for example, by sub-retinal injection of one or more pharmaceutical composition. Administration can be alternatively be, for example, by intravitreal injection of one or more pharmaceutical compositions. The same therapeutic approach and therapy has the potential to be used to treat more than one patient, for example a number of patients who share the same or similar genotype or allele. In contrast, ex vivo cell therapy typically requires using a subject’s own cells, which are isolated, manipulated and returned to the same patient.
[0194] For ameliorating a disorder associated with RHO (e.g., retinitis pigmentosa), the principal targets for gene editing can be within a cell such as a human cell. For example, in an ex vivo method, human cells can be somatic cells, which after being modified using techniques described herein, can give rise to differentiated cells, e.g., photoreceptor cells or retinal progenitor cells. In an in vivo method, human cells can be photoreceptor cells or retinal progenitor cells. By performing gene editing in autologous cells that are derived from and therefore already completely matched with a subject, it is possible to generate cells that can be safely re-introduced into the subject, and effectively give rise to a population of cells that can be effective in ameliorating one or more clinical conditions associated with the subject’s disease.
[0195] Progenitor cells (also referred to as stem cells herein) are capable of both proliferation and giving rise to more progenitor cells, which in turn have the ability to generate a large number of cells that can in turn give rise to differentiated or differentiable daughter cells. The daughter cells themselves can be induced to proliferate and produce progeny that subsequently differentiate into one or more mature cell types, while also retaining one or more cells with parental developmental potential. The term "stem cell" refers then to a cell with the capacity or potential, under particular circumstances, to differentiate to a more specialized or differentiated phenotype, and which retains the capacity, under certain circumstances, to proliferate without
substantially differentiating. In one aspect, the term progenitor or stem cell refers to a generalized mother cell whose descendants (progeny) specialize, often in different directions, by differentiation, e.g., by acquiring completely individual characters, as occurs in progressive diversification of embryonic cells and tissues. Cellular differentiation is a complex process typically occurring through many cell divisions. A differentiated cell can derive from a multipotent cell that itself is derived from a multipotent cell, and so on. While each of these multipotent cells can be considered stem cells, the range of cell types that each can give rise to can vary considerably. Some differentiated cells also have the capacity to give rise to cells of greater developmental potential. Such capacity can be natural or can be induced artificially upon treatment with various factors. In many biological instances, stem cells can also be "multipotent" because they can produce progeny of more than one distinct cell type, but this is not required.
[0196] Human cells described herein can be induced pluripotent stem cells (iPSCs). An advantage of using iPSCs in the methods of the disclosure is that the cells can be derived from the same subject to which the progenitor cells are to be administered. That is, a somatic cell can be obtained from a subject, reprogrammed to an induced pluripotent stem cell, and then differentiated into a progenitor cell to be administered to the subject (e.g., an autologous cell). Because progenitors are essentially derived from an autologous source, the risk of engraftment rejection or allergic response can be reduced compared to the use of cells from another subject or group of subjects. In addition, the use of iPSCs negates the need for cells obtained from an embryonic source. Thus, in one aspect, the stem cells used in the disclosed methods are not embryonic stem cells.
[0197] Methods are known in the art that can be used to generate pluripotent stem cells from somatic cells. Pluripotent stem cells generated by such methods can be used in the method of the disclosure.
[0198] Reprogramming methodologies for generating pluripotent cells using defined combinations of transcription factors have been described. Mouse somatic cells can be converted to ES cell-like cells with expanded developmental potential by the direct transduction of Oct4, Sox2, Klf4, and c-Myc; see, e.g., Takahashi and Yamanaka, 2006, Cell 126(4): 663-76. iPSCs resemble ES cells, as they restore the pluripotency-associated transcriptional circuitry and much of the epigenetic landscape. In addition, mouse iPSCs satisfy all the standard assays for pluripotency: specifically, in vitro differentiation into cell types of the three germ layers, teratoma formation, contribution to chimeras, germline transmission (see, e.g., Maherali and Hochedlinger, 2008, Cell Stem Cell. 3(6): 595-605), and tetraploid complementation.
[0199] Human iPSCs can be obtained using similar transduction methods, and the transcription factor trio, OCT4, SOX2, and NANOG, has been established as the core set of transcription
factors that govern pluripotency; see, e.g., 2014, Budniatzky and Gepstein, Stem Cells Transl Med. 3(4):448-57; Barrett etal, 2014, Stem Cells Trans Med 3: 1-6 sctm.2014-0121; Focosi et al, 2014, Blood Cancer Journal 4: e211. The production of iPSCs can be achieved by the introduction of nucleic acid sequences encoding stem cell-associated genes into an adult, somatic cell, historically using viral vectors.
[0200] iPSCs can be generated or derived from terminally differentiated somatic cells, as well as from adult stem cells, or somatic stem cells. That is, a non-pluripotent progenitor cell can be rendered pluripotent or multipotent by reprogramming. In such instances, it may not be necessary to include as many reprogramming factors as required to reprogram a terminally differentiated cell. Further, reprogramming can be induced by the non-viral introduction of reprogramming factors, e.g., by introducing the proteins themselves, or by introducing nucleic acids that encode the reprogramming factors, or by introducing messenger RNAs that upon translation produce the reprogramming factors (see e.g., Warren et al., 2010, Cell Stem Cell, 7(5):6I8- 30. Reprogramming can be achieved by introducing a combination of nucleic acids encoding stem cell-associated genes, including, for example, Oct-4 (also known as Oct-3/4 or Pouf5l), Soxl, Sox2, Sox3, Sox 15, Sox 18, NANOG, Klfl, Klf2, Klf4, Klf5, NR5A2, c-Myc, 1- Myc, n-Myc, Rem2, Tert, and LIN28. Reprogramming using the methods and compositions described herein can further comprise introducing one or more of Oct-3/4, a member of the Sox family, a member of the Klf family, and a member of the Myc family to a somatic cell. The methods and compositions described herein can further comprise introducing one or more of each of Oct-4, Sox2, Nanog, c-MYC and Klf4 for reprogramming. As noted above, the exact method used for reprogramming is not necessarily critical to the methods and compositions described herein. However, where cells differentiated from the reprogrammed cells are to be used in, e.g., human therapy, in one aspect the reprogramming is not affected by a method that alters the genome. Thus, in such examples, reprogramming can be achieved, e.g., without the use of viral or plasmid vectors.
[0201] Efficiency of reprogramming (the number of reprogrammed cells) derived from a population of starting cells can be enhanced by the addition of various agents, e.g., small molecules, as shown by Shi et al., 2008, Cell-Stem Cell 2:525-528; Huangfu et al., 2008,
Nature Biotechnology 26(7):795-797; and Marson etal., 2008, Cell-Stem Cell 3: 132-135. Thus, an agent or combination of agents that enhance the efficiency or rate of induced pluripotent stem cell production can be used in the production of patient-specific or disease-specific iPSCs.
Some non-limiting examples of agents that enhance reprogramming efficiency include soluble
Wnt, Wnt conditioned media, BIX-01294 (a G9a histone methyltransferase), PD0325901 (a
MEK inhibitor), DNA methyltransferase inhibitors, histone deacetylase (HD AC) inhibitors, valproic acid, 5'-azacytidine, dexamethasone, suberoylanilide, hydroxamic acid (SAHA), vitamin
C, and trichostatin (TSA), among others. Other non-limiting examples of reprogramming
enhancing agents include: Suberoylanilide Hydroxamic Acid (SAHA ( e.g MK0683, vorinostat) and other hydroxamic acids), BML-210, Depudecin (e.g., (-)-Depudecin), HC Toxin, Nullscript (4-(l,3-Dioxo-IH,3H-benzo[de]isoquinolin-2-yl)-N-hydroxybutanamide), Phenylbutyrate (e.g., sodium phenylbutyrate) and Valproic Acid ((VP A) and other short chain fatty acids), Scriptaid, Suramin Sodium, Trichostatin A (TSA), APHA Compound 8, Apicidin, Sodium Butyrate, pi valoyloxy methyl butyrate (Pivanex, AN-9), Trapoxin B, Chlamydocin, Depsipeptide (also known as FR901228 or FK228), benzamides (e.g., CI-994 (e.g., N-acetyl dinaline) and MS-27- 275), MGCD0103, NVP-l-AQ-824, CBHA (m-carboxycinnaminic acid bishydroxamic acid),
JNJ16241199, Tubacin, A-161906, proxamide, oxamflatin, 3-C1-UCHA (e.g., 6-(3- chlorophenylureido)caproic hydroxamic acid), AOE (2-amino-8-oxo-9, 10-epoxy decanoic acid), CHAP31 and CHAP 50. Other reprogramming enhancing agents include, for example, dominant negative forms of the HDACs (e.g, catalytically inactive forms), siRNA inhibitors of the HDACs, and antibodies that specifically bind to the HDACs. Such inhibitors are available, e.g., from BIOMOL International, Fukasawa, Merck Biosciences, Novartis, Gloucester Pharmaceuticals, Titan Pharmaceuticals, MethylGene, and Sigma Aldrich.
[0202] To confirm the induction of pluripotent stem cells, isolated clones can be tested for the expression of a stem cell marker. Such expression in a cell derived from a somatic cell identifies the cells as induced pluripotent stem cells. Stem cell markers can be selected from the non-limiting group including SSEA3, SSEA4, CD9, Nanog, Fbxl5, Ecatl, Esgl, Eras, Gdfi, Fgf4, Cripto, Daxl, Zpf296, Slc2a3, Rexl, Utfl, and Natl. In one case, for example, a cell that expresses Oct4 or Nanog is identified as pluripotent. Methods for detecting the expression of such markers can include, for example, RT-PCR and immunological methods that detect the presence of the encoded polypeptides, such as Western blots or flow cytometric analyses. Detection can involve not only RT-PCR, but also detection of protein markers. Intracellular markers can be best identified via RT-PCR, or protein detection methods such as immunocytochemistry, while cell surface markers are readily identified, e.g., by immunocytochemistry.
[0203] Pluripotency of isolated cells can be confirmed by tests evaluating the ability of the iPSCs to differentiate into cells of each of the three germ layers. As one example, teratoma formation in nude mice can be used to evaluate the pluripotent character of the isolated clones. The cells can be introduced into nude mice and histology and/or immunohistochemistry can be performed on a tumor arising from the cells. The growth of a tumor comprising cells from all three germ layers, for example, further indicates that the cells are pluripotent stem cells.
[0204] In some examples, the cells used in the method described herein are photoreceptor cells or retinal progenitor cells (RPCs). RPCs are multipotent progenitor cells that can give rise to all the six neurons of the retina as well as the Muller glia. Muller glia are a type of retinal glial
cells and are the major glial component of the retina. Their function is to support the neurons of the retina and to maintain retinal homeostasis and integrity. Muller glia isolated from adult human retinas have been shown to differentiate into rod photoreceptors. Functional characterization of such Muller glia-derived photoreceptors by patch-clamp recordings has revealed that their electrical properties are comparable to those of adult rods (Giannelli et at,, 2011, Stem Cells, (2):344-56). RPCs are gradually specified into lineage-restricted precursor cells during retinogenesis, which then maturate into the terminally differentiated neurons or Muller glia. Fetal-derived human retinal progenitor cells (hRPCs) exhibit molecular characteristics indicative of a retinal progenitor state up to the sixth passage. They demonstrate a gradual decrease in the percentages of KI67-, SOX2-, and vimentin-positive cells from passages 1 to 6, whereas a sustained expression of nestin and PAX6 is seen through passage 6.
[0205] Microarray analysis of passage 1 hRPCs demonstrate the expression of early retinal developmental genes: VIM (vimentin), KI67, NES (nestin), PAX6, SOX2, HES5, GNL3, OTX2, DACH1, SIX6, and CHX10 (VSX2). The hRPCs are functional in nature and respond to excitatory neurotransmitters (Schmitt etai, 2009, Investigative Ophthalmology and Visual Sciences. 50(l2):590l-8). The outermost region of the retina contains a supportive retinal pigment epithelium (RPE) layer, which maintains photoreceptor health by transporting nutrients and recycling shed photoreceptor parts. The RPE is attached to Bruch's membrane, an extracellular matrix structure at the interface between the choroid and retina. On the other side of the RPE, moving inwards towards the interior of the eye, there are three layers of neurons: light sensing rod and cone photoreceptors, a middle layer of connecting neurons (amacrine, bipolar and horizontal cells) and the innermost layer of ganglion cells, which transmit signals originating in the photoreceptor layer through the optic nerve and into the brain. In some aspects, the cells described herein are photoreceptor cells, which are specialized types of neurons found in the retina. Photoreceptors convert light into signals that are able to stimulate biological processes and are responsible for sight. Rods and cones are the two classic photoreceptor cells that contribute information to the visual system.
[0206] Retinal cells, including progenitor cells may be isolated according to any method known in the art. For example, retinal cells can be isolated from fresh surgical specimens. The retinal pigment epithelium (RPE) can be separated from the choroid by digesting the tissue with type IV collagenase and the retinal pigment epithelium patches can be cultured. Following the growth of 100-500 cells from the explant, the primary cultures can be passaged (Ishida M. et ai, 1998, Current Eye Research, 17(4): 392-402) and characterized for expression of RPE markers. Rods can be isolated by disruption of the biopsied retina using papain. Precautions can be taken to avoid a harsh disruption and improve cell yield. The isolated cells can be sorted
to yield a population of pure rod cells and characterized further by immunostaining (Feodorova et al. , 2015, MethodsX, 2:39-46).
[0207] To isolate cones, the neural retina can be identified, cut-out, and placed on 10% gelatin. The inner retinal layers can be isolated using a laser. The isolated cone monolayers can be cultured for 18 hours and compared with untreated retinas by light microscopy and transmission microscopy to check for any structural damage. The cells can be characterized for expression of cone-specific markers (Salchow et al., 2001 , Current Eye Research, 22 (2):85-9).
[0208] To isolate retinal progenitor cells, the biopsied retina can be minced with dual scalpels and digested enzymatically in an incubator at 37°C. The supernatants of the digested cells can be centrifuged and the cells can be resuspended in cell-free retinal progenitor-conditioned medium. The cells can be transferred to fibronectin-coated tissue culture flasks containing fresh media and cultured (Klassen et al., 2004, Journal of Neuroscience Research, 77:334-343).
[0209] Patient-specific iPS cells or cell line can be created. There are many established methods in the art for creating patient specific iPS cells, e.g., as described in Takahashi and Yamanaka 2006; Takahashi, Tanabe et al. 2007. For example, the creating step can comprise: a) isolating a somatic cell, such as a skin cell or fibroblast, from the patient; and b) introducing a set of pluripotency-associated genes into the somatic cell in order to induce the cell to become a pluripotent stem cell. The set of pluripotency-associated genes can be one or more of the genes selected from the group consisting of OCT4, SOX1, SOX2, SOX3, SOX15, SOX18, NANOG, KLF1, KLF2, KLF4, KLF5, c-MYC, n-MYC, REM2, TERT and LIN28.
[0210] In some aspects, a biopsy or aspirate of a subject’s bone marrow can be performed. A biopsy or aspirate is a sample of tissue or fluid taken from the body. There are many different kinds of biopsies or aspirates. Nearly all of them involve using a sharp tool to remove a small amount of tissue. If the biopsy will be on the skin or other sensitive area, numbing medicine can be applied first. A biopsy or aspirate can be performed according to any of the known methods in the art. For example, in a bone marrow aspirate, a large needle is used to enter the pelvis bone to collect bone marrow.
[0211] In some aspects, a mesenchymal stem cell can be isolated from a subject.
Mesenchymal stem cells can be isolated according to any method known in the art, such as from a subject’s bone marrow or peripheral blood. For example, marrow aspirate can be collected into a syringe with heparin. Cells can be washed and centrifuged on a Percoll™ density gradient. Cells, such as blood cells, liver cells, interstitial cells, macrophages, mast cells, and thymocytes, can be separated using density gradient centrifugation media, Percoll™. The cells can then be cultured in Dulbecco's modified Eagle's medium (DMEM) (low glucose) containing 10% fetal bovine serum (FBS) (Pittinger et. al., 1999, Science 284: 143-147).
[0212] The methods of the present disclosure can also comprise differentiating genome-edited iPSCs into photoreceptor cells or retinal progenitor cells. The differentiating step may be performed according to any method known in the art. For example, iPSCs can be used to generate retinal organioids and photoreceptors as described in the art (Phillips et al. , 2014, Stem Cells, 32(6): pgs. 1480-1492; Zhong etal., 2014, Nat. Commun., 5:4047; Tucker et al., 2011, PLoS One, 6(4): e18992). For example, hiPSC can be differentiated into retinal progenitor cells using various treatments, including Wnt, Nodal, and Notch pathway inhibitors (Noggin, Dkl, Lefty A, and DAPT) and other growth factors. The retinal progenitor cells can be further differentiated into photoreceptor cells, the treatment including: exposure to native retinal cells in coculture systems, RX+ or Mitf+ by subsequent treatment with retinoic acid and taurine, or exposure to several exogenous factors including Noggin, Dkkl, DAPT, and insulin-like growth factor (Yang et al., 2016, Stem Cells International 2016).
[0213] The methods of the present disclosure can also comprise differentiating the genome- edited mesenchymal stem cells into photoreceptor cells or retinal progenitor cells. The differentiating step can be performed according to any method known in the art.
[0214] The methods of the present disclosure can also comprise implanting the photoreceptor cells or retinal progenitor cells into a subject. This implanting step can be accomplished using any method of implantation known in the art. For example, cells can be injected directly in the subject’s blood or otherwise administered to the subject.
[0215] Another aspect of the methods can include implanting edited photoreceptor cells or retinal progenitor cells into a subject. The implanting step can be accomplished using any method of implantation known in the art. For example, the genetically modified cells can be injected directly in the subject’s eye or otherwise administered to the patient.
7. EXAMPLES
7.1.1. Materials and Methods for Examples 1 to 4 7.1.1.1. Plasmids and oligonucleotides [0216] SpCas9 and several high-fidelity variants were expressed from plasmids containing a CBh-driven expression cassette. The mutations included in each of the evaluated variants is reported in Table 4.
[0217] High-fidelity SpCas9 mutants were generated by site directed mutagenesis starting from the wt SpCas9 expression plasmid. All sgRNAs were expressed from a pUC19 plasmid containing U6-driven Pol III expression cassettes (pUC19-sgRNA). The spacer sequences of the sgRNAs and the oligonucleotides used to generate the expression constructs are reported in Table 5.
[0218] Spacers were cloned as annealed oligonucleotides into a double Bbsl site of the pUC19-sgRNA plasmids containing the corresponding constant sgRNA region for SpCas9.
[0219] The human rhodopsin (RHO) gene was PCR-amplified using the primers RHO_gene-F and RHO_gene-R from genomic DNA extracted from HEK293T/17 cells and cloned into a plasmid containing a doxycycline-inducible CMV-driven expression cassette, generating the pCMV_TO-RHO-wt plasmid. This plasmid was further modified by site-directed mutagenesis to substitute the rs7984A allele in the 5’-UTR with the minor G allele (oligonucleotides Mut- rs7984G-F and Mut-rs7984G-R) and to introduce the P23H (oligonucleotides Mut-P23H-F and Mut-P23H-R) or P347L (oligonucleotides Mut-P347L-F and Mut-P347L-R) mutations, generating the pCMV_TO-RHO-P347L and pCMV_TO-RHO-P347L plasmids. These vectors contained an hygromycin selection marker.
[0220] All PCR products used for preparing plasmid constructs were generated using the Phusion high-fidelity DNA polymerase (ThermoFisher Scientific). All oligonucleotides were obtained from Eurofins Genomics. The oligonucleotides used for cloning are listed in Table 6.
7.1.1.2. Cell Culture
[0221] HEK293T/17 and HEK293 cells were obtained from ATCC. HEK293TetO cells were generated by stable transduction of parental HEK293 cells with a lentiviral vector expressing the tetracycline repressor (TetR) and were selected using blasticidin.HEK293-TetP23H and HEK293-TetP347L cells, expressing the two RHO mutants under a doxycycline-inducible promoter, were generated by stable transfection of parental HEK293TetO cells. Transduced cells were pool-selected with 5 mg/ml of hygromycin (Invivogen) and single clones with a unique integrated transgene copy were selected for following studies. All cells were cultured in a 37°C incubator with 5% CO2 using DMEM supplemented with 10% fetal bovine serum (FBS, Life Technologies), 2 mM L-Glutamine (Life Technologies), 10 U/ml penicillin and 10 mg/ml
streptomycin (Life Technologies) and hygromycin and/or blasticidin as indicated above, when needed. All cell lines were verified mycoplasma-free (PlasmoTest, Invivogen).
7.1.1.3. Transfections
[0222] 105 HEK293T/17, HEK293-TetP23H, HEK293-TetP347L cells were transfected in 24- well plates with 500 ng of Cas9 coding plasmids and 250 ng of the desired pUC19-sgRNA plasmid using TranslT-LT1 (Mirus Bio), according to manufacturer’s instructions. Cells were collected 3 days after transfection for editing events evaluation or 6 days after transfection for other downstream analyses.
7.1.1.4. Evaluation of editing events
[0223] Genomic DNA was extracted from cell pellets using the QuickExtract solution (Lucigen) according to manufacturer’s instructions. The HOT FIREPol Multiplex Mix (Solis Biodyne) was used to amplify the endogenous RHO rs7984 locus using primers RH05end_endo-F and RH05end_endo-R (reported in Table 7) and the integrated mutated RHO using primers RH05end_Tg-F and RH05end_Tg-R (reported in Table 7), specifically detecting the integrated RHO gene. The amplicon pools were run on 1% agarose gel and Sanger sequenced (EasyRun service, Microsynth) using RH05end_endo-R for sequencing of the endogenous locus and either RH05end_Tg-R or RH05end_Tg_int_R (reported in Table 7) for sequencing of the integrated RHO gene. Indel levels were evaluated using either the TIDE (shinyapps.datacurators.nl/tide/), DECODR (decodr.org/) or the Synthego ICE (ice.synthego.com) webtools. To evaluate the presence of inversions the endogenous RHO rs7984 locus was amplified using primers RH05end_endo-F and RH05end_int_F (reported in Table 7), whereas the integrated RHO gene, using RH05end_Tg-F and RH05end_int_F.
7.1.1.5. Evaluation of RHO mRNA levels
[0224] Total RNA was extracted from cell pellets collected at 6 days post-transfection using the Nucleospin RNA kit (Macherey-Nagel) and ^g of total RNA was then reverse transcribed using the Revertaid RT Reverse Transcription kit (Thermo Scientific) according to manufacturer’s instructions using random hexamers primers. RT-qPCR was performed with primers reported in Table 8 using the HOT FIREPol EvaGreen qPCR Supermix and the CFX96 detection system
(Bio-Rad). Data were normalized on the expression of the reference gene GAPDH according to the AACt method.
7.1.1.6. Western blots
[0225] Cells were lysed in RIPA buffer (NaCI 150mM, NP-40 1%, Sodium deoxycholate 0.5%, SDS 0.1%, Tris 25mM in ddH20 supplemented with 1% of Halt protease inhibitor cocktail (Thermo Fisher Scientific)). Samples were not boiled before loading on the gel. Cell extracts were separated by SDS-PAGE using the PageRuler Plus Protein Standards as the standard molecular mass markers (Thermo Fisher Scientific). After electrophoresis, samples were transferred to 0.45 mhi nitrocellulose membranes (GE Healthcare). The membranes were incubated with mouse anti-Rhodopsin clone 4D2 antibody (MABN15, Sigma-Aldrich, dilution 1:500) or anti-Rhodopsin clone 1D4 antibody (sc-57432, Santa-Cruz Biotechnologies, dilution 1:1,000)and mouse anti-GAPDH 6C5 (sc-32233 Santa Cruz Biotechnology, dilution 1:4,000) and with the HRP conjugated mouse IgGK binding protein (sc-516102, Santa Cruz Biotechnology, 1:5,000) for ECL detection. Images were acquired using the UVItec Alliance detection system.
7.1.2. Example 1: Design of a mutation-independent genome editing strategy to target mutated RHO in autosomal dominant retinitis pigmentosa
[0226] In order to identify a SNP located in the RHO gene suitable to be used as a targeting anchor to tag mutated RHO alleles for CRISPR-mediated inactivation, aggregate information from the gnomAD (gnomad.broadinstitute.org/) and dbSNP (www.ncbi.nlm.nih.gov/snp/) databases was used. The ideal candidate should be located in the first exons of the RHO transcript and the frequency of its minor allele should be as close as possible to 0.5 in the populations of interest. This in turn leads to the possibility that many of the affected subjects will be heterozygous for the selected SNP allowing the design of an allele-specific targeting strategy to destroy the dominant negative RHO allele, regardless the mutation it contains.
[0227] The rs7984 SNP satisfies these requirements as it is located in the first exon of the RHO transcript (5’UTR) and its minor allele has a global frequency close to 0.28 as reported by the ALFA project on dbSNP (www.ncbi.nlm. nih.gov/snp/rs7984#frequency_tab). Conversely, since rs7984 falls outside the coding sequence of RHO (5’UTR), in order to knock-out protein
expression using CRISPR nucleases a strategy exploiting two different DNA cleavages to generate a deletion in the gene needs to be designed. In particular, the inventors have devised an approach which uses a first allele-specific cleavage at the level of the rs7984 SNP to select which of the two RHO alleles is inactivated and a second bi-allelic cut in a suitable position of RHO intron 1 (FIG. 1). This generates an allele-specific deletion that removes the majority of RHO exon 1, including the ATG translation start site, and should effectively knock-out mutant RHO expression sparing the wt RHO allele, as cleavage in selected positions of intron 1 should not have any detrimental consequences on protein expression.
[0228] In addition, to achieve allele-specific targeting of the rs7984 SNP, given the limited difference between the two alleles (1 nucleotide), the inventors surprisingly discovered that certain variants of the SpCas9 nuclease containing amino acid mutations are able to increase its specificity and thus target discrimination (see Table 4).
[0229] First, sgRNAs targeting the rs7984 SNP were designed. A clear requirement for those guides is that their spacer sequences span the rs7984 locus. Two sgRNAs meeting this requirement were identified (sg7984A/G-mm1 and sg7984A/G-mm14), as reported in FIG. 2A.
[0230] Second, sgRNAs targeting RHO intron 1 were designed. In order to limit the dimension of the deletion produced by the two cleavages (<1000bp), sgRNAs were designed considering approximately only the first 600bp of intron 1. In addition, to ensure maximum compatibility with high-fidelity SpCas9 variants, only spacers starting with a 5’-G, which are optimal for U6-driven Pol III transcription, were included. Selected guides are shown in FIG. 2B
7.1.3. Example 2: rs7984 allele-specific targeting [0231] In order to define the best candidate guide to target the rs7984 SNP, the editing activity of the two designed sgRNAs (sg7984A-mm1 and sg7984A-mm14) was evaluated in combination with wt SpCas9 against the endogenous RHO locus in HEK293T cells, which are homozygous for the rs7984A allele (FIG. 3A). For the sg7984A-mm1 guide, two different designs were evaluated, one in which a 5’-G is appended to the spacer increasing its length to 21 nt (sg7984A-mm1-20G) and another in which the twentieth spacer nucleotide (counting from the PAM-side) was substituted with a non-matching G (sg7984A-mm1-19G). Both 5’-Gs were introduced to allow efficient Pol III transcription from a canonical U6 promoter. As shown in FIG. 3A, the sg7984A-mm14 sgRNA greatly outperformed both designs of the comparator sgRNA, demonstrating approximately twice the amount of indel formation. In addition, the allele- specificity of the candidate sgRNAs was evaluated in combination with wt SpCas9 by targeting the RHO locus in HEK293T cells using alternative versions of the guides perfectly matching the G allele of the rs7984 SNP, which is absent in the cell line genome. None of the evaluated combinations showed allele-specific editing, as wt SpCas9 was able to proficiently cleave the endogenous target even when using the mismatch-containing sgRNAs (FIG. 3B).
[0232] Given its surprisingly superior editing activity, the sg7984A/G-mm14 guide design was selected for further studies. Additionally, this spacer natively starts with a 5’-G which makes it fully compatible with high-fidelity SpCas9 variants, that when transcribed from a U6 promoter generally prefer a matching 5’-G at the beginning of the spacer sequence (Casini et ai, 2018, Nat. Biotechnol.; Kulcsar et ai, 2020, Nat. comms.). This is not the case for the sg7984A/G- mm1 guide RNA design.
[0233] The sg7984A/G-mm14 was then evaluated for editing activity and allele-specificity in combination with a wide panel of SpCas9 variants characterized by increased editing specificity. The mutations included in each of the high-fidelity SpCas9 variants evaluated are reported in Table 4. In order to preliminarily evaluate their allele-specificity, a surrogate off- target model was used, where each SpCas9 variant was evaluated for indel formation at the endogenous RHO locus in HEK293T cells in combination with a guide RNA perfectly matching the G allele of the rs7984 SNP, which is absent in the cell’s genome. As shown in FIG. 3C, many of the evaluated variants were able to efficiently cleave the on-target site (rs7984A allele), up to levels comparable to wt SpCas9. Consistently, while being able to edit the target site at good levels, the high-fidelity variants characterized by a higher number of mutations showed a slight decrease in editing activity compared to wt SpCas9.
[0234] When evaluated for their ability to discriminate the two rs7984 alleles using the surrogate off-target model described above, the different variants showed varying levels of allele-specificity, with triple and quadruple mutants being more proficient in reducing off-target cleavage (FIG. 3C). Among all the candidates, the quadruple mutants evoCas9 and DQNV were able to reduce unwanted cleavages close to the limit of detection of the assay used.
[0235] To increase the allelic discrimination of some of the evaluated high-fidelity variants, alternative sgRNA designs were evaluated. In particular, the inventors reasoned that the addition of a second “synthetic” mismatch in the guide spacer may have helped prevent the cleavage of the non-target rs7984 allele by synergizing with the mismatch already present at the level of the rs7984 SNP (two mismatches in total), without compromising the on-target editing efficiency. This required the careful identification of the position of the spacer in which to insert the synthetic mismatch in order to maximize synergy with the SNP-derived mismatch, while reducing to a minimum the effect on cleavage efficacy when targeting the desired rs7984 allele. To this aim a single base substitution was inserted in all positions (except nt 14, which corresponds to the rs7984 locus) of the sg7984G-mm14 (see Table 5) spacer and the editing activity of each of these sgRNAs was evaluated in HEK293T cells by targeting the endogenous RHO locus in combination with the K526E high-fidelity SpCas9 mutant. While the majority of substitutions induced a sharp drop in cleavage activity, modifications in positions 19 and 20 in particular preserved most of the activity (FIG. 4A). The modification in position 20 corresponds
to a transition from G to A since it has been reported (Gao et a!., 2017, Transcription) that Pol III can initiate transcription from this nucleotide in the context of a U6 promoter. Given the minimum loss in targeting activity measured, the sgRNA with a synthetic mismatch in position 20 (sg7984A-mm 14+20) was selected for further characterization.
[0236] A panel of most promising candidates in terms of balance between on-target activity and allele-specificity was selected among the previously evaluated high-fidelity SpCas9 variants and evaluated in combination with the sg7984mm14+20 sgRNAs targeting either the A or G alleles of the rs7984 SNP. As reported in FIG. 4B, the use of a double-mismatched sgRNA generally led to significant improvements in terms of allele specificity, with off-target indel formation reduced to near-background levels for many variants (e.g. ES, EQ or ESN, compare FIG. 3C and FIG.4B). On the other hand, the introduction of the synthetic mismatch produced measurable losses of on-target cleavage activity for some of the combinations (e.g. ELN, DWN or EFN, compare FIG. 3C and FIG.4B).
[0237] Overall, the above data allowed the inventors to define the best SpCas9 variants- sgRNAs combinations that were evaluated in parallel for on-target activity and allele selectivity in order to rank them and select potential candidates for RHO downregulation (FIG. 5). Among the evaluated combinations, the DQNV+sg7984-mm14 and ESN+sg7984-mm14+20 were selected for further evaluation due to their high on-target activity and extremely reduced off- target cleavages.
7.1.4. Example 3: sgRNAs targeting RHO intron 1 [0238] The generation of a genomic deletion at the 5’-end of the gene to knock-out mutant RHO expression requires simultaneous targeting of the locus using two different sgRNAs. The first guide (sg7984A/G-mm14 and sg7984A/G-mm 14+20), characterized in detail above, should target the rs7984 SNP in an allele-specific manner; the second sgRNA should be selected among those targeting RHO intron 1 and should promote a bi-allelic cut in both RHO gene copies.
[0239] Starting from the assumption that smaller deletions are generally easier to generate, sgRNAs targeting RHO intron 1 at a maximum distance of approximately 1 kb from the rs7984 SNP locus were designed using the CRISPOR web tool (crispor.tefor.net). The list of possible hits was reduced to 16 candidates by using the following criteria: the 5’-end nucleotide of the spacer should be a G, in order to increase the compatibility with high-fidelity SpCas9 variants; the guide should have a favorable profile in terms of off-targets as predicted by CRISPOR. The list of selected guides is reported in Table 5.
[0240] As a first step, the selected guides were evaluated for editing activity in combination with wt SpCas9 by transient transfection in HEK293 cells having stably integrated a single copy of the P347L/rs7984G (characterized by the P347L mutation and the G allele of the rs7984 SNP)
RHO gene under the control of a tetracycline-inducible promoter (HEK293-TetP347L). As shown in FIG. 6A, the majority of the evaluated guides showed good levels of cleavage activity with sg109rev, sg170rev, sg189fw and sg352rev producing the highest levels of indel formation.
[0241] Given the bi-allelic nature of the cleavage in RHO intron 1, it is important to verify that intron targeting alone does not downregulate significantly RHO expression. This is to ensure that, when treating patients, cleavage at intron 1 of the wt RHO allele will not impact RHO gene expression, thus preserving normal photoreceptor function after removal of the dominant negative effect of the mutated RHO allele. RHO mRNA levels were thus measured by qPCR in HEK293-TetP347L cells after transient transfection of wt SpCas9 in combination with the selected guides. Surprisingly, many of the guides were indeed causing significant reductions in the intracellular levels of RHO transcripts (FIG. 6B and FIG. 6C). Among the exceptions was the sg189fw guide, which consistently did not perturb RHO expression. This feature, together with the high editing levels toward its target site and the reduced variability in the obtained results, made sg189fw the best candidate sgRNA to target RHO intron 1.
7.1.5. Example 4: Allele-specific downregulation of RHO P23H and RHO P347L
[0242] Having established that ESN in combination with sg7984A/G-mm 14+20 and DQNV combined with sg7984A/G-mm14 are the best candidates for the allele-specific targeting of the rs7984 SNP locus and that, among the sgRNAs evaluated to target RHO intron 1, sg189fw shows the best editing profile without affecting RHO expression, the inventors set out to verify that simultaneous targeting of the two sites was indeed able to produce a deletion and downregulate mutant RHO expression.
[0243] HEK293 cells containing a stably integrated copy of a RHO P23H/rs7984G gene
(characterized by the P23H mutation and the G allele of the rs7984 SNP) under the control of a doxycycline-inducible promoter (HEK293-TetP23H) were transiently transfected either with wt
SpCas9, ESN or DQNV together with the intron-targeting guide (sg189fw) and the corresponding sgRNA to target the rs7984 SNP alleles (sg7984A/G-mm 14+20 for ESN and sg7984A/G-mm14 for wt SpCas9 and DQNV), either alone or in combination. Deletion formation was evaluated by end-point PCR and agarose gel electrophoresis using primers specific for minigene amplification. While the deletion was readily detected in all samples transfected with both intron- and SNP-targeting sgRNAs, no product was detected when using single guides, as expected (FIG. 7A). Interestingly, while deletion formation was clearly evident when wt SpCas9 was co-transfected with sg189fw and either sg7984A-mm14 or sg7984G- mm14, no such editing product was detectable when the sg189fw/sg7984A-mm14 or sg189fw/sg7984A-mm 14+20 sgRNA couples were used in combination with DQNV or ESN, respectively (FIG. 7A). This clearly demonstrates the allele-specificity of the approach when
used in combination with the DQNV and ESN high-fidelity SpCas9 variants, as the rs7984A allele can be found only in the endogenous RHO locus which is not detected by the PCR amplification strategy used, while the rs7984G allele is present in the integrated RHO P23H minigene.
[0244] Next, the functional consequences of deletion formation on RHO P23H expression were evaluated by qPCR and Western blot. As shown in FIG. 7B, targeted deletion of the 5’-end of the RHO gene produces a strong downregulation of mRNA levels in samples treated with wt SpCas9 as well as the DQNV and ESN variants. This downregulation was allele-specific in samples transfected with the high-fidelity SpCas9 variants, while RHO mRNA downregulation was observed when using sgRNAs targeting both alleles of the rs7984 SNP combined with wt SpCas9 (FIG. 7B). This is in accordance with previous data showing that wt SpCas9 is not specific enough to discriminate the two SNP alleles. In addition, sole targeting of RHO intron 1 did not produce significant downregulation of RHO mRNA expression (FIG. 7B), as already demonstrated. Interestingly, targeting the rs7984 locus alone produced measurable downregulation of RHO transcript levels, which was allele-specific when using high-fidelity SpCas9 variants (ESN, DQNV) but not when the SNP-targeting sgRNAs were used in combination with wt SpCas9 (FIG. 7B).
[0245] Intracellular RHO P23H protein levels were then measured by Western blot after transfection of HEK293-TetP23H cells with wt SpCas9, the DQNV or the ESN variant together with the intron-targeting sgRNA sg189fw and the guides directed towards the rs7984 SNP alleles (A/G) either alone or in combination. Consistently with mRNA downregulation data, decrease in RHO P23H protein levels were observed in association with deletion formation through the dual-guide strategy (FIG. 7C). As before, RHO P23H protein reduction was allele- specific only when cells were treated with the high-fidelity SpCas9 variants DQNV and ESN. Similarly, targeting the rs7984 locus only resulted in downregulation of P23H protein levels, albeit to a lesser extent, which was allele-specific only when using the DQNV and ESN variants (FIG. 7C). Finally, no significant reduction in RHO protein levels were observed when treating the cells with the different nucleases in combination with sg189fw only, as expected from previous results.
[0246] To further demonstrate the efficacy of the selected genome editing strategy in downregulating RHO mutants independently of the identity of the mutation affecting the gene, the functional consequences on RHO expression of deletion formation through dual-guide targeting were investigated in the additional cell line model HEK293-TetP347L, expressing the P347L RHO mutant. After transient transfection with each SpCas9 variant together with its associated sgRNAs, formation of the desired deletion was detected (FIG. 8A), leading to RHO
mRNA downregulation as measured by qPCR (FIG. 8B) and decrease of mutant RHO intracellular protein levels (FIG. 8C), as previously observed for P23H.
[0247] Beside deletion of the intervening sequence, one of the possible outcomes of the introduction in the cellular genome of two double strand breaks, especially in close proximity, is repair by inversion of the excised DNA fragment. In order to verify whether the targeting strategy was indeed producing inversions at the level of the 5’-end of the RHO locus, a PCR strategy was designed to detect such repair products, both at the level of the integrated RHO P23H/rs7984G minigene and the endogenous RHO locus, characterized by the rs7984A allele (FIG. 9A). Inversions were readily detected in HEK293-TetP23H cells transfected with wt SpCas9 and each of the high-fidelity variants. Specifically, the inversion was detected at the integrated minigene when using sgRNAs targeting the rs7984G allele and at the endogenous RHO locus with the other set of guides directed towards rs7984A, as expected (FIG. 9B-C). Notably, wt SpCas9 was not able to discriminate among the endogenous and minigene targets with either of the sg7984A/G-mm14 guide RNAs, producing inversions at both loci with all the evaluated guides (FIGS. 9B-9C). These data are a further demonstration of the surprisingly high allele-specificity of the DQNV and ESN variants when used in combination with the sg7984A/G-mm14 and sg7984A/G-mm 14+20 guides, respectively.
7.1.6. Example 5: Genome-wide off-target analysis of sgRNA-nuclease couples
[0248] GUIDE-seq was used to evaluate the genome-wide specificity of ESN, EMN, and DQNV SpCas9 variants. SpCas9 was used as a benchmark
7.1.6.1. Materials and Methods
[0249] This Example was performed using wt HEK293T cells (homozygous for the rs7984A allele).
[0250] Genome-wide off-targets were evaluated using the GUIDE-seq protocol (Tsai et ai, 2015, Nature Biotechnology 33:187-195) with some modifications (Casini etai, 2018, Nature Biotechnology 36:265-271). Briefly, 2x105 HEK293T cells were seeded in a 24-well plate the day before transfection. Cells were then transfected with 750 ng of each Cas9 together with 250 ng of the corresponding pUC-sgRNA plasmids, 10 pmol of bait dsODN (sequence reported in the cited publications) and 50 ng of a pEGFP-IRES-Puro plasmid, expressing the EGFP reporter and a puromycin resistance marker, using Lipofectamine 3000 (Thermo Scientific) according to manufacturer’s instructions. The day after transfection cells were detached and seeded in a 12-well plate under puromycin selection (1 pg/ml, Invivogen) in order to enrich for transfected cells and enhance off-target detection. After two days, puromycin selection was removed and cell were allowed to recover for an additional 24 hours. Genomic DNA was then extracted using the Nucleospin Tissue kit (Macherey-Nagel) and libraries were prepared and
sequenced according to previously published protocols (Tsai et al., 2015, Nature Biotechnology 33:187-195). A maximum of 5 different libraries were loaded on a single lllumina Miseq Reagent kit v2 - 300 cycles flow cell. Raw sequencing data were analyzed using an available dedicated computational pipeline (Tsai et al. , 2016, Nature Biotechnology 34:483).
[0251] The off-target genomic sites detected by GUIDE-seq when treating the cells with high- fidelity SpCas9 variants (those detected with wt SpCas9 were not investigated further) were validated using targeted deep-sequencing. Briefly, target loci were amplified from genomic DNA extracted from HEK293T cells transiently transfected with the selected hi-fi variant and the corresponding sgRNA. The amplicons were then pooled by variant and biological replicate, indexed using Nextera XT adaptors (lllumina) and sequenced on an lllumina Miseq system using a Micro v2300 cycles flow cell. In these conditions, at best a sensitivity of 0.1% is expected, which is close to the limit of detection of the instrument. Raw data were analyzed for indel detection using the CRISPResso v2 computational pipeline (Clement et al., 2019, Nature Biotechnology 37:224-226) with standard input parameters.
7.1.6.2. Results
[0252] A panel of three candidate sgRNA-nuclease couples, namely DQNV+sg7984A/G- mm14, ESN+sg7984A/G-mm14 and ESN+sg7984A/G-mm 14+20, were investigated for their genome-wide specificity profile using GUIDE-seq (Tsai et al., 2015, Nature Biotechnology 33:187-195) in order to exclude possible unwanted damage to the cell genome upon editing the RHO locus. The GUIDE-seq protocol allows tagging of genomic sites cleaved by SpCas9 in living cells in vitro for subsequent identification by NGS. This allows the unbiased detection of genomic loci which are targeted non-specifically, together with the intended target site.
[0253] HEK293T cells were used (homozygous for the rs7984A allele) to generate GUIDE-seq profiles for the sg189fw, sg7984A/G-mm14 and sg7984A/Gmm 14+20 sgRNAs in combination with the three aforementioned high-fidelity SpCas9 variants (ESN, EMN, DQNV). Wt SpCas9 was evaluated in parallel to determine the baseline of off-target generation in combination with the all the sgRNAs.
[0254] As shown in Table 9 several off-target sites were generated by the sg7984A/G-mm14 and sg7984A/Gmm 14+20 sgRNAs in combination with wt SpCas9 (on average more than one hundred). On the other hand, when evaluated in combination with the ESN, EMN and DQNV high-fidelity variants (each in combination with their respective sgRNAs) the guides showed a dramatic drop in off-target generation, with less than 10 off-target sites captured for the EMN and ESN variants (4 total off-targets for EMN, 9 total off-targets for ESN) and no off-targets detected for DQNV. In addition, the majority of the detected sites were characterized by very low GUIDE-seq read counts (below 20-30), which generally correspond to the background noise associated to the assay without translating into measurable off-target editing in the
cellular genome (Tsai etal., 2015, Nature Biotechnology 33:187-195; Maeder et al., 2019, Nat Med 25:229-233).
[0255] The genome-wide specificity profile of the sg189fw guide RNA, targeting RHO intron 1, was also evaluated when used in combination with wt SpCas9 or the candidate high-fidelity variants. Even though few off-target sites with low GUIDE-seq read counts in the sample treated with wt SpCas9 were detected, no off-target cleavages were present when the same sgRNA was combined with the high-specificity SpCas9 mutants (Table 9).
[0256] To validate the results obtained by GUIDE-seq and verify if the captured sites were indeed edited by the nucleases, targeted deep-sequencing was performed on the genomic sites detected across all the evaluated guide RNAs in combination with the ESN and EMN high- fidelity variants (total number of captured off-target sites: 9, 5 of which exclusively present for the ESN variant). Among all the evaluated sites, editing levels above the background were detected only for two of the evaluated sites (OT 1 and OT7) in samples treated with the ESN variant, while all the others fell below the limits of detection of our sequencing assay. Conversely, no appreciable off-target editing was detected on the loci identified for the EMN nuclease (FIG. 10).
7.1.7. Example 6: Targeting RHO rs7984 SNP with AAV vectors [0257] AAV vectors were constructed to deliver SpCas9 variants and sgRNAs to cells and introduce deletions in the target RHO gene.
7.1.7.1. Materials and Methods
[0258] 105 HEK293-TetP23H cells were transduced in 24-well plate with couples of AAV2 vectors (a schematic representation of the vector genomes design is shown in FIG. 11 A) using 1x105 MOI of each vector. 6 days post transduction cells were collected and DNA was extracted with QuickExtract DNA extraction solution (Lucigen) according to manufacturer’s instructions. The targeted region was PCR amplified using the HOT FIREPol Multiplex Mix (Solis Biodyne) using primers RH05end_Tg-F and RH05end_Tg-R (reported in Table 7). PCR products were then run on 1% agarose gel to check for deletion formation. AAV2 vectors were produced by Vectorbuilder.
7.1.7.2. Results
[0259] A dual AAV vector system was constructed to allow expression in target cells of the high-fidelity SpCas9 variants ESN and DQNV as well as of the two sgRNAs necessary to introduce deletions in the target RHO gene containing the pathogenic mutation of interest (sg7984G-mm14 and sg189fw). For these latter vectors two different design were evaluated which are different only for the orientation of one of the two sgRNA expression cassettes (the one expressing the sg189fw guide). A schematic representation of the viral vector genomes is reported in FIG. 11 A. All the reported vectors were obtained using standard restriction-based cloning techniques.
[0260] Co-transduction of target cells with the vector expressing each of the high-fidelity nucleases together with the sgRNA-encoding vector is thus necessary to observe editing and in particular deletion formation. In order to verify the ability of AAV vectors to deliver the targeting strategy, AAV2 viral particles packaging the different genomes were produced and used to transduce HEK293-TetP23H cells: AAV2-ESN and AAV2-DGNV were each used in combination with AAV2-ATX001 and AAV2-ATX005, corresponding to two different designs of vectors expressing the guide RNAs of interest (see FIG. 11 A). Cells were then collected at 6 days post-transduction for the evaluation of deletion formation at the level of the target RHO gene by endpoint PCR. As shown in FIG. 11B both the ESN and the DGNV variants were able to produce appreciable levels of deletion formation in RHO when delivered in combination with both sgRNA-expressing vectors (AAV2-ATX001 and AAV2-ATX005), independently of the design of the latter. These data are a clear demonstration that both high-fidelity SpCas9 variants and their sgRNAs can be efficiently delivered to target cells using commonly exploited AAV serotypes, such as AAV2.
7.1.8. Example 7: Evaluation of the cellular toxicity of deleted RHO [0261] The toxicity of RHO having a deletion was evaluated.
7.1.8.1. Materials and Methods
[0262] 105 HEK293T cells were transfected in 96-well plates with 200 ng of an empty plasmid (pcDNA3), or expression vectors for RHO WT, RHO P23H or a RHO minigene containing a 560bp long deletion, corresponding to the most frequent editing outcome produced by the evaluated genome editing strategy (see Example 4) using the TranslT-LT1 transfection reagent (Mirus Bio), according to manufacturer’s instructions. Cells were collected 3 days after transfection to evaluate cell viability using the CellTiter-Glo luminescent cell viability assay (Promega). Cells were then incubated for 10 min with CellTiter-Glo reagent, and luminescence was measured using a 96-well plate reader. Background luminescence was measured in medium without cells and subtracted from experimental values. Data were normalized on the luminescence of the untreated sample (UT).
7.1.8.2. Results
[0263] To verify that introducing deletions in the RHO gene would reduce the toxicity of RHO mutants, HEK293T cells were transfected with different expression vectors encoding either RHO WT, RHO P23H or a deleted version of the RHO gene. This deleted version was generated using standard cloning techniques to mimic the most prevalent editing product obtained by the simultaneous targeting of the RHO sequence with the guides targeting the rs7984 SNP in combination with sg189fw. Given the nature of this edit (deletion of the majority of RHO exon 1, including the ATG initiation codon), it is expected to abolish protein expression and thus consequent toxicities. Cell vitality was evaluated by using a standardized commercial assay (CellTiter-Glo from Promega).
[0264] As shown in FIG. 12, while no effects on cell viability were observed when transfecting a construct expressing WT RHO, a 50% drop in viable cells was produced by the transfection of the RHO P23H mutant, confirming its toxicity due to protein misfolding and ER accumulation with consequent ER-stress. Notably, cells transfected with the vector expressing the deleted RHO gene behaved similar to cells transfected with WT RHO or an empty plasmid, clearly demonstrating that the deletion product generated by the targeting strategy presented in Example 4 is non-toxic for cells. This is crucial to ensure proper recovery of photoreceptor functionality when treating patients affected by RHO-dependent retinitis pigmentosa.
8. SPECIFIC EMBODIMENTS
[0265] The present disclosure is exemplified by the specific embodiments below.
1. A guide RNA molecule (gRNA) for editing a human RHO gene, the gRNA comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence, wherein the reference sequence is:
a) GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2); b) a sequence having one or two mismatches with the sequence GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2); c) CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3); d) a sequence having one or two mismatches with the sequence CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3); e) UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4); or f) a sequence having one or two mismatches with the sequence UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4); wherein R is A or G.
2. The gRNA of embodiment 1 , which comprises a spacer that is 15 to 30 nucleotides in length.
3. The gRNA of embodiment 2, wherein the spacer is 15 to 25 nucleotides in length.
4. The gRNA of embodiment 2, wherein the spacer is 16 to 24 nucleotides in length.
5. The gRNA of embodiment 2, wherein the spacer is 17 to 23 nucleotides in length.
6. The gRNA of embodiment 2, wherein the spacer is 18 to 22 nucleotides in length.
7. The gRNA of embodiment 2, wherein the spacer is 19 to 21 nucleotides in length.
8. The gRNA of embodiment 2, wherein the spacer is 18 to 30 nucleotides in length.
9. The gRNA of embodiment 2, wherein the spacer is 20 to 28 nucleotides in length.
10. The gRNA of embodiment 2, wherein the spacer is 22 to 26 nucleotides in length.
11. The gRNA of embodiment 2, wherein the spacer is 23 to 25 nucleotides in length.
12. The gRNA of embodiment 2, wherein the spacer is 20 nucleotides in length.
13. The gRNA of embodiment 2, wherein the spacer is 21 nucleotides in length.
14. The gRNA of embodiment 2, wherein the spacer is 22 nucleotides in length.
15. The gRNA of embodiment 2, wherein the spacer is 23 nucleotides in length.
16. The gRNA of embodiment 2, wherein the spacer is 24 nucleotides in length.
17. The gRNA of embodiment 2, wherein the spacer is 25 nucleotides in length.
18. The gRNA of any one of embodiments 1 to 17, wherein the spacer comprises 16 or more consecutive nucleotides of the reference sequence.
19. The gRNA of any one of embodiments 1 to 17, wherein the spacer comprises 17 or more consecutive nucleotides of the reference sequence.
20. The gRNA of any one of embodiments 1 to 17, wherein the spacer comprises 18 or more consecutive nucleotides of the reference sequence.
21. The gRNA of any one of embodiments 1 to 17, wherein the spacer comprises 19 or more consecutive nucleotides of the reference sequence.
22. The gRNA of any one of embodiments 1 to 17, wherein the spacer comprises 20 consecutive nucleotides of the reference sequence.
23. The gRNA of any one of embodiments 1 to 17, wherein the spacer comprises the reference sequence.
24. The gRNA of any one of embodiments 1 to 23, wherein the reference sequence is GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2).
25. The gRNA of any one of embodiments 1 to 23, wherein the reference sequence has one mismatch with the nucleotide sequence GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2).
26. The gRNA of embodiment 25, wherein the reference sequence is ACAGCCRCGGGUCAGCCACA (SEQ ID NO:7).
27. The gRNA of any one of embodiments 1 to 23, wherein the reference sequence has two mismatches with the nucleotide sequence GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2).
28. The gRNA of any one of embodiments 1 to 23, wherein the reference sequence is CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3).
29. The gRNA of any one of embodiments 1 to 23, wherein the reference sequence has one mismatch with the sequence CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3).
30. The gRNA of any one of embodiments 1 to 23, wherein the reference sequence has two mismatches with the sequence CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3).
31. The gRNA of any one of embodiments 1 to 23, wherein the reference sequence is UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4).
32. The gRNA of any one of embodiments 1 to 23, wherein the reference sequence has one mismatch with the sequence UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4).
33. The gRNA of any one of embodiments 1 to 23, wherein the reference sequence has two mismatches with the sequence UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4).
34. The gRNA of embodiment 1 , wherein the nucleotide sequence of the spacer is GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2).
35. The gRNA of embodiment 1 , wherein the nucleotide sequence of the spacer is ACAGCCRCGGGUCAGCCACA (SEQ ID NO:7).
36. The gRNA of embodiment 1 , wherein the nucleotide sequence of the spacer is CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3).
37. The gRNA of embodiment 1 , wherein the nucleotide sequence of the spacer is GAGCCRCGGGUCAGCCACAA (SEQ ID NO:228).
38. The gRNA of embodiment 1 , wherein the nucleotide sequence of the spacer is GCAGCCRCGGGUCAGCCACAA (SEQ ID NO:229).
39. The gRNA of embodiment 1 , wherein the nucleotide sequence of the spacer is UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4).
40. The gRNA of embodiment 1 , wherein the nucleotide sequence of the spacer is GCUUGGGUGGGAGCAGCCRC (SEQ ID NO:230).
41. The gRNA of embodiment 1 , wherein the nucleotide sequence of the spacer is GUCUUGGGUGGGAGCAGCCRC (SEQ ID NO:231).
42. The gRNA of any one of embodiments 1 to 41 , wherein R is A.
43. The gRNA of any one of embodiments 1 to 41 , wherein R is G.
44. The gRNA of any one of embodiments 1 to 43, which is a Cas9 gRNA.
45. The gRNA of embodiment 44, which is a Streptococcus pyogenes Cas9
(SpCas9) gRNA.
46. The gRNA of any one of embodiments 1 to 45, which is a single guide RNA (sgRNA).
47. The gRNA of embodiment 46, which comprises a 3’ sgRNA segment.
48. The gRNA of embodiment 47, wherein the 3’ sgRNA segment has a nucleotide sequence comprising a sequence set forth in Table 3.
49. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 1 as set forth in Table 3.
50. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 2 as set forth in Table 3.
51. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 3 as set forth in Table 3.
52. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 4 as set forth in Table 3.
53. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 5 as set forth in Table 3.
54. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 6 as set forth in Table 3.
55. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 7 as set forth in Table 3.
56. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 8 as set forth in Table 3.
57. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 9 as set forth in Table 3.
58. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 10 as set forth in Table 3.
59. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 11 as set forth in Table 3.
60. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 12 as set forth in Table 3.
61. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 13 as set forth in Table 3.
62. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 14 as set forth in Table 3.
63. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 15 as set forth in Table 3.
64. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 16 as set forth in Table 3.
65. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 17 as set forth in Table 3.
66. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 18 as set forth in Table 3.
67. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 19 as set forth in Table 3.
68. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 20 as set forth in Table 3.
69. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 21 as set forth in Table 3.
70. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 22 as set forth in Table 3.
71. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 23 as set forth in Table 3.
72. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 24 as set forth in Table 3.
73. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 25 as set forth in Table 3.
74. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 26 as set forth in Table 3.
75. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 27 as set forth in Table 3.
76. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 28 as set forth in Table 3.
77. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 29 as set forth in Table 3.
78. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 30 as set forth in Table 3.
79. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 31 as set forth in Table 3.
80. The gRNA of embodiment 48, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 32 as set forth in Table 3.
81. The gRNA of any one of embodiments 47 to 80, wherein the 3’ sgRNA segment comprises one or more uracils at its 3’ end.
82. The gRNA of embodiment 81 , wherein the 3’ sgRNA segment comprises one to eight uracils at its 3’ end.
83. The gRNA of embodiment 81 , wherein the 3’ sgRNA segment comprises one uracil at its 3’ end.
84. The gRNA of embodiment 81 , wherein the 3’ sgRNA segment comprises two uracils at its 3’ end.
85. The gRNA of embodiment 81 , wherein the 3’ sgRNA segment comprises three uracils at its 3’ end.
86. The gRNA of embodiment 81 , wherein the 3’ sgRNA segment comprises four uracils at its 3’ end.
87. The gRNA of embodiment 81 , wherein the 3’ sgRNA segment comprises five uracils at its 3’ end.
88. The gRNA of embodiment 81 , wherein the 3’ sgRNA segment comprises six uracils at its 3’ end.
89. The gRNA of embodiment 81 , wherein the 3’ sgRNA segment comprises seven uracils at its 3’ end.
90. The gRNA of embodiment 81 , wherein the 3’ sgRNA segment comprises eight uracils at its 3’ end.
91. The gRNA of any one of embodiments 1 to 90, wherein the gRNA is an unmodified gRNA.
92. The gRNA of any one of embodiments 1 to 90, which comprises one or more modifications.
93. The gRNA of embodiment 92, wherein the one or more modifications comprises one or more 2’-0-methyl phosphorothioate nucleotides.
94. A nucleic acid encoding the gRNA of any one of embodiments 1 to 91.
95. The nucleic acid of embodiment 94, which further comprises a Pol III promoter sequence operably linked to the nucleotide sequence encoding the gRNA.
96. The nucleic acid of embodiment 95, wherein the promoter is a U6 promoter.
97. The nucleic acid of embodiment 95, wherein the promoter is a H1 promoter.
98. The nucleic acid of any one of embodiments 94 to 97, which further encodes a second gRNA.
99. The nucleic acid of embodiment 98, wherein the second gRNA is a sgRNA.
100. The nucleic acid of embodiment 98 or embodiment 99, which further comprises a
Pol III promoter sequence operably linked to the nucleotide sequence encoding the second gRNA.
101. The nucleic acid of embodiment 100, wherein the promoter sequence operably linked to the nucleotide sequence encoding the second gRNA is a U6 promoter sequence.
102. The nucleic acid of embodiment 100, wherein the promoter sequence operably linked to the nucleotide sequence encoding the second gRNA is a H1 promoter sequence.
103. The nucleic acid of any one of embodiments 99 to 102, wherein the second gRNA comprises a spacer sequence that is partially or fully complementary to a target sequence in a human RHO gene.
104. The nucleic acid of embodiment 103, wherein the second gRNA comprises a spacer sequence that is partially or fully complementary to a target sequence in intron 1 of a human RHO gene.
105. The nucleic acid of embodiment 104, wherein the spacer sequence of the second gRNA comprises 15 or more consecutive nucleotides of a reference sequence, wherein the reference sequence is: a) GCCGGGCUGCUGUUUGUGCA (SEQ ID NO:27); b) GCAGGAGCCCGGGAGCAUGG (SEQ ID NO:24); c) GUCUGGGAGAGUCCCGGGCU (SEQ ID NO:25); d) GAGAGUCCCGGGCUUGGCGG (SEQ ID NO:26); e) GCCCUGCUGGGGCGUCACAC (SEQ ID NO:28); f) GGACGGGUGCAGAGUUGAGU (SEQ ID NO:29); g) GUGCUGAGUCAGACCCAGGC (SEQ ID NQ:30);
h) GCAAUGGGCUCGGUCCCCUC (SEQ ID NO:31); i) GUAUGAGCCGGGUGUGGGUG (SEQ ID NO:32); j) GCUUGGCGGUGGUGGCUGAG (SEQ ID NO:33); k) GGGCUUUGGAUAACAUUGAC (SEQ ID NO:34);
L) GACUGAAUAUAUGAGGGCUU (SEQ ID NO:35); m) GCCCUGCACAAACAGCAGCC (SEQ ID NO:36); n) GCUGGGGCGUCACACAGGGA (SEQ ID NO:37); o) GAGGCUUGGUGCUGCAAACA (SEQ ID NO:38); or p) GCCAGACCCCUCCUCUCUGG (SEQ ID NO:39).
106. The nucleic acid of embodiment 105, wherein the nucleotide sequence of the spacer comprises 16 or more consecutive nucleotides from the reference sequence.
107. The nucleic acid of embodiment 105, wherein the nucleotide sequence of the spacer comprises 17 or more consecutive nucleotides from the reference sequence.
108. The nucleic acid of embodiment 105, wherein the nucleotide sequence of the spacer comprises 18 or more consecutive nucleotides from the reference sequence.
109. The nucleic acid of embodiment 105, wherein the nucleotide sequence of the spacer comprises 19 or more consecutive nucleotides from the reference sequence.
110. The nucleic acid of embodiment 105, wherein the nucleotide sequence of the spacer comprises the reference sequence.
111. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCCGGGCUGCUGUUUGUGCA (SEQ ID NO:27).
112. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCAGGAGCCCGGGAGCAUGG (SEQ ID NO:24).
113. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GUCUGGGAGAGUCCCGGGCU (SEQ ID NO:25).
114. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GAGAGUCCCGGGCUUGGCGG (SEQ ID NO:26).
115. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCCCUGCUGGGGCGUCACAC (SEQ ID NO:28).
116. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GGACGGGUGCAGAGUUGAGU (SEQ ID NO:29).
117. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GUGCUGAGUCAGACCCAGGC (SEQ ID NO:30).
118. The nucleic acid of any one of embodiments 105 to 110 wherein the reference sequence is GCAAUGGGCUCGGUCCCCUC (SEQ ID NO:31).
119. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GUAUGAGCCGGGUGUGGGUG (SEQ ID NO:32).
120. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCUUGGCGGUGGUGGCUGAG (SEQ ID NO:33).
121. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GGGCUUUGGAUAACAUUGAC (SEQ ID NO:34).
122. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GACUGAAUAUAUGAGGGCUU (SEQ ID NO:35).
123. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCCCUGCACAAACAGCAGCC (SEQ ID NO:36).
124. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCUGGGGCGUCACACAGGGA (SEQ ID NO:37).
125. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GAGGCUUGGUGCUGCAAACA (SEQ ID NO:38).
126. The nucleic acid of any one of embodiments 105 to 110, wherein the reference sequence is GCCAGACCCCUCCUCUCUGG (SEQ ID NO:39).
127. The nucleic acid of any one of embodiments 94 to 126, wherein the nucleic acid is a plasmid.
128. The nucleic acid of any one of embodiments 94 to 126, wherein the nucleic acid is a viral genome.
129. The nucleic acid of embodiment 128, wherein the viral genome is an adeno- associated virus (AAV) genome.
130. The nucleic acid of embodiment 129, wherein the viral genome is a AAV2 genome.
131. The nucleic acid of embodiment 129, wherein the viral genome is a AAV5 genome.
132. The nucleic acid of embodiment 129, wherein the viral genome is a AAV7m8 genome.
133. The nucleic acid of embodiment 129, wherein the viral genome is a AAV8 genome.
134. A particle comprising the gRNA of any one of embodiments 1 to 93 or the nucleic acid of any one of embodiments 94 to 133.
135. The particle of embodiment 134, wherein the particle is a viral particle, a lipid nanoparticle, a vesicle, or a gold nanoparticle.
136. The particle of embodiment 135, wherein the particle is a viral particle.
137. The particle of embodiment 135, wherein the particle is an adeno-associated virus (AAV) particle.
138. The particle of embodiment 137, which is a AAV2 particle.
139. The particle of embodiment 137, which is a AAV5 particle.
140. The particle of embodiment 137, which is a AAV7m8 particle.
141. The particle of embodiment 137, which is a AAV8 particle.
142. A plurality of particles comprising a first particle according to any one of embodiments 127 to 141 and a second particle comprising a nucleic acid encoding a Cas9 protein, optionally wherein the first particle and second particle are in a single container or wherein the first particle is in a first container and the second particle is in a second container.
143. The plurality of particles of embodiment 142, wherein the nucleic acid encoding the Cas9 protein is operably linked to a promoter, which is optionally a tissue specific promoter or a constitutive promoter.
144. The plurality of particles of embodiment 143, wherein the promoter is a hGRK1 promoter.
145. The plurality of particles of embodiment 143, wherein the promoter is a RHO promoter.
146. The plurality of particles of embodiment 143, wherein the promoter is an EF1 alpha promoter, e.g., an EF1 alpha short (EFS) promoter.
147. The plurality of particles of any one of embodiments 142 to 146, wherein the Cas9 protein is a wild-type Cas9 protein or a modified Cas9 protein.
148. The plurality of particles of embodiment 147, wherein the Cas9 protein is a modified Cas9 protein having one or more amino acid modifications relative to the corresponding wild-type Cas9 protein.
149. The plurality of particles of embodiment 148, wherein the position of one or more modifications are identified by reference to the amino acid numbering in an unmodified mature Streptococcus pyogenes Cas9 as set forth in SEQ ID NO:1.
150. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises a K526 mutation.
151. The plurality of particles of embodiment 150, wherein the K526 mutation is a K526E mutation.
152. The plurality of particles of embodiment 150, wherein the K526 mutation is a K526D mutation.
153. The plurality of particles of embodiment 150, wherein the K526 mutation is a K526A mutation.
154. The plurality of particles of embodiment 150, wherein the K526 mutation is a K526N mutation.
155. The plurality of particles of any one of embodiments 149 to 154, wherein the modified Cas9 protein comprises a Y515 mutation.
156. The plurality of particles of embodiment 155, wherein the Y515 mutation is a
Y515N mutation.
157. The plurality of particles of any one of embodiments 149 to 156, wherein the modified Cas9 protein comprises a R661 mutation.
158. The plurality of particles of embodiment 157, wherein the R661 mutation is a R661Q mutation.
159. The plurality of particles of embodiment 157, wherein the R661 mutation is a R661S mutation.
160. The plurality of particles of embodiment 157, wherein the R661 mutation is a R661L mutation.
161. The plurality of particles of embodiment 157, wherein the R661 mutation is a R661D mutation.
162. The plurality of particles of embodiment 157, wherein the R661 mutation is a R661E mutation.
163. The plurality of particles of embodiment 157, wherein the R661 mutation is a R661F mutation.
164. The plurality of particles of embodiment 157, wherein the R661 mutation is a R661M mutation.
165. The plurality of particles of embodiment 157, wherein the R661 mutation is a R661W mutation.
166. The plurality of particles of embodiment 157, wherein the R661 mutation is a R661Y mutation.
167. The plurality of particles of embodiment 157, wherein the R661 mutation is a R661A mutation.
168. The plurality of particles of any one of embodiments 149 to 167, wherein the modified Cas9 protein comprises a M495 mutation.
169. The plurality of particles of embodiment 168, wherein the M495 mutation is M495V mutation.
170. The plurality of particles of any one of embodiments 149 to 169, wherein the modified Cas9 protein comprises a H698Q mutation.
171. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises K526E and R661S mutations.
172. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises K526E and R661Q mutations.
173. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises K526E and R661L mutations.
174. The plurality of particles of embodiment 149, wherein the modified Cas9 protein
comprises Y515N, K526E, and R661S mutations.
175. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526E, and R661Q mutations.
176. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526E, and R661L mutations.
177. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526E, and R661D mutations.
178. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526E, and R661E mutations.
179. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526E, and R661F mutations.
180. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526E, and R661M mutations.
181. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526E, and R661W mutations.
182. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526E, and R661Y mutations.
183. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526E, and M495V mutations.
184. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises M495V, Y515N, K526E, and R661Q mutations.
185. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises M495V, K526E, R661Q, and H698Q mutations.
186. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises M495V, Y515N, K526E, and R661A mutations.
187. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526D, and R661Q mutations.
188. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526D, and R661L mutations.
189. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises Y515N, K526D, and R661W mutations.
190. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises M495V, Y515N, K526D, and R661Q mutations.
191. The plurality of particles of embodiment 149, wherein the modified Cas9 protein comprises M495V, Y515N, K526A, and R661Q mutations.
192. The plurality of particles of any one of embodiments 142 to 191, wherein the second particle is a viral particle, a lipid nanoparticle, a vesicle, or a gold nanoparticle.
193. The plurality of particles of embodiment 192, wherein the second particle is a viral particle.
194. The plurality of particles of embodiment 192, wherein the second particle is an adeno-associated virus (AAV) particle.
195. The plurality of particles of embodiment 194, wherein the second particle is a AAV2 particle.
196. The plurality of particles of embodiment 194, wherein the second particle is a AAV5 particle.
197. The plurality of particles of embodiment 194, wherein the second particle is a AAV7m8 particle.
198. The plurality of particles of embodiment 194, wherein the second particle is a AAV8 particle.
199. A plurality of nucleic acids comprising a first nucleic acid according to any one of embodiments 94 to 133 and a second nucleic acid encoding a Cas9 protein optionally wherein the first nucleic acid and second nucleic acid are in a single container or wherein the first nucleic acid is in a first container and the second nucleic acid is in a second container.
200. The plurality of nucleic acids of embodiment 199, wherein the Cas9 protein has the features of a Cas9 protein described in any one of embodiments 147 to 191.
201. A system comprising a Cas9 protein and the gRNA of any one of embodiments 1 to 93.
202. The system of embodiment 201 , wherein the Cas9 protein has the features of a Cas9 protein described in any one of embodiments 147 to 191.
203. The system of embodiment 201 or embodiment 202, further comprising a second gRNA.
204. The system of embodiment 203, wherein the second gRNA has the features of a second gRNA described in any one of embodiments 98 to 126.
205. A pharmaceutical composition comprising (i) the gRNA of any one of embodiments 1 to 93, the nucleic acid of any one of embodiments 94 to 133, the particle of any one of embodiments 134 to 141, the plurality of particles of any one of embodiments 142 to 198, the plurality of nucleic acids of any one of embodiments 199 to 200, or the system of any one of embodiments 201 to 204 and (ii) a pharmaceutically acceptable excipient.
206. A cell comprising the gRNA of any one of embodiments 1 to 93.
207. A cell comprising the nucleic acid of any one of embodiments 94 to 133.
208. A cell comprising the particle of any one of embodiments 134 to 141.
209. A cell comprising the plurality of particles of any one of embodiments 142 to 198.
210. A cell comprising the plurality of nucleic acids of any one of embodiments 199 to
200
211. A cell comprising the system of any one of embodiments 201 to 204.
212. The cell of any one of embodiments 206 to 211 , which is a human cell.
213. The cell of embodiment 212, which is a human retinal cell.
214. The cell of embodiment 212, which is a human retinal epithelial cell.
215. The cell of embodiment 212, which is a human photoreceptor cell.
216. The cell of embodiment 212, which is a human retinal progenitor cell.
217. The cell of embodiment 212, which is a stem cell.
218. The cell of embodiment 212, which is an iPS cell.
219. The cell of embodiment 212, which is a HEK293T cell.
220. The cell of embodiment 219, which is a HEK293T/17 cell.
221. The cell of any one of embodiments 206 to 220, which is an ex vivo cell.
222. A population of cells according to any one of embodiments 206 to 221.
223. A method of altering a human cell comprising a RHO allele having a pathogenic mutation, comprising contacting the cell with the gRNA of any one of embodiments 1 to 93, the nucleic acid of any one of embodiments 94 to 133, the particle of any one of embodiments 134 to 141, the plurality of nucleic acids of any one of embodiments 142 to 198, the plurality of nucleic acids of any one of embodiments 199 to 200, the system of any one of embodiments 201 to 204, or the pharmaceutical composition of embodiment 205.
224. A method of altering a human cell comprising a RHO allele having a pathogenic mutation and which is heterozygous for the rs7984 SNP, comprising contacting the cell with the gRNA of any one of embodiments 1 to 93, the nucleic acid of any one of embodiments 94 to 133, the particle of any one of embodiments 134 to 141, the plurality of nucleic acids of any one of embodiments 142 to 198, the plurality of nucleic acids of any one of embodiments 199 to 200, the system of any one of embodiments 201 to 204 or the pharmaceutical composition of embodiment 205, provided that R is A when the RHO allele having the pathogenic mutation has an A at the nucleotide position corresponding to rs7984 SNP and R is G when the RHO allele having the pathogenic mutation has a G at nucleotide position corresponding to the rs7984 SNP.
225. The method of embodiment 223 or embodiment 224, wherein the RHO allele having the pathogenic mutation encodes a rhodopsin protein having a P23 mutation or a P347 mutation.
226. The method of embodiment 225, wherein the RHO allele having the pathogenic mutation encodes a rhodopsin protein having a P23 mutation.
227. The method of embodiment 226, wherein the P23 mutation is a P23H mutation.
228. The method of embodiment 223 or embodiment 224, wherein the RHO allele having the pathogenic mutation encodes a rhodopsin protein having a P347 mutation.
229. The method of embodiment 228, wherein the P347 mutation is a P347L
mutation, a P347S mutation, a P347R mutation, a P347Q mutation, a P347T mutation, or a
P347A mutation.
230. The method of embodiment 229, wherein the P347 mutation is a P347L mutation.
231. The method of embodiment 229, wherein the P347 mutation is a P347S mutation.
232. The method of embodiment 229, wherein the P347 mutation is a P347R mutation.
233. The method of embodiment 229, wherein the P347 mutation is a P347Q mutation.
234. The method of embodiment 229, wherein the P347 mutation is a P347T mutation.
235. The method of embodiment 229, wherein the P347 mutation is a P347A mutation.
236. The method of any one of embodiments 223 to 235, which comprises contacting the cell with the plurality of particles of any one of 142 to 198.
237. The method of any one of embodiments 223 to 235, which comprises contacting the cell with the system of any one of embodiments 201 to 204.
238. The method of embodiment 237, wherein the contacting comprises delivering the system to the cell via one or more particles and/or one or more vectors.
239. The method of embodiment 238, wherein the contacting comprises delivering the system to the cell via one or more particles.
240. The method of embodiment 238, wherein the one or more particles comprise a lipid nanoparticle, a vesicle, or a gold nanoparticle.
241. The method of any one of embodiments 238 to 240, wherein the contacting comprises delivering the system to the cell via one or more vectors.
242. The method of embodiment 241 , wherein the one or more vectors comprise one or more viral vectors.
243. The method of embodiment 242, wherein the one or more viral vectors comprise an adeno-associated virus (AAV), a lentivirus, or an adenovirus.
244. The method of embodiment 243, wherein the one or more viral vectors comprise an adeno-associated virus (AAV).
245. The method of embodiment 244, wherein the one or more viral vectors comprise one or more AAV2, AAV5, AAV7m8, or AAV8 vectors.
246. The method of embodiment 245, wherein the one or more viral vectors comprise one or more AAV2 vectors.
247. The method of embodiment 245 or embodiment 246, wherein the one or more
viral vectors comprise one or more AAV5 vectors.
248. The method of any one of embodiments 245 to 247, wherein the one or more viral vectors comprise one or more AAV7m8 vectors.
249. The method of any one of embodiments 245 to 248, wherein the one or more viral vectors comprise one or more AAV8 vectors.
250. The method of any one of embodiments 244 to 254, wherein the one or more viral vectors comprise a first AAV vector encoding the Cas9 protein and a second AAV vector encoding the gRNA(s).
251. The method of embodiment 250, wherein the AAV vector encoding the Cas9 protein and the AAV vector encoding the gRNA(s) are provided in the same composition.
252. The method of embodiment 250, wherein the AAV vector encoding the Cas9 protein and the AAV vector encoding the gRNA(s) are provided in different compositions.
253. The method of any one of embodiments 244 to 252, wherein the one or more viral vectors comprise an AAV2 vector encoding the Cas9 protein.
254. The method of any one of embodiments 244 to 252, wherein the one or more viral vectors comprise an AAV8 vector encoding the Cas9 protein.
255. The method of any one of embodiments 244 to 254, wherein the one or more viral vectors comprise an AAV2 vector encoding the gRNA(s).
256. The method of any one of embodiments 244 to 254, wherein the one or more viral vectors comprise an AAV8 vector encoding the gRNA(s).
257. The method of embodiment 243, wherein the one or more viral vectors comprise a lentivirus.
258. The method of embodiment 243, wherein the one or more viral vectors comprise an adenovirus.
259. The method of any one of embodiments 241 to 258, wherein the one or more viral vectors comprise nucleic acid(s) encoding the gRNA(s) and the Cas9 protein each operably linked to a promoter.
260. The method of embodiment 259, wherein the nucleic acid encoding the gRNA(s) is/are operably linker to a Pol III promoter.
261. The method of embodiment 260, wherein the Pol III promoter is a U6 promoter.
262. The method of embodiment 260, wherein the Pol III promoter is a H1 promoter.
263. The method of any one of embodiments 259 to 262, wherein the nucleic acid encoding the Cas9 protein is operably linked to a promoter, which is optionally a tissue specific promoter.
264. The method of embodiment 263, wherein the promoter is a hGRK1 promoter.
265. The method of embodiment 263, wherein the promoter is a RHO promoter.
266. The method of any one of embodiments 259 to 262, wherein the nucleic acid
encoding the Cas9 protein is operably linked to a constitutive promoter.
267. The method of embodiment 266, wherein the constitutive promoter is an EF1 alpha promoter, e.g., an EF1 alpha short (EFS) promoter.
268. The method of any one of embodiments 223 to 267, wherein the cell is a stem cell.
269. The method of any one of embodiments 223 to 267, wherein the cell is an iPS cell.
270. The method of any one of embodiments 223 to 267, wherein the cell is a human retinal cell.
271. The method of any one of embodiments 223 to 267, wherein the cell is a human retinal epithelial cell.
272. The method of any one of embodiments 223 to 267, wherein the cell is a human photoreceptor cell.
273. The method of any one of embodiments 223 to 267, wherein the cell is a human retinal progenitor cell.
274. The method of any one of embodiments 223 to 273, wherein the contacting results in a deletion in the RHO allele encoding the pathogenic mutation.
275. The method of any one of embodiments 223 to 274, wherein the cell contains a human RHO allele having the pathogenic mutation and contains a human RHO allele not having the pathogenic mutation.
276. The method of embodiment 275, wherein as a result of the contacting, indels at the rs7984 locus in phase with the human RHO allele not having the pathogenic mutation occur with a frequency of less than 20%.
277. The method of embodiment 275, wherein as a result of the contacting, indels at the rs7984 locus in phase with the human RHO allele not having the pathogenic mutation occur with a frequency of less than 10%.
278. The method of embodiment 275, wherein as a result of the contacting, indels at the rs7984 locus in phase with the human RHO allele not having the pathogenic mutation occur with a frequency of less than 5%.
279. The method of embodiment 275, wherein as a result of the contacting, indels at the rs7984 locus in phase with the human RHO allele not having the pathogenic mutation occur with a frequency of less than 2%.
280. The method of any one of embodiments 275 to 279, wherein the contacting results in preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having the pathogenic mutation.
281. The method of embodiment 280, wherein the preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having
the pathogenic mutation is by a factor of at least 1.5.
282. The method of embodiment 280, wherein the preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having the pathogenic mutation is by a factor of at least 2.
283. The method of embodiment 280, wherein the preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having the pathogenic mutation is by a factor of at least 2.5.
284. The method of embodiment 280, wherein the preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having the pathogenic mutation is by a factor of at least 3.
285. The method of embodiment 280, wherein the preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having the pathogenic mutation is by a factor of at least 4.
286. The method of embodiment 280, wherein the preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having the pathogenic mutation is by a factor of at least 5.
287. The method of embodiment 280, wherein the preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having the pathogenic mutation is by a factor of at least 10.
288. The method of embodiment 280, wherein the preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having the pathogenic mutation is by a factor of at least 100.
289. The method of any one of embodiments 280 to 286, wherein the preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having the pathogenic mutation is by a factor of up to 5.
290. The method of any one of embodiments 280 to 286, wherein the preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having the pathogenic mutation is by a factor of up to 10.
291. The method of any one of embodiments 280 to 287, wherein the preferential formation of a deletion in the RHO allele having the pathogenic mutation over a deletion in the RHO allele not having the pathogenic mutation is by a factor of up to 11.
292. The method of any one of embodiments 223 to 291 , wherein the contacting results in deletion of one or more nucleotides in the RHO allele having the pathogenic mutation.
293. The method of any one of embodiments 223 to 292, wherein the method reduces expression of rhodopsin comprising the pathogenic mutation in the cell.
294. The method of any one of embodiments 223 to 293, wherein the method reduces expression of rhodopsin not comprising the pathogenic mutation in the cell by less than
50%.
295. The method of any one of embodiments 223 to 293, wherein the method reduces expression of rhodopsin not comprising the pathogenic mutation in the cell by less than 40%.
296. The method of any one of embodiments 223 to 293, wherein the method reduces expression of rhodopsin not comprising the pathogenic mutation in the cell by less than 30%.
297. The method of any one of embodiments 223 to 293, wherein the method reduces expression of rhodopsin not comprising the pathogenic mutation in the cell by less than 20%.
298. The method of any one of embodiments 223 to 293, wherein the method reduces expression of rhodopsin not comprising the pathogenic mutation in the cell by less than 10%.
299. The method of any one of embodiments 223 to 298, wherein the cell is a cell from a subject having a RHO allele with the pathogenic mutation or a progeny of such cell.
300. The method of embodiment 299, wherein the subject is heterozygous for the rs7984 SNP and the subject is heterozygous for the pathogenic mutation.
301. The method of embodiment 300, which further comprises a step of genotyping the subject to determine which allele of the rs7984 SNP is in phase with the pathogenic mutation.
302. The method of any one of embodiments 299 to 301 , wherein the contacting is performed ex vivo.
303. The method of embodiment 302, which further comprises returning the contacted cell or a progeny thereof to the subject.
304. The method of any one of embodiments 299 to 301 , wherein the contacting is performed in vivo.
305. The method of embodiment 304, wherein the contacting is performed in or near an eye of the subject.
306. The method of embodiment 305, wherein the contacting comprises delivering the gRNA, nucleic acid, plurality of nucleic acids, particle, plurality of particles, system, or pharmaceutical composition to the eye by sub-retinal injection.
307. The method of embodiment 305, wherein the contacting comprises delivering the gRNA, nucleic acid, plurality of nucleic acids, particle, plurality of particles, system, or pharmaceutical composition to the eye by intravitreal injection.
308. A guide RNA molecule (gRNA) for editing a RHO gene, the gRNA comprising a spacer whose nucleic acid sequence comprises 15 or more consecutive nucleotides from a
reference sequence or comprises a nucleotide sequence that is at least 85% identical to a reference sequence, wherein the reference sequence is: a) GCCGGGCUGCUGUUUGUGCA (SEQ ID NO:27); b) GCAGGAGCCCGGGAGCAUGG (SEQ ID NO:24); c) GUCUGGGAGAGUCCCGGGCU (SEQ ID NO:25); d) GAGAGUCCCGGGCUUGGCGG (SEQ ID NO:26); e) GCCCUGCUGGGGCGUCACAC (SEQ ID NO:28); f) GGACGGGUGCAGAGUUGAGU (SEQ ID NO:29); g) GUGCUGAGUCAGACCCAGGC (SEQ ID NO:30); h) GCAAUGGGCUCGGUCCCCUC (SEQ ID N0:31); i) GUAUGAGCCGGGUGUGGGUG (SEQ ID NO:32); j) GCUUGGCGGUGGUGGCUGAG (SEQ ID NO:33); k) GGGCUUUGGAUAACAUUGAC (SEQ ID NO:34);
L) GACUGAAUAUAUGAGGGCUU (SEQ ID NO:35); m) GCCCUGCACAAACAGCAGCC (SEQ ID NO:36); n) GCUGGGGCGUCACACAGGGA (SEQ ID NO:37); o) GAGGCUUGGUGCUGCAAACA (SEQ ID NO:38); or p) GCCAGACCCCUCCUCUCUGG (SEQ ID NO:39).
309. The gRNA of embodiment 308, wherein the spacer comprises a nucleotide sequence that is at least 85% identical to the reference sequence.
310. The gRNA of embodiment 308, wherein the spacer comprises a nucleotide sequence that is at least 90% identical to the reference sequence.
311. The gRNA of embodiment 308, wherein the spacer comprises a nucleotide sequence that is at least 95% identical to the reference sequence.
312. The gRNA of embodiment 308, wherein the spacer comprises a nucleotide sequence that has one mismatch relative to the reference sequence.
313. The gRNA of embodiment 308, wherein the spacer comprises a nucleotide sequence that has two mismatches relative to the reference sequence.
314. The gRNA of embodiment 308, wherein the nucleotide sequence of the spacer comprises 15 or more consecutive nucleotides from the reference sequence.
315. The gRNA of embodiment 308, wherein the nucleotide sequence of the spacer comprises 16 or more consecutive nucleotides from the reference sequence.
316. The gRNA of embodiment 308, wherein the nucleotide sequence of the spacer comprises 17 or more consecutive nucleotides from the reference sequence.
317. The gRNA of embodiment 308, wherein the nucleotide sequence of the spacer comprises 18 or more consecutive nucleotides from the reference sequence.
318. The gRNA of embodiment 308, wherein the nucleotide sequence of the spacer comprises 19 or more consecutive nucleotides from the reference sequence.
319. The gRNA of embodiment 308, wherein the nucleotide sequence of the spacer comprises the reference sequence.
320. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCCGGGCUGCUGUUUGUGCA (SEQ ID NO:27).
321. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCAGGAGCCCGGGAGCAUGG (SEQ ID NO:24).
322. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GUCUGGGAGAGUCCCGGGCU (SEQ ID NO:25).
323. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GAGAGUCCCGGGCUUGGCGG (SEQ ID NO:26).
324. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCCCUGCUGGGGCGUCACAC (SEQ ID NO:28).
325. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GGACGGGUGCAGAGUUGAGU (SEQ ID NO:29).
326. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GUGCUGAGUCAGACCCAGGC (SEQ ID NO:30).
327. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCAAUGGGCUCGGUCCCCUC (SEQ ID NO:31).
328. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GUAUGAGCCGGGUGUGGGUG (SEQ ID NO:32).
329. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCUUGGCGGUGGUGGCUGAG (SEQ ID NO:33).
330. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GGGCUUUGGAUAACAUUGAC (SEQ ID NO:34).
331. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GACUGAAUAUAUGAGGGCUU (SEQ ID NO:35).
332. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCCCUGCACAAACAGCAGCC (SEQ ID NO:36).
333. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCUGGGGCGUCACACAGGGA (SEQ ID NO:37).
334. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GAGGCUUGGUGCUGCAAACA (SEQ ID NO:38).
335. The gRNA of any one of embodiments 308 to 319, wherein the reference sequence is GCCAGACCCCUCCUCUCUGG (SEQ ID NO:39).
336. The gRNA of any one of embodiments 308 to 335, which comprises a spacer that is 15 to 30 nucleotides in length.
337. The gRNA of embodiment 336, wherein the spacer is 15 to 25 nucleotides in length.
338. The gRNA of embodiment 336, wherein the spacer is 16 to 24 nucleotides in length.
339. The gRNA of embodiment 336, wherein the spacer is 17 to 23 nucleotides in length.
340. The gRNA of embodiment 336, wherein the spacer is 18 to 22 nucleotides in length.
341. The gRNA of embodiment 336, wherein the spacer is 19 to 21 nucleotides in length.
342. The gRNA of embodiment 336, wherein the spacer is 18 to 30 nucleotides in length.
343. The gRNA of embodiment 336, wherein the spacer is 20 to 28 nucleotides in length.
344. The gRNA of embodiment 336, wherein the spacer is 22 to 26 nucleotides in length.
345. The gRNA of embodiment 336, wherein the spacer is 23 to 25 nucleotides in length.
346. The gRNA of embodiment 336, wherein the spacer is 20 nucleotides in length.
347. The gRNA of embodiment 336, wherein the spacer is 21 nucleotides in length.
348. The gRNA of embodiment 336, wherein the spacer is 22 nucleotides in length.
349. The gRNA of embodiment 336, wherein the spacer is 23 nucleotides in length.
350. The gRNA of embodiment 336, wherein the spacer is 24 nucleotides in length.
351. The gRNA of embodiment 336, wherein the spacer is 25 nucleotides in length
352. The gRNA of any one of embodiments 308 to 351 , which is a Cas9 gRNA.
353. The gRNA of embodiment 352, which is a Streptococcus pyogenes Cas9 (SpCas9) gRNA.
354. The gRNA of any one of embodiments 308 to 353, which is a single guide RNA (sgRNA).
355. The gRNA of embodiment 354, which comprises a 3’ sgRNA segment.
356. The gRNA of embodiment 355, wherein the 3’ sgRNA segment has a nucleotide sequence comprising a sequence set forth in Table 3.
357. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 1 as set forth in Table 3.
358. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 2 as set forth in Table 3.
359. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 3 as set forth in Table 3.
360. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 4 as set forth in Table 3.
361. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 5 as set forth in Table 3.
362. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 6 as set forth in Table 3.
363. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 7 as set forth in Table 3.
364. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 8 as set forth in Table 3.
365. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 9 as set forth in Table 3.
366. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 10 as set forth in Table 3.
367. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 11 as set forth in Table 3.
368. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 12 as set forth in Table 3.
369. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 13 as set forth in Table 3.
370. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 14 as set forth in Table 3.
371. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 15 as set forth in Table 3.
372. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 16 as set forth in Table 3.
373. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 17 as set forth in Table 3.
374. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 18 as set forth in Table 3.
375. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 19 as set forth in Table 3.
376. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 20 as set forth in Table 3.
377. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 21 as set forth in Table 3.
378. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 22 as set forth in Table 3.
379. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 23 as set forth in Table 3.
380. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 24 as set forth in Table 3.
381. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 25 as set forth in Table 3.
382. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 26 as set forth in Table 3.
383. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 27 as set forth in Table 3.
384. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 28 as set forth in Table 3.
385. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 29 as set forth in Table 3.
386. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 30 as set forth in Table 3.
387. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 31 as set forth in Table 3.
388. The gRNA of embodiment 356, wherein the 3’ sgRNA segment comprises the nucleotide sequence of 3’ sgRNA sequence 32 as set forth in Table 3.
389. The gRNA of any one of embodiments 355 to 388, wherein the 3’ sgRNA segment comprises one or more uracils at its 3’ end.
390. The gRNA of embodiment 389, wherein the 3’ sgRNA segment comprises one to eight uracils at its 3’ end.
391. The gRNA of embodiment 389, wherein the 3’ sgRNA segment comprises one uracil at its 3’ end.
392. The gRNA of embodiment 389, wherein the 3’ sgRNA segment comprises two uracils at its 3’ end.
393. The gRNA of embodiment 389, wherein the 3’ sgRNA segment comprises three uracils at its 3’ end.
394. The gRNA of embodiment 389, wherein the 3’ sgRNA segment comprises four uracils at its 3’ end.
395. The gRNA of embodiment 389, wherein the 3’ sgRNA segment comprises five uracils at its 3’ end.
396. The gRNA of embodiment 389, wherein the 3’ sgRNA segment comprises six uracils at its 3’ end.
397. The gRNA of embodiment 389, wherein the 3’ sgRNA segment comprises seven uracils at its 3’ end.
398. The gRNA of embodiment 389, wherein the 3’ sgRNA segment comprises eight uracils at its 3’ end.
399. The gRNA of any one of embodiments 308 to 398, wherein the gRNA is an unmodified gRNA.
400. The gRNA of any one of embodiments 308 to 399, which comprises one or more modifications.
401. The gRNA of embodiment 400, wherein the one or more modifications comprises one or more 2’-0-methyl phosphorothioate nucleotides.
402. A nucleic acid encoding the gRNA of any one of embodiments 308 to 399.
403. The nucleic acid of embodiment 402, which further comprises a Pol III promoter sequence operably linked to the nucleotide sequence encoding the gRNA.
404. The nucleic acid of embodiment 403, wherein the promoter is a U6 promoter.
405. The nucleic acid of embodiment 403, wherein the promoter is a H1 promoter.
406. The nucleic acid of any one of embodiments 402 to 405, which further encodes a second gRNA.
407. The nucleic acid of embodiment 98, wherein the second gRNA is a gRNA as described in any one of embodiments 1 to 93.
408. A particle comprising the gRNA of any one of embodiments 308 to 401 or the nucleic acid of any one of embodiments 402 to 407.
409. The particle of embodiment 408, wherein the particle is a viral particle, a lipid nanoparticle, a vesicle, or a gold nanoparticle.
410. The particle of embodiment 409, wherein the particle is a viral particle.
411. The particle of embodiment 410, wherein the particle is an adeno-associated virus (AAV) particle.
412. The particle of embodiment 411, which is a AAV2 particle.
413. The particle of embodiment 411, which is a AAV5 particle.
414. The particle of embodiment 411, which is a AAV7m8 particle.
415. The particle of embodiment 411, which is a AAV8 particle.
416. A plurality of particles comprising a first particle according to any one of embodiments 408 to 415 and a second particle comprising a nucleic acid encoding a Cas9 protein.
417. The plurality of particles of embodiment 416, where the second particle is a second particle as described in any one of embodiments 142 to 198.
418. A modified Cas9 protein comprising one or more mutations, wherein the position of the one or more mutations is identified by reference to the amino acid numbering in an unmodified mature Streptococcus pyogenes Cas9 (SpCas9) as set forth in SEQ ID NO:1
419. The modified Cas9 protein of embodiment 418, which comprises a K526 mutation.
420. The modified Cas9 protein of embodiment 419, wherein the K526 mutation is a K526E mutation.
421. The modified Cas9 protein of embodiment 419, wherein the K526 mutation is a K526D mutation.
422. The modified Cas9 protein of embodiment 419, wherein the K526 mutation is a K526A mutation.
423. The modified Cas9 protein of embodiment 419, wherein the K526 mutation is a K526N mutation.
424. The modified Cas9 protein of any one of embodiments 418 to 423, which comprises a Y515 mutation.
425. The modified Cas9 protein of embodiment 424, wherein the Y515 mutation is a Y515N mutation.
426. The modified Cas9 protein of any one of embodiments 418 to 425, which comprises a R661 mutation.
427. The modified Cas9 protein of embodiment 426, wherein the R661 mutation is a R661Q mutation.
428. The modified Cas9 protein of embodiment 426, wherein the R661 mutation is a R661S mutation.
429. The modified Cas9 protein of embodiment 426, wherein the R661 mutation is a R661L mutation.
430. The modified Cas9 protein of embodiment 426, wherein the R661 mutation is a R661D mutation.
431. The modified Cas9 protein of embodiment 426, wherein the R661 mutation is a R661E mutation.
432. The modified Cas9 protein of embodiment 426, wherein the R661 mutation is a R661F mutation.
433. The modified Cas9 protein of embodiment 426, wherein the R661 mutation is a
R661M mutation.
434. The modified Cas9 protein of embodiment 426, wherein the R661 mutation is a R661W mutation.
435. The modified Cas9 protein of embodiment 426, wherein the R661 mutation is a R661Y mutation.
436. The modified Cas9 protein of embodiment 426, wherein the R661 mutation is a R661A mutation.
437. The modified Cas9 protein of any one of embodiments 418 to 436, which comprises a M495 mutation.
438. The modified Cas9 protein of embodiment 437, wherein the M495 mutation is M495V mutation.
439. The modified Cas9 protein of any one of embodiments 418 to 438, which comprises a H698Q mutation.
440. The modified Cas9 protein of embodiment 418, which comprises K526E and R661S mutations.
441. The modified Cas9 protein of embodiment 418, which comprises K526E and R661Q mutations.
442. The modified Cas9 protein of embodiment 418, which comprises K526E and R661L mutations.
443. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526E, and R661S mutations.
444. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526E, and R661Q mutations.
445. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526E, and R661L mutations.
446. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526E, and R661D mutations.
447. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526E, and R661E mutations.
448. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526E, and R661F mutations.
449. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526E, and R661M mutations.
450. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526E, and R661W mutations.
451. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526E, and R661Y mutations.
452. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526E, and M495V mutations.
453. The modified Cas9 protein of embodiment 418, which comprises M495V,
Y515N, K526E, and R661Q mutations.
454. The modified Cas9 protein of embodiment 418, which comprises M495V, K526E, R661Q, and H698Q mutations.
455. The modified Cas9 protein of embodiment 418, which comprises M495V,
Y515N, K526E, and R661A mutations.
456. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526D, and R661Q mutations.
457. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526D, and R661L mutations.
458. The modified Cas9 protein of embodiment 418, which comprises Y515N, K526D, and R661W mutations.
459. The modified Cas9 protein of embodiment 418, which comprises M495V,
Y515N, K526D, and R661Q mutations.
460. The modified Cas9 protein of embodiment 418, which comprises M495V,
Y515N, K526A, and R661Q mutations.
461. The modified Cas9 protein of any one of embodiments 418 to 460, which is a modified S. pyogenes Cas9.
462. The modified Cas9 protein of any one of embodiments 418 to 461 , wherein the amino acid sequence of the modified Cas9 protein comprises an amino acid sequence which is at least 90% identical to SEQ ID NO:1.
463. The modified Cas9 protein of any one of embodiments 418 to 461 , wherein the amino acid sequence of the modified Cas9 protein comprises an amino acid sequence which is at least 95% identical to SEQ ID NO:1.
464. The modified Cas9 protein of any one of embodiments 418 to 461 , wherein the amino acid sequence of the modified Cas9 protein comprises an amino acid sequence which is at least 97% identical to SEQ ID NO:1.
465. The modified Cas9 protein of any one of embodiments 418 to 461 , wherein the amino acid sequence of the modified Cas9 protein comprises an amino acid sequence which is at least 99% identical to SEQ ID NO:1.
466. The modified Cas9 protein of any one of embodiments 418 to 465, which is a modified S. pyogenes Cas9 orthologue.
467. The modified Cas9 protein of embodiment 466, wherein the S. pyogenes Cas9 orthologue is S. thermophilus.
468. The modified Cas9 protein of embodiment 466, wherein the S. pyogenes Cas9
orthologue is S. aureus.
469. The modified Cas9 protein of embodiment 466, wherein the S. pyogenes Cas9 orthologue is N. meningitides.
470. A fusion protein comprising the modified Cas9 protein of any one of embodiments 418 to 469 fused to a second amino acid sequence.
471. The fusion protein of embodiment 470, wherein the second amino acid sequence comprises a nuclear localization signal.
472. The fusion protein of embodiment 470, wherein the second amino acid sequence comprises a non-native tag.
473. The fusion protein of embodiment 470, wherein the second amino acid sequence comprises a transcriptional activator, a transcriptional repressor, a histone-modifying protein, an integrase, or a recombinase.
474. A nucleic acid encoding the modified Cas9 protein of any one of embodiments 418 to 469 or the fusion protein of any one of embodiments 470 to 473.
475. The nucleic acid of embodiment 474, which is a plasmid.
476. The nucleic acid of embodiment 474, which is a viral genome.
477. The nucleic acid of embodiment 474, wherein the viral genome is an adeno- associated virus (AAV) genome.
478. The nucleic acid of embodiment 477, wherein the AAV genome is a AAV2,
AAV5, AAV7m8, or AAV8 genome.
479. A particle comprising the modified Cas9 protein of any one of embodiments 418 to 469, the fusion protein of any one of embodiments 470 to 473 or the nucleic acid of any one of embodiments 474 to 478.
480. The particle of embodiment 479, wherein the particle is a viral particle, a lipid nanoparticle, a vesicle, or a gold nanoparticle.
481. The particle of embodiment 480, wherein the particle is a viral particle.
482. The particle of embodiment 481, wherein the particle is an adeno-associated virus (AAV) particle.
483. The particle of embodiment 482, which is a AAV2 particle.
484. The particle of embodiment 482, which is a AAV5 particle.
485. The particle of embodiment 482, which is a AAV7m8 particle.
486. The particle of embodiment 482, which is a AAV8 particle.
487. A system comprising the modified Cas9 protein of any one of embodiments 418 to 469 or the fusion protein of any one of embodiments 470 to 473 and a gRNA.
488. The system of embodiment 487, which comprises a first gRNA as described in any one of embodiments 1 to 93 and a second gRNA as described in any one of embodiments
308 to 401.
489. The system of embodiment 487, wherein the gRNA is a gRNA as described in any one of embodiments 1 to 93 and 308 to 401.
490. A pharmaceutical composition comprising the gRNA of any one of embodiments 308 to 401 , the nucleic acid of any one of embodiments 402 to 407, the particle of any one of embodiments 408 to 415, the plurality of particles of any one of embodiments 416 to 417, the modified Cas9 protein of any one of embodiments 418 to 469, the fusion protein of any one of embodiments 470 to 473, the nucleic acid of any one of embodiments 474 to 478, the particle of any one of embodiments 479 to 486, or the system of any one of embodiments 487 to 489 and at least one pharmaceutically acceptable excipient.
491. A cell comprising the gRNA of any one of embodiments 308 to 401.
492. A cell comprising the nucleic acid of any one of embodiments 402 to 407.
493. A cell comprising the particle of any one of embodiments 408 to 415.
494. A cell comprising the plurality of particles of any one of embodiments 416 to 417.
495. A cell comprising the modified Cas9 protein of any one of embodiments 418 to
469.
496. A cell comprising the fusion protein of any one of embodiments 470 to 473.
497. A cell comprising the nucleic acid of any one of embodiments 474 to 478.
498. A cell comprising the particle of any one of embodiments 479 to 486.
499. A cell comprising the system of any one of embodiments 487 to 489.
500. The cell of any one of embodiments 491 to 499, which is a human cell.
501. The cell of embodiment 500, which is a human retinal cell.
502. The cell of embodiment 500, which is a human retinal epithelial cell.
503. The cell of embodiment 500, which is a human photoreceptor cell.
504. The cell of embodiment 500, which is a human retinal progenitor cell.
505. The cell of embodiment 500, which is a stem cell.
506. The cell of embodiment 500, which is an iPS cell.
507. The cell of embodiment 500, which is a HEK293T cell.
508. The cell of embodiment 500, which is a HEK293T/17 cell.
509. The cell of any one of embodiments 491 to 508, which is an ex vivo cell.
510. A population of cells according to any one of embodiments 491 to 509.
511. The gRNA of any one of embodiments 1 to 93, the nucleic acid of any one of embodiments 94 to 133, the particle of any one of embodiments 134 to 141, the plurality of nucleic acids of any one of embodiments 142 to 198, the plurality of nucleic acids of any one of embodiments 199 to 200, the system of any one of embodiments 201 to 204, or the pharmaceutical composition of embodiment 205 for use in a method of altering a human cell comprising a RHO allele having a pathogenic mutation, optionally wherein the method is a method according to any one of embodiments 223 to 307.
512. The gRNA of any one of embodiments 308 to 401, the nucleic acid of any one of embodiments 402 to 407, the particle of any one of embodiments 408 to 415, the plurality of particles of any one of embodiments 416 to 417, the modified Cas9 protein of any one of embodiments 418 to 469, the fusion protein of any one of embodiments 470 to 473, the nucleic acid of any one of embodiments 474 to 478, the particle of any one of embodiments 479 to 486, the system of any one of embodiments 487 to 489, or the pharmaceutical composition of embodiment 490 for use in a method of altering a human cell comprising a RHO allele having a pathogenic mutation, optionally wherein the method is a method according to any one of embodiments 223 to 307.
513. The gRNA of any one of embodiments 1 to 93, the nucleic acid of any one of embodiments 94 to 133, the particle of any one of embodiments 134 to 141, the plurality of nucleic acids of any one of embodiments 142 to 198, the plurality of nucleic acids of any one of embodiments 199 to 200, the system of any one of embodiments 201 to 204, or the pharmaceutical composition of embodiment 205 for use in a method of altering a human cell comprising a RHO allele having a pathogenic mutation and which is heterozygous for the rs7984 SNP, optionally wherein the method is a method according to any one of embodiments 223 to 307
514. The gRNA of any one of embodiments 308 to 401, the nucleic acid of any one of embodiments 402 to 407, the particle of any one of embodiments 408 to 415, the plurality of particles of any one of embodiments 416 to 417, the modified Cas9 protein of any one of embodiments 418 to 469, the fusion protein of any one of embodiments 470 to 473, the nucleic acid of any one of embodiments 474 to 478, the particle of any one of embodiments 479 to 486, the system of any one of embodiments 487 to 489, or the pharmaceutical composition of embodiment 490 for use in a method of altering a human cell comprising a RHO allele having a pathogenic mutation and which is heterozygous for the rs7984 SNP, optionally wherein the method is a method according to any one of embodiments 223 to 307.
515. A gRNA according to any one of embodiments 1 to 93 for use in combination with a second gRNA according to any one of embodiments 308 to 401 for use in a method of editing a human RHO allele, optionally wherein the method is a method according to any one of embodiments 223 to 307.
516. A gRNA according to any one of embodiments 308 to 401 for use in combination with a second gRNA according to any one of embodiments 1 to 93 for use in a method of editing a human RHO allele, optionally wherein the method is a method according to any one of embodiments 223 to 307.
517. The gRNA of embodiment 515 or embodiment 516 for use in combination with a Cas9 protein for use in a method of editing a human RHO allele, optionally wherein the Cas9
protein is a Cas9 protein according to any one of embodiments 418 to 469, optionally wherein the method is a method according to any one of embodiments 223 to 307.
518. A first particle according to any one of embodiments 134 to 141 for use in combination with a second particle according to any one of embodiments 479 to 486 in a method of editing a human RHO allele, optionally wherein the method is a method according to any one of embodiments 223 to 307.
519. A first particle according to any one of embodiments 479 to 486 for use in combination with a second particle according to any one of embodiments 134 to 141 in a method of editing a human RHO allele, optionally wherein the method is a method according to any one of embodiments 223 to 307.
9. CITATION OF REFERENCES
[0266] All publications, patents, patent applications and other documents cited in this application are hereby incorporated by reference in their entireties for all purposes to the same extent as if each individual publication, patent, patent application or other document were individually indicated to be incorporated by reference for all purposes. In the event that there is an inconsistency between the teachings of one or more of the references incorporated herein and the present disclosure, the teachings of the present specification are intended.
Claims
WHAT IS CLAIMED IS:
1. A guide RNA molecule (gRNA) for editing a human RHO gene, the gRNA comprising a spacer whose nucleotide sequence comprises 15 or more consecutive nucleotides of a reference sequence, wherein the reference sequence is: a) GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2); b) a sequence having one or two mismatches with the sequence GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2); c) CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3); d) a sequence having one or two mismatches with the sequence CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3); e) UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4); or f) a sequence having one or two mismatches with the sequence UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4); wherein R is A or G.
2. The gRNA of claim 1 , which comprises a spacer that is: a) 15 to 30 nucleotides in length; b) 15 to 25 nucleotides in length; c) 16 to 24 nucleotides in length; d) 17 to 23 nucleotides in length; e) 18 to 22 nucleotides in length; f) 19 to 21 nucleotides in length; g) 18 to 30 nucleotides in length; h) 20 to 28 nucleotides in length; i) 22 to 26 nucleotides in length; j) 23 to 25 nucleotides in length; k) 20 nucleotides in length;
L) 21 nucleotides in length; m) 22 nucleotides in length; n) 23 nucleotides in length;
o) 24 nucleotides in length; or p) 25 nucleotides in length.
3. The gRNA of claim 1 or claim 2, wherein the spacer comprises: a) 16 or more consecutive nucleotides of the reference sequence; b) 17 or more consecutive nucleotides of the reference sequence; c) 18 or more consecutive nucleotides of the reference sequence; d) 19 or more consecutive nucleotides of the reference sequence; e) 20 consecutive nucleotides of the reference sequence; or f) the reference sequence.
4. The gRNA of any one of claims 1 to 3, wherein the reference sequence is: a) GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2); b) ACAGCCRCGGGUCAGCCACA (SEQ ID NO:7); c) CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3); or d) UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4).
5. The gRNA of claim 1 , wherein the nucleotide sequence of the spacer is: a) GCAGCCRCGGGUCAGCCACA (SEQ ID NO:2); b) ACAGCCRCGGGUCAGCCACA (SEQ ID NO:7); c) CAGCCRCGGGUCAGCCACAA (SEQ ID NO:3); d) GAGCCRCGGG UCAGCCACAA (SEQ ID NO:228); e) GCAGCCRCGGGUCAGCCACAA (SEQ ID NO:229); f) UCUUGGGUGGGAGCAGCCRC (SEQ ID NO:4); g) GCUUGGGUGGGAGCAGCCRC (SEQ ID NO:230); h) GUCUUGGGUGGGAGCAGCCRC (SEQ ID NO:231).
6. The gRNA of any one of claims 1 to 5, wherein R is A.
7. The gRNA of any one of claims 1 to 5, wherein R is G.
8. The gRNA of any one of claims 1 to 7, which is a Cas9 gRNA, optionally a Streptococcus pyogenes Cas9 (SpCas9) gRNA.
9. The gRNA of any one of claims 1 to 8, which is a single guide RNA (sgRNA).
10. The gRNA of claim 9, which comprises a 3’ sgRNA segment, optionally wherein the 3’ sgRNA segment has a nucleotide sequence comprising a sequence set forth in Table 3.
11. The gRNA of claim 10, wherein the 3’ sgRNA segment comprises one or more uracils at its 3’ end.
12. A nucleic acid encoding the gRNA of any one of claims 1 to 11 , optionally wherein the nucleic acid further comprises a Pol III promoter sequence operably linked to the nucleotide sequence encoding the gRNA, optionally wherein the Pol III promoter is a U6 promoter or a H1 promoter.
13. The nucleic acid of claim 12, which further encodes a second gRNA, optionally wherein the second gRNA comprises a spacer sequence that is partially or fully complementary to a target sequence in a human RHO gene.
14. The nucleic acid of claim 13, wherein the second gRNA comprises a spacer sequence that is partially or fully complementary to a target sequence in intron 1 of a human RHO gene.
15. The nucleic acid of claim 14, wherein the spacer sequence of the second gRNA comprises 15 or more consecutive nucleotides of a reference sequence, wherein the reference sequence is: a) GCCGGGCUGCUGUUUGUGCA (SEQ ID NO:27); b) GCAGGAGCCCGGGAGCAUGG (SEQ ID NO:24); c) GUCUGGGAGAGUCCCGGGCU (SEQ ID NO:25); d) GAGAGUCCCGGGCUUGGCGG (SEQ ID NO:26); e) GCCCUGCUGGGGCGUCACAC (SEQ ID NO:28); f) GGACGGGUGCAGAGUUGAGU (SEQ ID NO:29); g) GUGCUGAGUCAGACCCAGGC (SEQ ID NO:30); h) GCAAUGGGCUCGGUCCCCUC (SEQ ID NO:31); i) GUAUGAGCCGGGUGUGGGUG (SEQ ID NO:32);
j) GCUUGGCGGUGGUGGCUGAG (SEQ ID NO:33); k) GGGCUUUGGAUAACAUUGAC (SEQ ID NO:34);
L) GACUGAAUAUAUGAGGGCUU (SEQ ID NO:35); m) GCCCUGCACAAACAGCAGCC (SEQ ID NO:36); n) GCUGGGGCGUCACACAGGGA (SEQ ID NO:37); o) GAGGCUUGGUGCUGCAAACA (SEQ ID NO:38); or p) GCCAGACCCCUCCUCUCUGG (SEQ ID NO:39).
16. The nucleic acid of claim 15, wherein the nucleotide sequence of the spacer of the second gRNA comprises: a) 16 or more consecutive nucleotides from the reference sequence; b) 17 or more consecutive nucleotides from the reference sequence; c) 18 or more consecutive nucleotides from the reference sequence; d) 19 or more consecutive nucleotides from the reference sequence; or e) the reference sequence.
17. The nucleic acid of any one of claims 12 to 16, wherein the nucleic acid is a viral genome, which is optionally an adeno-associated virus (AAV) genome, optionally wherein the AAV genome is an AAV2, AAV5, AAV7m8, or AAV8 genome.
18. A particle comprising the gRNA of any one of claims 1 to 11 or the nucleic acid of any one of claims 12 to 17, optionally wherein the particle is a viral particle, a lipid nanoparticle, a vesicle, or a gold nanoparticle, optionally wherein the particle is an adeno- associated virus (AAV) particle, optionally wherein the AAV particle is an AAV2, AAV5, AAV7m8, or AAV8 particle.
19. A plurality of particles comprising a first particle according to claim 18 and a second particle comprising a nucleic acid encoding a Cas9 protein, optionally wherein the first particle and second particle are in a single container or wherein the first particle is in a first container and the second particle is in a second container, and optionally wherein the nucleic acid encoding the Cas9 protein is operably linked to a promoter, which is optionally a tissue specific promoter or a constitutive promoter, optionally wherein the promoter is a hGRK1 promoter, a RHO promoter, or an EF1 alpha promoter, e.g., an EF1 alpha short (EFS) promoter. .
20. The plurality of particles of claim 19, wherein the Cas9 protein is a wild-type Cas9 protein or a modified Cas9 protein.
21. The plurality of particles of claim 20, wherein the Cas9 protein is a modified Cas9 protein having one or more amino acid modifications relative to the corresponding wild- type Cas9 protein.
22. The plurality of particles of claim 21 , wherein the position of one or more modifications are identified by reference to the amino acid numbering in an unmodified mature Streptococcus pyogenes Cas9 as set forth in SEQ ID NO:1.
23. The plurality of particles of claim 22, wherein the modified Cas9 protein comprises a K526 mutation, a Y515 mutation, a R661 mutation, a M495 mutation, or a combination thereof, optionally wherein: a) the K526 mutation is a K526E, K526D, K526A, or K526N mutation; and/or b) the Y515 mutation is a Y515N mutation; and/or c) the R661 mutation is a R661Q, R661S, R661L, R661D, R661E, R661F, R661M, R661W, R661Y, or R661A mutation; and/or d) the M495 mutation is M495V.
The plurality of particles of claim 22, wherein the modified Cas9 protein comprises: a) K526E and R661S mutations; b) K526E and R661Q mutations; c) K526E and R661L mutations; d) Y515N, K526E, and R661S mutations; e) Y515N, K526E, and R661Q mutations; f) Y515N, K526E, and R661L mutations; g) Y515N, K526E, and R661D mutations; h) Y515N, K526E, and R661E mutations; i) Y515N, K526E, and R661F mutations; j) Y515N, K526E, and R661M mutations;
k) Y515N, K526E, and R661W mutations;
L) Y515N, K526E, and R661Y mutations; m) Y515N, K526E, and M495V mutations; n) M495V, Y515N, K526E, and R661Q mutations; o) M495V, K526E, R661Q, and H698Q mutations; p) M495V, Y515N, K526E, and R661A mutations; q) Y515N, K526D, and R661Q mutations; r) Y515N, K526D, and R661L mutations; s) Y515N, K526D, and R661W mutations; t) M495V, Y515N, K526D, and R661Q mutations; or u) M495V, Y515N, K526A, and R661Q mutations.
25. The plurality of particles of any one of claims 19 to 24, wherein the second particle is a viral particle, optionally an adeno-associated virus (AAV) particle, optionally wherein the AAV particle is AAV2, AAV5, AAV7m8, or AAV8 particle.
26. A plurality of nucleic acids comprising a first nucleic acid according to any one of claims 12 to 17 and a second nucleic acid encoding a Cas9 protein, optionally wherein the first nucleic acid and second nucleic acid are in a single container or wherein the first nucleic acid is in a first container and the second nucleic acid is in a second container.
27. A system comprising a Cas9 protein and the gRNA of any one of claims 1 to 11.
28. The system of claim 27, wherein the Cas9 protein has the features of a Cas9 protein described in any one of claims 20 to 24.
29. The system of claim 27 or claim 28, further comprising a second gRNA.
30. The system of claim 29, wherein the second gRNA has the features of a second gRNA described in any one of claims 13 to 16.
31. A pharmaceutical composition comprising (i) the gRNA of any one of claims 1 to 11, the nucleic acid of any one of claims 12 to 17, the particle of claim 18, the plurality of particles of any one of claims 19 to 25, the plurality of nucleic acids of claim 26, or the system of any one of claims 27 to 30 and (ii) a pharmaceutically acceptable excipient.
32. A cell comprising the gRNA of any one of claims 1 to 11 , the nucleic acid of any one of claims 12 to 17, the particle of claim 18, the plurality of particles of any one of claims 19 to 25, the plurality of nucleic acids of claim 26, or the system of any one of claims 27 to 30, optionally wherein the cell is an ex vivo cell.
33. The cell of claim 32, which is a human cell, optionally wherein the cell: a) is a human retinal cell; b) is a human retinal epithelial cell; c) is a human photoreceptor cell; d) is a human retinal progenitor cell; e) is a stem cell; f) is an iPS cell; g) is a HEK293T cell; or h) is a HEK293T/17 cell.
34. A population of cells according to claim 32 or claim 33.
35. A method of altering a human cell comprising a RHO allele having a pathogenic mutation, comprising contacting the cell with the gRNA of any one of claims 1 to 11, the nucleic acid of any one of claims 12 to 17, the particle of claim 18, the plurality of particles of any one of claims 19 to 25, the plurality of nucleic acids of claim 26, the system of any one of claims 27 to
30, or the pharmaceutical composition of claim 31.
36. A method of altering a human cell comprising a RHO allele having a pathogenic mutation and which is heterozygous for the rs7984 SNP, comprising contacting the cell with the gRNA of any one of claims 1 to 11, the nucleic acid of any one of claims 12 to 17, the particle of claim 18, the plurality of particles of any one of claims 19 to 25, the plurality of nucleic acids of claim 26, the system of any one of claims 27 to 30, or the pharmaceutical composition of claim
31 , provided that R is A when the RHO allele having the pathogenic mutation has an A at the nucleotide position corresponding to rs7984 SNP and R is G when the RHO allele having the pathogenic mutation has a G at nucleotide position corresponding to the rs7984 SNP.
37. The method of claim 35 or claim 36, wherein the RHO allele having the pathogenic mutation encodes a rhodopsin protein having a P23 mutation or a P347 mutation, optionally wherein the P23 mutation is a P23H mutation and optionally wherein the P347 mutation is a P347L mutation, a P347S mutation, a P347R mutation, a P347Q mutation, a
P347T mutation, or a P347A mutation.
38. The method of any one of claims 35 to 37, wherein the cell is a stem cell, an iPS cell, a human retinal cell, a human retinal epithelial cell, a human photoreceptor cell, or a human retinal progenitor cell.
39. The method of any one of claims 35 to 38, wherein the contacting results in a deletion in the RHO allele encoding the pathogenic mutation.
40. The method of any one of claims 35 to 39, wherein the cell contains a human RHO allele having the pathogenic mutation and contains a human RHO allele not having the pathogenic mutation.
41. The method of any one of claims 35 to 40, wherein the cell is a cell from a subject having a RHO allele with the pathogenic mutation or a progeny of such cell.
42. The method of claim 41 , wherein the subject is heterozygous for the rs7984 SNP and the subject is heterozygous for the pathogenic mutation.
43. The method of claim 42, which further comprises a step of genotyping the subject to determine which allele of the rs7984 SNP is in phase with the pathogenic mutation.
44. The method of any one of claims 41 to 43, wherein the contacting is performed ex vivo and, optionally, wherein the method further comprises returning the contacted cell or a progeny thereof to the subject.
45. The method of any one of claims 41 to 43, wherein the contacting is performed in vivo, optionally wherein the contacting is performed in or near an eye of the subject.
46. A guide RNA molecule (gRNA) for editing a RHO gene, the gRNA comprising a spacer whose nucleic acid sequence comprises 15 or more consecutive nucleotides from a reference sequence or comprises a nucleotide sequence that is at least 85% identical to a reference sequence, wherein the reference sequence is: a) GCCGGGCUGCUGUUUGUGCA (SEQ ID NO:27); b) GCAGGAGCCCGGGAGCAUGG (SEQ ID NO:24); c) GUCUGGGAGAGUCCCGGGCU (SEQ ID NO:25); d) GAGAGUCCCGGGCUUGGCGG (SEQ ID NO:26); e) GCCCUGCUGGGGCGUCACAC (SEQ ID NO:28);
f) GGACGGGUGCAGAGUUGAGU (SEQ ID NO:29); g) GUGCUGAGUCAGACCCAGGC (SEQ ID NO:30); h) GCAAUGGGCUCGGUCCCCUC (SEQ ID N0:31); i) GUAUGAGCCGGGUGUGGGUG (SEQ ID NO:32); j) GCUUGGCGGUGGUGGCUGAG (SEQ ID NO:33); k) GGGCUUUGGAUAACAUUGAC (SEQ ID NO:34);
L) GACUGAAUAUAUGAGGGCUU (SEQ ID NO:35); m) GCCCUGCACAAACAGCAGCC (SEQ ID NO:36); n) GCUGGGGCGUCACACAGGGA (SEQ ID NO:37); o) GAGGCUUGGUGCUGCAAACA (SEQ ID NO:38); or p) GCCAGACCCCUCCUCUCUGG (SEQ ID NO:39).
47. The gRNA of claim 46, wherein the spacer comprises a nucleotide sequence that: a) is at least 85% identical to the reference sequence; b) is at least 90% identical to the reference sequence; c) is at least 95% identical to the reference sequence; d) has one mismatch relative to the reference sequence; or e) two mismatches relative to the reference sequence.
48. The gRNA of claim 46, wherein the nucleotide sequence of the spacer comprises: a) 15 or more consecutive nucleotides from the reference sequence; b) 16 or more consecutive nucleotides from the reference sequence; c) 17 or more consecutive nucleotides from the reference sequence; d) 18 or more consecutive nucleotides from the reference sequence; e) 19 or more consecutive nucleotides from the reference sequence; or f) the reference sequence.
49. The gRNA of any one of claims 46 to 48, which comprises a spacer that is: a) 15 to 30 nucleotides in length;
b) 15 to 25 nucleotides in length; c) 16 to 24 nucleotides in length; d) 17 to 23 nucleotides in length; e) 18 to 22 nucleotides in length; f) 19 to 21 nucleotides in length; g) 18 to 30 nucleotides in length; h) 20 to 28 nucleotides in length; i) 22 to 26 nucleotides in length; j) 23 to 25 nucleotides in length; k) 20 nucleotides in length;
L) 21 nucleotides in length; m) 22 nucleotides in length; n) 23 nucleotides in length; o) 24 nucleotides in length; or p) 25 nucleotides in length.
50. The gRNA of any one of claims 46 to 49, which is a Cas9 gRNA, optionally a Streptococcus pyogenes Cas9 (SpCas9) gRNA.
51. The gRNA of any one of claims 1 to 11, the nucleic acid of any one of claims 12 to 17, the particle of claim 18, the plurality of particles of any one of claims 19 to 25, the plurality of nucleic acids of claim 26, the system of any one of claims 27 to 30, or the pharmaceutical composition of claim 31 for use in a method of altering a human cell comprising a RHO allele having a pathogenic mutation, optionally wherein the method is a method according to any one of claims 35 to 45.
52. The gRNA of any one of claims 1 to 11, the nucleic acid of any one of claims 12 to 17, the particle of claim 18, the plurality of particles of any one of claims 19 to 25, the plurality of nucleic acids of claim 26, the system of any one of claims 27 to 30, or the pharmaceutical composition of claim 31 for use in a method of altering a human cell comprising a RHO allele having a pathogenic mutation and which is heterozygous for the rs7984 SNP, optionally wherein the method is a method according to any one of claims 35 to 45.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202163220876P | 2021-07-12 | 2021-07-12 | |
US63/220,876 | 2021-07-12 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2023285431A1 true WO2023285431A1 (en) | 2023-01-19 |
Family
ID=82799906
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2022/069401 WO2023285431A1 (en) | 2021-07-12 | 2022-07-12 | Compositions and methods for allele specific treatment of retinitis pigmentosa |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2023285431A1 (en) |
Citations (121)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3687808A (en) | 1969-08-14 | 1972-08-29 | Univ Leland Stanford Junior | Synthetic polynucleotides |
US4469863A (en) | 1980-11-12 | 1984-09-04 | Ts O Paul O P | Nonionic nucleic acid alkyl and aryl phosphonates and processes for manufacture and use thereof |
US4476301A (en) | 1982-04-29 | 1984-10-09 | Centre National De La Recherche Scientifique | Oligonucleotides, a process for preparing the same and their application as mediators of the action of interferon |
US4587044A (en) | 1983-09-01 | 1986-05-06 | The Johns Hopkins University | Linkage of proteins to nucleic acids |
US4605735A (en) | 1983-02-14 | 1986-08-12 | Wakunaga Seiyaku Kabushiki Kaisha | Oligonucleotide derivatives |
US4667025A (en) | 1982-08-09 | 1987-05-19 | Wakunaga Seiyaku Kabushiki Kaisha | Oligonucleotide derivatives |
US4762779A (en) | 1985-06-13 | 1988-08-09 | Amgen Inc. | Compositions and methods for functionalizing nucleic acids |
US4824941A (en) | 1983-03-10 | 1989-04-25 | Julian Gordon | Specific antibody to the native form of 2'5'-oligonucleotides, the method of preparation and the use as reagents in immunoassays or for binding 2'5'-oligonucleotides in biological systems |
US4828979A (en) | 1984-11-08 | 1989-05-09 | Life Technologies, Inc. | Nucleotide analogs for nucleic acid labeling and detection |
US4835263A (en) | 1983-01-27 | 1989-05-30 | Centre National De La Recherche Scientifique | Novel compounds containing an oligonucleotide sequence bonded to an intercalating agent, a process for their synthesis and their use |
US4845205A (en) | 1985-01-08 | 1989-07-04 | Institut Pasteur | 2,N6 -disubstituted and 2,N6 -trisubstituted adenosine-3'-phosphoramidites |
US4876335A (en) | 1986-06-30 | 1989-10-24 | Wakunaga Seiyaku Kabushiki Kaisha | Poly-labelled oligonucleotide derivative |
US4904582A (en) | 1987-06-11 | 1990-02-27 | Synthetic Genetics | Novel amphiphilic nucleic acid conjugates |
US4948882A (en) | 1983-02-22 | 1990-08-14 | Syngene, Inc. | Single-stranded labelled oligonucleotides, reactive monomers and methods of synthesis |
US4958013A (en) | 1989-06-06 | 1990-09-18 | Northwestern University | Cholesteryl modified oligonucleotides |
US5023243A (en) | 1981-10-23 | 1991-06-11 | Molecular Biosystems, Inc. | Oligonucleotide therapeutic agent and method of making same |
US5034506A (en) | 1985-03-15 | 1991-07-23 | Anti-Gene Development Group | Uncharged morpholino-based polymers having achiral intersubunit linkages |
US5082830A (en) | 1988-02-26 | 1992-01-21 | Enzo Biochem, Inc. | End labeled nucleotide probe |
US5109124A (en) | 1988-06-01 | 1992-04-28 | Biogen, Inc. | Nucleic acid probe linked to a label having a terminal cysteine |
US5112963A (en) | 1987-11-12 | 1992-05-12 | Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. | Modified oligonucleotides |
US5118802A (en) | 1983-12-20 | 1992-06-02 | California Institute Of Technology | DNA-reporter conjugates linked via the 2' or 5'-primary amino group of the 5'-terminal nucleoside |
US5130302A (en) | 1989-12-20 | 1992-07-14 | Boron Bilogicals, Inc. | Boronated nucleoside, nucleotide and oligonucleotide compounds, compositions and methods for using same |
US5134066A (en) | 1989-08-29 | 1992-07-28 | Monsanto Company | Improved probes using nucleosides containing 3-dezauracil analogs |
US5138045A (en) | 1990-07-27 | 1992-08-11 | Isis Pharmaceuticals | Polyamine conjugated oligonucleotides |
US5166315A (en) | 1989-12-20 | 1992-11-24 | Anti-Gene Development Group | Sequence-specific binding polymers for duplex nucleic acids |
US5175273A (en) | 1988-07-01 | 1992-12-29 | Genentech, Inc. | Nucleic acid intercalating agents |
US5177196A (en) | 1990-08-16 | 1993-01-05 | Microprobe Corporation | Oligo (α-arabinofuranosyl nucleotides) and α-arabinofuranosyl precursors thereof |
US5185444A (en) | 1985-03-15 | 1993-02-09 | Anti-Gene Deveopment Group | Uncharged morpolino-based polymers having phosphorous containing chiral intersubunit linkages |
US5188897A (en) | 1987-10-22 | 1993-02-23 | Temple University Of The Commonwealth System Of Higher Education | Encapsulated 2',5'-phosphorothioate oligoadenylates |
WO1993007883A1 (en) | 1991-10-24 | 1993-04-29 | Isis Pharmaceuticals, Inc. | Derivatized oligonucleotides having improved uptake and other properties |
US5214136A (en) | 1990-02-20 | 1993-05-25 | Gilead Sciences, Inc. | Anthraquinone-derivatives oligonucleotides |
US5214134A (en) | 1990-09-12 | 1993-05-25 | Sterling Winthrop Inc. | Process of linking nucleosides with a siloxane bridge |
US5216141A (en) | 1988-06-06 | 1993-06-01 | Benner Steven A | Oligonucleotide analogs containing sulfur linkages |
US5218105A (en) | 1990-07-27 | 1993-06-08 | Isis Pharmaceuticals | Polyamine conjugated oligonucleotides |
US5235033A (en) | 1985-03-15 | 1993-08-10 | Anti-Gene Development Group | Alpha-morpholino ribonucleoside derivatives and polymers thereof |
US5245022A (en) | 1990-08-03 | 1993-09-14 | Sterling Drug, Inc. | Exonuclease resistant terminally substituted oligonucleotides |
US5254469A (en) | 1989-09-12 | 1993-10-19 | Eastman Kodak Company | Oligonucleotide-enzyme conjugate that can be used as a probe in hybridization assays and polymerase chain reaction procedures |
US5258506A (en) | 1984-10-16 | 1993-11-02 | Chiron Corporation | Photolabile reagents for incorporation into oligonucleotide chains |
US5262536A (en) | 1988-09-15 | 1993-11-16 | E. I. Du Pont De Nemours And Company | Reagents for the preparation of 5'-tagged oligonucleotides |
US5264562A (en) | 1989-10-24 | 1993-11-23 | Gilead Sciences, Inc. | Oligonucleotide analogs with novel linkages |
US5264564A (en) | 1989-10-24 | 1993-11-23 | Gilead Sciences | Oligonucleotide analogs with novel linkages |
US5264423A (en) | 1987-03-25 | 1993-11-23 | The United States Of America As Represented By The Department Of Health And Human Services | Inhibitors for replication of retroviruses and for the expression of oncogene products |
US5272250A (en) | 1992-07-10 | 1993-12-21 | Spielvogel Bernard F | Boronated phosphoramidate compounds |
US5276019A (en) | 1987-03-25 | 1994-01-04 | The United States Of America As Represented By The Department Of Health And Human Services | Inhibitors for replication of retroviruses and for the expression of oncogene products |
US5278302A (en) | 1988-05-26 | 1994-01-11 | University Patents, Inc. | Polynucleotide phosphorodithioates |
US5292873A (en) | 1989-11-29 | 1994-03-08 | The Research Foundation Of State University Of New York | Nucleic acids labeled with naphthoquinone probe |
US5317098A (en) | 1986-03-17 | 1994-05-31 | Hiroaki Shizuya | Non-radioisotope tagging of fragments |
US5321131A (en) | 1990-03-08 | 1994-06-14 | Hybridon, Inc. | Site-specific functionalization of oligodeoxynucleotides for non-radioactive labelling |
US5367066A (en) | 1984-10-16 | 1994-11-22 | Chiron Corporation | Oligonucleotides with selectably cleavable and/or abasic sites |
US5371241A (en) | 1991-07-19 | 1994-12-06 | Pharmacia P-L Biochemicals Inc. | Fluorescein labelled phosphoramidites |
US5391723A (en) | 1989-05-31 | 1995-02-21 | Neorx Corporation | Oligonucleotide conjugates |
US5399676A (en) | 1989-10-23 | 1995-03-21 | Gilead Sciences | Oligonucleotides with inverted polarity |
US5405939A (en) | 1987-10-22 | 1995-04-11 | Temple University Of The Commonwealth System Of Higher Education | 2',5'-phosphorothioate oligoadenylates and their covalent conjugates with polylysine |
US5405938A (en) | 1989-12-20 | 1995-04-11 | Anti-Gene Development Group | Sequence-specific binding polymers for duplex nucleic acids |
US5414077A (en) | 1990-02-20 | 1995-05-09 | Gilead Sciences | Non-nucleoside linkers for convenient attachment of labels to oligonucleotides using standard synthetic methods |
US5432272A (en) | 1990-10-09 | 1995-07-11 | Benner; Steven A. | Method for incorporating into a DNA or RNA oligonucleotide using nucleotides bearing heterocyclic bases |
US5434257A (en) | 1992-06-01 | 1995-07-18 | Gilead Sciences, Inc. | Binding compentent oligomers containing unsaturated 3',5' and 2',5' linkages |
US5451463A (en) | 1989-08-28 | 1995-09-19 | Clontech Laboratories, Inc. | Non-nucleoside 1,3-diol reagents for labeling synthetic oligonucleotides |
US5455233A (en) | 1989-11-30 | 1995-10-03 | University Of North Carolina | Oligoribonucleoside and oligodeoxyribonucleoside boranophosphates |
US5457187A (en) | 1993-12-08 | 1995-10-10 | Board Of Regents University Of Nebraska | Oligonucleotides containing 5-fluorouracil |
US5459255A (en) | 1990-01-11 | 1995-10-17 | Isis Pharmaceuticals, Inc. | N-2 substituted purines |
US5466677A (en) | 1993-03-06 | 1995-11-14 | Ciba-Geigy Corporation | Dinucleoside phosphinates and their pharmaceutical compositions |
US5470967A (en) | 1990-04-10 | 1995-11-28 | The Dupont Merck Pharmaceutical Company | Oligonucleotide analogs with sulfamate linkages |
US5476925A (en) | 1993-02-01 | 1995-12-19 | Northwestern University | Oligodeoxyribonucleotides including 3'-aminonucleoside-phosphoramidate linkages and terminal 3'-amino groups |
US5484908A (en) | 1991-11-26 | 1996-01-16 | Gilead Sciences, Inc. | Oligonucleotides containing 5-propynyl pyrimidines |
US5486603A (en) | 1990-01-08 | 1996-01-23 | Gilead Sciences, Inc. | Oligonucleotide having enhanced binding affinity |
US5489677A (en) | 1990-07-27 | 1996-02-06 | Isis Pharmaceuticals, Inc. | Oligonucleoside linkages containing adjacent oxygen and nitrogen atoms |
US5502177A (en) | 1993-09-17 | 1996-03-26 | Gilead Sciences, Inc. | Pyrimidine derivatives for labeled binding partners |
US5510475A (en) | 1990-11-08 | 1996-04-23 | Hybridon, Inc. | Oligonucleotide multiple reporter precursors |
US5512439A (en) | 1988-11-21 | 1996-04-30 | Dynal As | Oligonucleotide-linked magnetic particles and uses thereof |
US5512667A (en) | 1990-08-28 | 1996-04-30 | Reed; Michael W. | Trifunctional intermediates for preparing 3'-tailed oligonucleotides |
US5514785A (en) | 1990-05-11 | 1996-05-07 | Becton Dickinson And Company | Solid supports for nucleic acid hybridization assays |
US5519126A (en) | 1988-03-25 | 1996-05-21 | University Of Virginia Alumni Patents Foundation | Oligonucleotide N-alkylphosphoramidates |
US5525465A (en) | 1987-10-28 | 1996-06-11 | Howard Florey Institute Of Experimental Physiology And Medicine | Oligonucleotide-polyamide conjugates and methods of production and applications of the same |
US5525711A (en) | 1994-05-18 | 1996-06-11 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Pteridine nucleotide analogs as fluorescent DNA probes |
US5539082A (en) | 1993-04-26 | 1996-07-23 | Nielsen; Peter E. | Peptide nucleic acids |
US5541307A (en) | 1990-07-27 | 1996-07-30 | Isis Pharmaceuticals, Inc. | Backbone modified oligonucleotide analogs and solid phase synthesis thereof |
US5545730A (en) | 1984-10-16 | 1996-08-13 | Chiron Corporation | Multifunctional nucleic acid monomer |
US5550111A (en) | 1984-07-11 | 1996-08-27 | Temple University-Of The Commonwealth System Of Higher Education | Dual action 2',5'-oligoadenylate antiviral derivatives and uses thereof |
US5552540A (en) | 1987-06-24 | 1996-09-03 | Howard Florey Institute Of Experimental Physiology And Medicine | Nucleoside derivatives |
US5561225A (en) | 1990-09-19 | 1996-10-01 | Southern Research Institute | Polynucleotide analogs containing sulfonate and sulfonamide internucleoside linkages |
US5565552A (en) | 1992-01-21 | 1996-10-15 | Pharmacyclics, Inc. | Method of expanded porphyrin-oligonucleotide conjugate synthesis |
US5571799A (en) | 1991-08-12 | 1996-11-05 | Basco, Ltd. | (2'-5') oligoadenylate analogues useful as inhibitors of host-v5.-graft response |
US5574142A (en) | 1992-12-15 | 1996-11-12 | Microprobe Corporation | Peptide linkers for improved oligonucleotide delivery |
US5578718A (en) | 1990-01-11 | 1996-11-26 | Isis Pharmaceuticals, Inc. | Thiol-derivatized nucleosides |
US5580731A (en) | 1994-08-25 | 1996-12-03 | Chiron Corporation | N-4 modified pyrimidine deoxynucleotides and oligonucleotide probes synthesized therewith |
US5585481A (en) | 1987-09-21 | 1996-12-17 | Gen-Probe Incorporated | Linking reagents for nucleotide probes |
US5587371A (en) | 1992-01-21 | 1996-12-24 | Pharmacyclics, Inc. | Texaphyrin-oligonucleotide conjugates |
US5587361A (en) | 1991-10-15 | 1996-12-24 | Isis Pharmaceuticals, Inc. | Oligonucleotides having phosphorothioate linkages of high chiral purity |
US5595726A (en) | 1992-01-21 | 1997-01-21 | Pharmacyclics, Inc. | Chromophore probe for detection of nucleic acid |
US5596086A (en) | 1990-09-20 | 1997-01-21 | Gilead Sciences, Inc. | Modified internucleoside linkages having one nitrogen and two carbon atoms |
US5596091A (en) | 1994-03-18 | 1997-01-21 | The Regents Of The University Of California | Antisense oligonucleotides comprising 5-aminoalkyl pyrimidine nucleotides |
US5597696A (en) | 1994-07-18 | 1997-01-28 | Becton Dickinson And Company | Covalent cyanine dye oligonucleotide conjugates |
US5599923A (en) | 1989-03-06 | 1997-02-04 | Board Of Regents, University Of Tx | Texaphyrin metal complexes having improved functionalization |
US5602240A (en) | 1990-07-27 | 1997-02-11 | Ciba Geigy Ag. | Backbone modified oligonucleotide analogs |
US5608046A (en) | 1990-07-27 | 1997-03-04 | Isis Pharmaceuticals, Inc. | Conjugated 4'-desmethyl nucleoside analog compounds |
US5610289A (en) | 1990-07-27 | 1997-03-11 | Isis Pharmaceuticals, Inc. | Backbone modified oligonucleotide analogues |
US5614617A (en) | 1990-07-27 | 1997-03-25 | Isis Pharmaceuticals, Inc. | Nuclease resistant, pyrimidine modified oligonucleotides that detect and modulate gene expression |
US5618704A (en) | 1990-07-27 | 1997-04-08 | Isis Pharmacueticals, Inc. | Backbone-modified oligonucleotide analogs and preparation thereof through radical coupling |
US5623070A (en) | 1990-07-27 | 1997-04-22 | Isis Pharmaceuticals, Inc. | Heteroatomic oligonucleoside linkages |
US5633360A (en) | 1992-04-14 | 1997-05-27 | Gilead Sciences, Inc. | Oligonucleotide analogs capable of passive cell membrane permeation |
US5663312A (en) | 1993-03-31 | 1997-09-02 | Sanofi | Oligonucleotide dimers with amide linkages replacing phosphodiester linkages |
US5677439A (en) | 1990-08-03 | 1997-10-14 | Sanofi | Oligonucleotide analogues containing phosphate diester linkage substitutes, compositions thereof, and precursor dinucleotide analogues |
US5677437A (en) | 1990-07-27 | 1997-10-14 | Isis Pharmaceuticals, Inc. | Heteroatomic oligonucleoside linkages |
US5681941A (en) | 1990-01-11 | 1997-10-28 | Isis Pharmaceuticals, Inc. | Substituted purines and oligonucleotide cross-linking |
US5688941A (en) | 1990-07-27 | 1997-11-18 | Isis Pharmaceuticals, Inc. | Methods of making conjugated 4' desmethyl nucleoside analog compounds |
US5714331A (en) | 1991-05-24 | 1998-02-03 | Buchardt, Deceased; Ole | Peptide nucleic acids having enhanced binding affinity, sequence specificity and solubility |
US5719262A (en) | 1993-11-22 | 1998-02-17 | Buchardt, Deceased; Ole | Peptide nucleic acids having amino acid side chains |
US5750692A (en) | 1990-01-11 | 1998-05-12 | Isis Pharmaceuticals, Inc. | Synthesis of 3-deazapurines |
US5830653A (en) | 1991-11-26 | 1998-11-03 | Gilead Sciences, Inc. | Methods of using oligomers containing modified pyrimidines |
US6287860B1 (en) | 2000-01-20 | 2001-09-11 | Isis Pharmaceuticals, Inc. | Antisense inhibition of MEKK2 expression |
US20030158403A1 (en) | 2001-07-03 | 2003-08-21 | Isis Pharmaceuticals, Inc. | Nuclease resistant chimeric oligonucleotides |
US9322037B2 (en) | 2013-09-06 | 2016-04-26 | President And Fellows Of Harvard College | Cas9-FokI fusion proteins and uses thereof |
WO2018009562A1 (en) | 2016-07-05 | 2018-01-11 | The Johns Hopkins University | Crispr/cas9-based compositions and methods for treating retinal degenerations |
WO2018149888A1 (en) | 2017-02-14 | 2018-08-23 | Universita' Degli Studi Di Trento | High-fidelity cas9 variants and applications thereof |
WO2019102381A1 (en) | 2017-11-21 | 2019-05-31 | Casebia Therapeutics Llp | Materials and methods for treatment of autosomal dominant retinitis pigmentosa |
WO2019183630A2 (en) | 2018-03-23 | 2019-09-26 | The Trustees Of Columbia University In The City Of New York | Gene editing for autosomal dominant diseases |
WO2020176552A1 (en) * | 2019-02-25 | 2020-09-03 | Editas Medicine, Inc. | Crispr/rna-guided nuclease-related methods and compositions for treating rho-associated autosomal-dominant retinitis pigmentosa (adrp) |
WO2020257514A1 (en) * | 2019-06-21 | 2020-12-24 | Children's Medical Center Corporation | Methods and compositions for allele specific gene editing |
WO2021113763A1 (en) * | 2019-12-06 | 2021-06-10 | Scribe Therapeutics Inc. | Compositions and methods for the targeting of rhodopsin |
WO2021122944A1 (en) * | 2019-12-18 | 2021-06-24 | Alia Therapeutics Srl | Compositions and methods for treating retinitis pigmentosa |
-
2022
- 2022-07-12 WO PCT/EP2022/069401 patent/WO2023285431A1/en unknown
Patent Citations (138)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3687808A (en) | 1969-08-14 | 1972-08-29 | Univ Leland Stanford Junior | Synthetic polynucleotides |
US4469863A (en) | 1980-11-12 | 1984-09-04 | Ts O Paul O P | Nonionic nucleic acid alkyl and aryl phosphonates and processes for manufacture and use thereof |
US5023243A (en) | 1981-10-23 | 1991-06-11 | Molecular Biosystems, Inc. | Oligonucleotide therapeutic agent and method of making same |
US4476301A (en) | 1982-04-29 | 1984-10-09 | Centre National De La Recherche Scientifique | Oligonucleotides, a process for preparing the same and their application as mediators of the action of interferon |
US4789737A (en) | 1982-08-09 | 1988-12-06 | Wakunaga Seiyaku Kabushiki Kaisha | Oligonucleotide derivatives and production thereof |
US4667025A (en) | 1982-08-09 | 1987-05-19 | Wakunaga Seiyaku Kabushiki Kaisha | Oligonucleotide derivatives |
US4835263A (en) | 1983-01-27 | 1989-05-30 | Centre National De La Recherche Scientifique | Novel compounds containing an oligonucleotide sequence bonded to an intercalating agent, a process for their synthesis and their use |
US4605735A (en) | 1983-02-14 | 1986-08-12 | Wakunaga Seiyaku Kabushiki Kaisha | Oligonucleotide derivatives |
US5541313A (en) | 1983-02-22 | 1996-07-30 | Molecular Biosystems, Inc. | Single-stranded labelled oligonucleotides of preselected sequence |
US4948882A (en) | 1983-02-22 | 1990-08-14 | Syngene, Inc. | Single-stranded labelled oligonucleotides, reactive monomers and methods of synthesis |
US4824941A (en) | 1983-03-10 | 1989-04-25 | Julian Gordon | Specific antibody to the native form of 2'5'-oligonucleotides, the method of preparation and the use as reagents in immunoassays or for binding 2'5'-oligonucleotides in biological systems |
US4587044A (en) | 1983-09-01 | 1986-05-06 | The Johns Hopkins University | Linkage of proteins to nucleic acids |
US5118802A (en) | 1983-12-20 | 1992-06-02 | California Institute Of Technology | DNA-reporter conjugates linked via the 2' or 5'-primary amino group of the 5'-terminal nucleoside |
US5550111A (en) | 1984-07-11 | 1996-08-27 | Temple University-Of The Commonwealth System Of Higher Education | Dual action 2',5'-oligoadenylate antiviral derivatives and uses thereof |
US5545730A (en) | 1984-10-16 | 1996-08-13 | Chiron Corporation | Multifunctional nucleic acid monomer |
US5367066A (en) | 1984-10-16 | 1994-11-22 | Chiron Corporation | Oligonucleotides with selectably cleavable and/or abasic sites |
US5258506A (en) | 1984-10-16 | 1993-11-02 | Chiron Corporation | Photolabile reagents for incorporation into oligonucleotide chains |
US5552538A (en) | 1984-10-16 | 1996-09-03 | Chiron Corporation | Oligonucleotides with cleavable sites |
US5578717A (en) | 1984-10-16 | 1996-11-26 | Chiron Corporation | Nucleotides for introducing selectably cleavable and/or abasic sites into oligonucleotides |
US4828979A (en) | 1984-11-08 | 1989-05-09 | Life Technologies, Inc. | Nucleotide analogs for nucleic acid labeling and detection |
US4845205A (en) | 1985-01-08 | 1989-07-04 | Institut Pasteur | 2,N6 -disubstituted and 2,N6 -trisubstituted adenosine-3'-phosphoramidites |
US5034506A (en) | 1985-03-15 | 1991-07-23 | Anti-Gene Development Group | Uncharged morpholino-based polymers having achiral intersubunit linkages |
US5185444A (en) | 1985-03-15 | 1993-02-09 | Anti-Gene Deveopment Group | Uncharged morpolino-based polymers having phosphorous containing chiral intersubunit linkages |
US5235033A (en) | 1985-03-15 | 1993-08-10 | Anti-Gene Development Group | Alpha-morpholino ribonucleoside derivatives and polymers thereof |
US4762779A (en) | 1985-06-13 | 1988-08-09 | Amgen Inc. | Compositions and methods for functionalizing nucleic acids |
US5317098A (en) | 1986-03-17 | 1994-05-31 | Hiroaki Shizuya | Non-radioisotope tagging of fragments |
US4876335A (en) | 1986-06-30 | 1989-10-24 | Wakunaga Seiyaku Kabushiki Kaisha | Poly-labelled oligonucleotide derivative |
US5264423A (en) | 1987-03-25 | 1993-11-23 | The United States Of America As Represented By The Department Of Health And Human Services | Inhibitors for replication of retroviruses and for the expression of oncogene products |
US5276019A (en) | 1987-03-25 | 1994-01-04 | The United States Of America As Represented By The Department Of Health And Human Services | Inhibitors for replication of retroviruses and for the expression of oncogene products |
US5286717A (en) | 1987-03-25 | 1994-02-15 | The United States Of America As Represented By The Department Of Health And Human Services | Inhibitors for replication of retroviruses and for the expression of oncogene products |
US4904582A (en) | 1987-06-11 | 1990-02-27 | Synthetic Genetics | Novel amphiphilic nucleic acid conjugates |
US5552540A (en) | 1987-06-24 | 1996-09-03 | Howard Florey Institute Of Experimental Physiology And Medicine | Nucleoside derivatives |
US5585481A (en) | 1987-09-21 | 1996-12-17 | Gen-Probe Incorporated | Linking reagents for nucleotide probes |
US5405939A (en) | 1987-10-22 | 1995-04-11 | Temple University Of The Commonwealth System Of Higher Education | 2',5'-phosphorothioate oligoadenylates and their covalent conjugates with polylysine |
US5188897A (en) | 1987-10-22 | 1993-02-23 | Temple University Of The Commonwealth System Of Higher Education | Encapsulated 2',5'-phosphorothioate oligoadenylates |
US5525465A (en) | 1987-10-28 | 1996-06-11 | Howard Florey Institute Of Experimental Physiology And Medicine | Oligonucleotide-polyamide conjugates and methods of production and applications of the same |
US5112963A (en) | 1987-11-12 | 1992-05-12 | Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. | Modified oligonucleotides |
US5082830A (en) | 1988-02-26 | 1992-01-21 | Enzo Biochem, Inc. | End labeled nucleotide probe |
US5519126A (en) | 1988-03-25 | 1996-05-21 | University Of Virginia Alumni Patents Foundation | Oligonucleotide N-alkylphosphoramidates |
US5278302A (en) | 1988-05-26 | 1994-01-11 | University Patents, Inc. | Polynucleotide phosphorodithioates |
US5453496A (en) | 1988-05-26 | 1995-09-26 | University Patents, Inc. | Polynucleotide phosphorodithioate |
US5109124A (en) | 1988-06-01 | 1992-04-28 | Biogen, Inc. | Nucleic acid probe linked to a label having a terminal cysteine |
US5216141A (en) | 1988-06-06 | 1993-06-01 | Benner Steven A | Oligonucleotide analogs containing sulfur linkages |
US5175273A (en) | 1988-07-01 | 1992-12-29 | Genentech, Inc. | Nucleic acid intercalating agents |
US5262536A (en) | 1988-09-15 | 1993-11-16 | E. I. Du Pont De Nemours And Company | Reagents for the preparation of 5'-tagged oligonucleotides |
US5512439A (en) | 1988-11-21 | 1996-04-30 | Dynal As | Oligonucleotide-linked magnetic particles and uses thereof |
US5599923A (en) | 1989-03-06 | 1997-02-04 | Board Of Regents, University Of Tx | Texaphyrin metal complexes having improved functionalization |
US5391723A (en) | 1989-05-31 | 1995-02-21 | Neorx Corporation | Oligonucleotide conjugates |
US4958013A (en) | 1989-06-06 | 1990-09-18 | Northwestern University | Cholesteryl modified oligonucleotides |
US5416203A (en) | 1989-06-06 | 1995-05-16 | Northwestern University | Steroid modified oligonucleotides |
US5451463A (en) | 1989-08-28 | 1995-09-19 | Clontech Laboratories, Inc. | Non-nucleoside 1,3-diol reagents for labeling synthetic oligonucleotides |
US5134066A (en) | 1989-08-29 | 1992-07-28 | Monsanto Company | Improved probes using nucleosides containing 3-dezauracil analogs |
US5254469A (en) | 1989-09-12 | 1993-10-19 | Eastman Kodak Company | Oligonucleotide-enzyme conjugate that can be used as a probe in hybridization assays and polymerase chain reaction procedures |
US5399676A (en) | 1989-10-23 | 1995-03-21 | Gilead Sciences | Oligonucleotides with inverted polarity |
US5264562A (en) | 1989-10-24 | 1993-11-23 | Gilead Sciences, Inc. | Oligonucleotide analogs with novel linkages |
US5264564A (en) | 1989-10-24 | 1993-11-23 | Gilead Sciences | Oligonucleotide analogs with novel linkages |
US5292873A (en) | 1989-11-29 | 1994-03-08 | The Research Foundation Of State University Of New York | Nucleic acids labeled with naphthoquinone probe |
US5455233A (en) | 1989-11-30 | 1995-10-03 | University Of North Carolina | Oligoribonucleoside and oligodeoxyribonucleoside boranophosphates |
US5405938A (en) | 1989-12-20 | 1995-04-11 | Anti-Gene Development Group | Sequence-specific binding polymers for duplex nucleic acids |
US5166315A (en) | 1989-12-20 | 1992-11-24 | Anti-Gene Development Group | Sequence-specific binding polymers for duplex nucleic acids |
US5130302A (en) | 1989-12-20 | 1992-07-14 | Boron Bilogicals, Inc. | Boronated nucleoside, nucleotide and oligonucleotide compounds, compositions and methods for using same |
US5486603A (en) | 1990-01-08 | 1996-01-23 | Gilead Sciences, Inc. | Oligonucleotide having enhanced binding affinity |
US5587469A (en) | 1990-01-11 | 1996-12-24 | Isis Pharmaceuticals, Inc. | Oligonucleotides containing N-2 substituted purines |
US5750692A (en) | 1990-01-11 | 1998-05-12 | Isis Pharmaceuticals, Inc. | Synthesis of 3-deazapurines |
US5459255A (en) | 1990-01-11 | 1995-10-17 | Isis Pharmaceuticals, Inc. | N-2 substituted purines |
US5681941A (en) | 1990-01-11 | 1997-10-28 | Isis Pharmaceuticals, Inc. | Substituted purines and oligonucleotide cross-linking |
US5578718A (en) | 1990-01-11 | 1996-11-26 | Isis Pharmaceuticals, Inc. | Thiol-derivatized nucleosides |
US5214136A (en) | 1990-02-20 | 1993-05-25 | Gilead Sciences, Inc. | Anthraquinone-derivatives oligonucleotides |
US5414077A (en) | 1990-02-20 | 1995-05-09 | Gilead Sciences | Non-nucleoside linkers for convenient attachment of labels to oligonucleotides using standard synthetic methods |
US5321131A (en) | 1990-03-08 | 1994-06-14 | Hybridon, Inc. | Site-specific functionalization of oligodeoxynucleotides for non-radioactive labelling |
US5563253A (en) | 1990-03-08 | 1996-10-08 | Worcester Foundation For Biomedical Research | Linear aminoalkylphosphoramidate oligonucleotide derivatives |
US5541306A (en) | 1990-03-08 | 1996-07-30 | Worcester Foundation For Biomedical Research | Aminoalkylphosphotriester oligonucleotide derivatives |
US5536821A (en) | 1990-03-08 | 1996-07-16 | Worcester Foundation For Biomedical Research | Aminoalkylphosphorothioamidate oligonucleotide deratives |
US5470967A (en) | 1990-04-10 | 1995-11-28 | The Dupont Merck Pharmaceutical Company | Oligonucleotide analogs with sulfamate linkages |
US5514785A (en) | 1990-05-11 | 1996-05-07 | Becton Dickinson And Company | Solid supports for nucleic acid hybridization assays |
US5218105A (en) | 1990-07-27 | 1993-06-08 | Isis Pharmaceuticals | Polyamine conjugated oligonucleotides |
US5602240A (en) | 1990-07-27 | 1997-02-11 | Ciba Geigy Ag. | Backbone modified oligonucleotide analogs |
US5688941A (en) | 1990-07-27 | 1997-11-18 | Isis Pharmaceuticals, Inc. | Methods of making conjugated 4' desmethyl nucleoside analog compounds |
US5623070A (en) | 1990-07-27 | 1997-04-22 | Isis Pharmaceuticals, Inc. | Heteroatomic oligonucleoside linkages |
US5677437A (en) | 1990-07-27 | 1997-10-14 | Isis Pharmaceuticals, Inc. | Heteroatomic oligonucleoside linkages |
US5618704A (en) | 1990-07-27 | 1997-04-08 | Isis Pharmacueticals, Inc. | Backbone-modified oligonucleotide analogs and preparation thereof through radical coupling |
US5138045A (en) | 1990-07-27 | 1992-08-11 | Isis Pharmaceuticals | Polyamine conjugated oligonucleotides |
US5489677A (en) | 1990-07-27 | 1996-02-06 | Isis Pharmaceuticals, Inc. | Oligonucleoside linkages containing adjacent oxygen and nitrogen atoms |
US5541307A (en) | 1990-07-27 | 1996-07-30 | Isis Pharmaceuticals, Inc. | Backbone modified oligonucleotide analogs and solid phase synthesis thereof |
US5610289A (en) | 1990-07-27 | 1997-03-11 | Isis Pharmaceuticals, Inc. | Backbone modified oligonucleotide analogues |
US5608046A (en) | 1990-07-27 | 1997-03-04 | Isis Pharmaceuticals, Inc. | Conjugated 4'-desmethyl nucleoside analog compounds |
US5614617A (en) | 1990-07-27 | 1997-03-25 | Isis Pharmaceuticals, Inc. | Nuclease resistant, pyrimidine modified oligonucleotides that detect and modulate gene expression |
US5245022A (en) | 1990-08-03 | 1993-09-14 | Sterling Drug, Inc. | Exonuclease resistant terminally substituted oligonucleotides |
US5677439A (en) | 1990-08-03 | 1997-10-14 | Sanofi | Oligonucleotide analogues containing phosphate diester linkage substitutes, compositions thereof, and precursor dinucleotide analogues |
US5567810A (en) | 1990-08-03 | 1996-10-22 | Sterling Drug, Inc. | Nuclease resistant compounds |
US5177196A (en) | 1990-08-16 | 1993-01-05 | Microprobe Corporation | Oligo (α-arabinofuranosyl nucleotides) and α-arabinofuranosyl precursors thereof |
US5512667A (en) | 1990-08-28 | 1996-04-30 | Reed; Michael W. | Trifunctional intermediates for preparing 3'-tailed oligonucleotides |
US5214134A (en) | 1990-09-12 | 1993-05-25 | Sterling Winthrop Inc. | Process of linking nucleosides with a siloxane bridge |
US5561225A (en) | 1990-09-19 | 1996-10-01 | Southern Research Institute | Polynucleotide analogs containing sulfonate and sulfonamide internucleoside linkages |
US5596086A (en) | 1990-09-20 | 1997-01-21 | Gilead Sciences, Inc. | Modified internucleoside linkages having one nitrogen and two carbon atoms |
US5432272A (en) | 1990-10-09 | 1995-07-11 | Benner; Steven A. | Method for incorporating into a DNA or RNA oligonucleotide using nucleotides bearing heterocyclic bases |
US5510475A (en) | 1990-11-08 | 1996-04-23 | Hybridon, Inc. | Oligonucleotide multiple reporter precursors |
US5714331A (en) | 1991-05-24 | 1998-02-03 | Buchardt, Deceased; Ole | Peptide nucleic acids having enhanced binding affinity, sequence specificity and solubility |
US5371241A (en) | 1991-07-19 | 1994-12-06 | Pharmacia P-L Biochemicals Inc. | Fluorescein labelled phosphoramidites |
US5571799A (en) | 1991-08-12 | 1996-11-05 | Basco, Ltd. | (2'-5') oligoadenylate analogues useful as inhibitors of host-v5.-graft response |
US5587361A (en) | 1991-10-15 | 1996-12-24 | Isis Pharmaceuticals, Inc. | Oligonucleotides having phosphorothioate linkages of high chiral purity |
WO1993007883A1 (en) | 1991-10-24 | 1993-04-29 | Isis Pharmaceuticals, Inc. | Derivatized oligonucleotides having improved uptake and other properties |
US5484908A (en) | 1991-11-26 | 1996-01-16 | Gilead Sciences, Inc. | Oligonucleotides containing 5-propynyl pyrimidines |
US5830653A (en) | 1991-11-26 | 1998-11-03 | Gilead Sciences, Inc. | Methods of using oligomers containing modified pyrimidines |
US5565552A (en) | 1992-01-21 | 1996-10-15 | Pharmacyclics, Inc. | Method of expanded porphyrin-oligonucleotide conjugate synthesis |
US5595726A (en) | 1992-01-21 | 1997-01-21 | Pharmacyclics, Inc. | Chromophore probe for detection of nucleic acid |
US5587371A (en) | 1992-01-21 | 1996-12-24 | Pharmacyclics, Inc. | Texaphyrin-oligonucleotide conjugates |
US5633360A (en) | 1992-04-14 | 1997-05-27 | Gilead Sciences, Inc. | Oligonucleotide analogs capable of passive cell membrane permeation |
US5434257A (en) | 1992-06-01 | 1995-07-18 | Gilead Sciences, Inc. | Binding compentent oligomers containing unsaturated 3',5' and 2',5' linkages |
US5272250A (en) | 1992-07-10 | 1993-12-21 | Spielvogel Bernard F | Boronated phosphoramidate compounds |
US5574142A (en) | 1992-12-15 | 1996-11-12 | Microprobe Corporation | Peptide linkers for improved oligonucleotide delivery |
US5476925A (en) | 1993-02-01 | 1995-12-19 | Northwestern University | Oligodeoxyribonucleotides including 3'-aminonucleoside-phosphoramidate linkages and terminal 3'-amino groups |
US5466677A (en) | 1993-03-06 | 1995-11-14 | Ciba-Geigy Corporation | Dinucleoside phosphinates and their pharmaceutical compositions |
US5663312A (en) | 1993-03-31 | 1997-09-02 | Sanofi | Oligonucleotide dimers with amide linkages replacing phosphodiester linkages |
US5539082A (en) | 1993-04-26 | 1996-07-23 | Nielsen; Peter E. | Peptide nucleic acids |
US5763588A (en) | 1993-09-17 | 1998-06-09 | Gilead Sciences, Inc. | Pyrimidine derivatives for labeled binding partners |
US6005096A (en) | 1993-09-17 | 1999-12-21 | Gilead Sciences, Inc. | Pyrimidine derivatives |
US5502177A (en) | 1993-09-17 | 1996-03-26 | Gilead Sciences, Inc. | Pyrimidine derivatives for labeled binding partners |
US5719262A (en) | 1993-11-22 | 1998-02-17 | Buchardt, Deceased; Ole | Peptide nucleic acids having amino acid side chains |
US5457187A (en) | 1993-12-08 | 1995-10-10 | Board Of Regents University Of Nebraska | Oligonucleotides containing 5-fluorouracil |
US5599928A (en) | 1994-02-15 | 1997-02-04 | Pharmacyclics, Inc. | Texaphyrin compounds having improved functionalization |
US5596091A (en) | 1994-03-18 | 1997-01-21 | The Regents Of The University Of California | Antisense oligonucleotides comprising 5-aminoalkyl pyrimidine nucleotides |
US5525711A (en) | 1994-05-18 | 1996-06-11 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Pteridine nucleotide analogs as fluorescent DNA probes |
US5597696A (en) | 1994-07-18 | 1997-01-28 | Becton Dickinson And Company | Covalent cyanine dye oligonucleotide conjugates |
US5580731A (en) | 1994-08-25 | 1996-12-03 | Chiron Corporation | N-4 modified pyrimidine deoxynucleotides and oligonucleotide probes synthesized therewith |
US5591584A (en) | 1994-08-25 | 1997-01-07 | Chiron Corporation | N-4 modified pyrimidine deoxynucleotides and oligonucleotide probes synthesized therewith |
US6287860B1 (en) | 2000-01-20 | 2001-09-11 | Isis Pharmaceuticals, Inc. | Antisense inhibition of MEKK2 expression |
US20030158403A1 (en) | 2001-07-03 | 2003-08-21 | Isis Pharmaceuticals, Inc. | Nuclease resistant chimeric oligonucleotides |
US9322037B2 (en) | 2013-09-06 | 2016-04-26 | President And Fellows Of Harvard College | Cas9-FokI fusion proteins and uses thereof |
US9388430B2 (en) | 2013-09-06 | 2016-07-12 | President And Fellows Of Harvard College | Cas9-recombinase fusion proteins and uses thereof |
WO2018009562A1 (en) | 2016-07-05 | 2018-01-11 | The Johns Hopkins University | Crispr/cas9-based compositions and methods for treating retinal degenerations |
WO2018149888A1 (en) | 2017-02-14 | 2018-08-23 | Universita' Degli Studi Di Trento | High-fidelity cas9 variants and applications thereof |
WO2019102381A1 (en) | 2017-11-21 | 2019-05-31 | Casebia Therapeutics Llp | Materials and methods for treatment of autosomal dominant retinitis pigmentosa |
WO2019183630A2 (en) | 2018-03-23 | 2019-09-26 | The Trustees Of Columbia University In The City Of New York | Gene editing for autosomal dominant diseases |
WO2020176552A1 (en) * | 2019-02-25 | 2020-09-03 | Editas Medicine, Inc. | Crispr/rna-guided nuclease-related methods and compositions for treating rho-associated autosomal-dominant retinitis pigmentosa (adrp) |
WO2020257514A1 (en) * | 2019-06-21 | 2020-12-24 | Children's Medical Center Corporation | Methods and compositions for allele specific gene editing |
WO2021113763A1 (en) * | 2019-12-06 | 2021-06-10 | Scribe Therapeutics Inc. | Compositions and methods for the targeting of rhodopsin |
WO2021122944A1 (en) * | 2019-12-18 | 2021-06-24 | Alia Therapeutics Srl | Compositions and methods for treating retinitis pigmentosa |
Non-Patent Citations (78)
Title |
---|
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
ALTSCHUL ET AL., NUC. ACIDS RES., vol. 25, 1977, pages 3389 - 3402 |
ATHANASIOU ET AL., PROG RETIN EYE RES., vol. 62, 2018, pages 1 - 23 |
BARRETT ET AL., STEM CELLS TRANS MED, vol. 3, 2014, pages 1 - 6 |
BEHLKE, OLIGONUCLEOTIDES, vol. 18, no. 4, 2008, pages 305 - 19 |
BOSHART ET AL., CELL, vol. 41, 1985, pages 521 - 530 |
BRAASCHDAVID COREY, BIOCHEMISTRY, vol. 41, no. 14, 2002, pages 4503 - 4510 |
BREMSEN ET AL., FRONT GENET, vol. 3, 2012, pages 154 |
BUDNIATZKYGEPSTEIN, STEM CELLS TRANSL MED., vol. 3, no. 4, pages 448 - 57 |
CAHILL ET AL., FRONT. BIOSCI., vol. 11, 2006, pages 1958 - 1976 |
CASINI ET AL., NATURE BIOTECHNOLOGY, vol. 36, 2018, pages 265 - 271 |
CASINI, NAT. BIOTECHNOL., 2018 |
CHERNOLOVSKAYA ET AL., CURR OPIN MOL THER., vol. 12, no. 2, 2010, pages 158 - 67 |
CLEMENT ET AL., NATURE BIOTECHNOLOGY, vol. 37, 2019, pages 224 - 226 |
CONCEPCION ET AL., VISION RESEARCH, vol. 42, no. 4, 2002, pages 417 - 426 |
CROOKE ET AL., J. PHARMACOL. EXP. THER., vol. 277, 1996, pages 923 - 937 |
DE MESMAEKER ET AL., ACE. CHEM. RES., vol. 28, 1995, pages 366 - 374 |
DELEAVEY ET AL., CURR PROTOC NUCLEIC ACID CHEM CHAPTER, vol. 16, 2009 |
DRYJA ET AL., N.ENGL.J.MED., vol. 323, 1990, pages 1302 - 1307 |
ENGLISCH ET AL.: "Angewandle Chemie", vol. 30, 1991, pages: 613 |
ERIN R. BURNIGHT ET AL: "Using CRISPR-Cas9 to Generate Gene-Corrected Autologous iPSCs for the Treatment of Inherited Retinal Degeneration", MOLECULAR THERAPY, vol. 25, no. 9, 1 September 2017 (2017-09-01), US, pages 1999 - 2013, XP055557450, ISSN: 1525-0016, DOI: 10.1016/j.ymthe.2017.05.015 * |
FEODOROVA ET AL., METHODSX, vol. 2, 2015, pages 39 - 46 |
FOCOSI ET AL., BLOOD CANCER JOURNAL, vol. 4, 2014, pages e211 |
FUCINI ET AL., NUCLEIC ACID THER, vol. 22, no. 3, 2012, pages 205 - 210 |
GAGLIONEMESSERE, MINI REV MED CHEM, vol. 10, no. 7, 2010, pages 578 - 95 |
GEBEYEHU ET AL., NUCL. ACIDS RES., vol. 15, 1997, pages 4513 |
GENESIS, vol. 30, 2001 |
GOEDDEL: "Gene Expression Technology: Methods in Enzymology", vol. 185, 1990, ACADEMIC PRESS |
HEASMAN, DEV. BIOL., vol. 243, 2002, pages 209 - 214 |
HU, PROTEIN PEPT LETT., vol. 21, no. 10, 2014, pages 1025 - 30 |
HUANGFU, NATURE BIOTECHNOLOGY, vol. 26, no. 7, 2008, pages 795 - 797 |
IKEDA ET AL., COMMUN BIOL, vol. 2, 2019, pages 371 |
ISHIDA M., CURRENT EYE RESEARCH, vol. 17, no. 4, 1998, pages 392 - 402 |
JAYAVARADHAN ET AL., NAT COMMUN, vol. 10, 2019, pages 2866 |
KABANOV ET AL., FEBS LETT., vol. 259, 1990, pages 327 - 330 |
KARLINALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5787 |
KLASSEN ET AL., JOURNAL OF NEUROSCIENCE RESEARCH, vol. 77, 2004, pages 334 - 343 |
KLEINSTIVER ET AL., NATURE, vol. 529, 2016, pages 490 - 495 |
KOMBERG, A.: "Remington's Pharmaceutical Sciences", 1980, MACK PUBLISHING CO, pages: 75 - 77 |
KULCSAR, NAT. COMMS, 2020 |
LACERRA ET AL., PROC. NATL. ACAD. SCI., vol. 97, 2000, pages 9591 - 9596 |
LEE, NAT COMMUN., vol. 9, 2018, pages 3048 |
LETSINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 10915 - 6556 |
MAEDER ET AL., NAT MED, vol. 25, 2019, pages 229 - 233 |
MAHERALIHOCHEDLINGER, CELL STEM CELL, vol. 3, no. 6, 2008, pages 595 - 605 |
MALI, NAT METHODS., vol. 10, no. 10, 2013, pages 957 - 63 |
MANCHARAN ET AL., NUCLEOSIDES & NUCLEOTIDES, vol. 14, 1995, pages 969 - 973 |
MANOHARAN ET AL., ANN. N. Y. ACAD. SCI., vol. 660, 1992, pages 306 - 309 |
MANOHARAN ET AL., BIOORG. MED. CHEM. LET., vol. 3, 1993, pages 2765 - 2770 |
MANOHARAN ET AL., BIOORG. MED. CHEM. LET., vol. 4, 1994, pages 1053 - 1060 |
MANOHARAN ET AL., TETRAHEDRON LETT., vol. 36, 1995, pages 3651 - 3654 |
MARSON ET AL., CELL-STEM CELL, vol. 3, 2008, pages 132 - 135 |
MARTIN ET AL., HELV. CHIM. ACTA, vol. 78, 1995, pages 486 |
MISHRA ET AL., BIOCHIM. BIOPHYS. ACTA, vol. 1264, 1995, pages 229 - 237 |
MONTAGNA ET AL., MOLECULAR THERAPY: NUCLEIC ACIDS, vol. 12, 2018, pages 453 - 462 |
NASEVICIUS ET AL., NAT. GENET., vol. 26, 2000, pages 216 - 220 |
NIELSEN ET AL., SCIENCE, vol. 254, 1991, pages 1497 - 1500 |
OBERHAUSER, NUCL. ACIDS RES., vol. 20, 1992, pages 533 - 538 |
PETRIS ET AL., NATURE COMMUNICATIONS, vol. 8, 2017, pages 15334 |
PHILLIPS ET AL., STEM CELLS, vol. 32, no. 6, 2014, pages 1480 - 1492 |
PITTINGER, SCIENCE, vol. 284, 1999, pages 143 - 147 |
RIBEIRO ET AL., J. GENOMICS, 2018 |
SALCHOW ET AL., CURRENT EYE RESEARCH, vol. 22, no. 2, 2001, pages 85 - 9 |
SCHMITT ET AL., INVESTIGATIVE OPHTHALMOLOGY AND VISUAL SCIENCES, vol. 50, no. 12, 2009, pages 5901 - 8 |
SHEA ET AL., NUCL. ACIDS RES., vol. 18, 1990, pages 3777 - 3783 |
SLAYMAKER ET AL., SCIENCE, vol. 351, no. 6268, 2016, pages 84 - 88 |
SVINARCHUK ET AL., BIOCHIMIE, vol. 75, 1993, pages 49 - 54 |
TAKAHASHIYAMANAKA, CELL, vol. 126, no. 4, 2006, pages 663 - 76 |
TSAI ET AL., NATURE BIOTECHNOLOGY, vol. 33, 2015, pages 187 - 195 |
TSAI ET AL., NATURE BIOTECHNOLOGY, vol. 34, 2016, pages 483 |
TUCKER ET AL., PLOS ONE, vol. 6, no. 4, 2011, pages e18992 |
VAKULSKAS, NAT MED, vol. 24, 2018, pages 1216 - 1224 |
WANG ET AL., J. AM. CHEM. SOC., vol. 122, 2000, pages 8595 - 8602 |
WARREN ET AL., CELL STEM CELL, vol. 7, no. 5, 2010, pages 618 - 30 |
WHITEHEAD KA ET AL., ANNUAL REVIEW OF CHEMICAL AND BIOMOLECULAR ENGINEERING, vol. 2, 2011, pages 77 - 96 |
XIAO ET AL., THE CRISPR JOURNAL, vol. 2, no. 1, 2019, pages 51 - 63 |
YANG ET AL., STEM CELLS INTERNATIONAL, 2016 |
ZHONG ET AL., NAT. COMMUN, vol. 5, 2014, pages 4047 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP3585900B1 (en) | Materials and methods for treatment of spinocerebellar ataxia type 2 (sca2) and other spinocerebellar ataxia type 2 protein (atxn2) gene related conditions or disorders | |
US11118177B2 (en) | Materials and methods for treatment of Usher syndrome type 2A and/or non-syndromic autosomal recessive retinitis pigmentosa (ARRP) | |
US20230227855A1 (en) | Materials and Methods for Treatment of Myotonic Dystrophy Type 1 (DM) and Other Related Disorders | |
US11407997B2 (en) | Materials and methods for treatment of primary hyperoxaluria type 1 (PH1) and other alanine-glyoxylate aminotransferase (AGXT) gene related conditions or disorders | |
US11559588B2 (en) | Materials and methods for treatment of Spinocerebellar Ataxia Type 1 (SCA1) and other Spinocerebellar Ataxia Type 1 Protein (ATXN1) gene related conditions or disorders | |
US11459587B2 (en) | Materials and methods for treatment of pain related disorders | |
US20190153441A1 (en) | Materials and methods for treatment of autosomal dominant retinitis pigmentosa | |
WO2018058064A1 (en) | Compositions and methods for gene editing | |
EP3585895A1 (en) | Compositions and methods for gene editing | |
WO2018154412A1 (en) | Materials and methods for treatment of merosin-deficient cogenital muscular dystrophy (mdcmd) and other laminin, alpha 2 (lama2) gene related conditions or disorders | |
US10995328B2 (en) | Materials and methods for treatment of autosomal dominant cone-rod dystrophy | |
AU2017292169B2 (en) | Materials and methods for treatment of pain related disorders | |
AU2017290614A1 (en) | Materials and methods for treatment of friedreich ataxia and other related disorders | |
WO2018002886A1 (en) | Materials and methods for treatment of spinocerebellar ataxia 3 (sca3) and other related disorders | |
US20230054569A1 (en) | Compositions and methods for treating retinitis pigmentosa | |
WO2023285431A1 (en) | Compositions and methods for allele specific treatment of retinitis pigmentosa | |
WO2023194359A1 (en) | Compositions and methods for treatment of usher syndrome type 2a | |
WO2024056880A2 (en) | Enqp type ii cas proteins and applications thereof | |
WO2023118349A1 (en) | Type ii cas proteins and applications thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22751019 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |