WO2020223322A1 - Intrathecal and intravenous combination gene therapy for the treatment of infantile batten disease - Google Patents

Intrathecal and intravenous combination gene therapy for the treatment of infantile batten disease Download PDF

Info

Publication number
WO2020223322A1
WO2020223322A1 PCT/US2020/030427 US2020030427W WO2020223322A1 WO 2020223322 A1 WO2020223322 A1 WO 2020223322A1 US 2020030427 W US2020030427 W US 2020030427W WO 2020223322 A1 WO2020223322 A1 WO 2020223322A1
Authority
WO
WIPO (PCT)
Prior art keywords
polynucleotide
aav
viral particle
cln1
vector
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/030427
Other languages
English (en)
French (fr)
Inventor
Timothy J. Miller
Steven J. Gray
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of North Carolina at Chapel Hill
Original Assignee
University of North Carolina at Chapel Hill
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to BR112021021632A priority Critical patent/BR112021021632A8/pt
Priority to CA3138274A priority patent/CA3138274A1/en
Priority to EP20798198.6A priority patent/EP3963081A4/en
Priority to SG11202111908XA priority patent/SG11202111908XA/en
Priority to CN202080047719.4A priority patent/CN114269935A/zh
Priority to AU2020264438A priority patent/AU2020264438A1/en
Priority to KR1020217038864A priority patent/KR20220046513A/ko
Priority to MX2021013275A priority patent/MX2021013275A/es
Application filed by University of North Carolina at Chapel Hill filed Critical University of North Carolina at Chapel Hill
Priority to JP2021564486A priority patent/JP7788594B2/ja
Priority to US17/607,315 priority patent/US20220193268A1/en
Publication of WO2020223322A1 publication Critical patent/WO2020223322A1/en
Priority to IL287608A priority patent/IL287608A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/0075Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the delivery route, e.g. oral, subcutaneous
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/08Antiepileptics; Anticonvulsants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/07Animals genetically altered by homologous recombination
    • A01K2217/075Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/0306Animal model for genetic diseases
    • A01K2267/0318Animal model for neurodegenerative disease, e.g. non- Alzheimer's
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14123Virus like particles [VLP]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14171Demonstrated in vivo effect

Definitions

  • infantile neuronal lipofuscinosis infantile Batten disease or“IBD”) or infantile neuronal ceroid lipofuscinosis (INCL) is caused by mutations in the CLN1 gene and is an autosomal recessive disorder.
  • the CLN1 gene located at lp32, encodes a lysosomal enzyme called palmitoyl protein thioesterase 1 (PPT1).
  • PPT1 deficient cells accumulate autoflurorescent storage material and become dysfunctional, leading to neuro-inflammation, neuron loss, and neurodegeneration.
  • Some children with mutations in CLN1 have a later onset of symptoms and slower disease progression, which resembles juvenile onset disease and is more typically associated with mutations in the CLN3 gene.
  • Prior treatments include enzyme replacement therapy, gene therapy and the administration of neural stem cells.
  • kits for treating IBD or an IBD related disorder in a subject in need thereof comprising, or consisting essentially of, or yet further consisting of, intrathecal administration of a polynucleotide comprising a CLN1 open reading frame and subsequent intravenous administration of the polynucleotide, thereby treating IBD or an IBD related disorder.
  • the polynucleotide comprising the CLN1 open reading frame comprises a wild-type CLN1 polynucleotide.
  • the polynucleotide comprising the CLN1 open reading frame comprises codon-optimized polynucleotide sequence of the polynucleotide or its complement is codon-optimized for expression in a human cell.
  • the polynucleotide comprises the nucleotide sequence of SEQ ID NO: 1 or SEQ ID NO: 2, or a nucleotide sequence having at least about 90% identical of each thereto or their complements, wherein the equivalent is identical at the codon-optimized nucleotides.
  • FIG. 1 shows a map of an illustrative CLN1 expression cassette.
  • FIG. 2 shows serum enzyme activity of PPT1 in mice administered scAAV9/CLNl therapy.
  • IT lumbar intrathecal injection
  • IV intravenous injection
  • Het heterologous
  • KO knock-out.
  • FIG. 3A shows survival curves for cohorts of CLN1 knockout mice intrathecally administered with the CLN1 AAV vector at 4 or 12 weeks of age.
  • FIG. 3B shows survival curves for cohorts of CLN1 knockout mice intrathecally administered with the CLN1 AAV vector at 20 or 26 weeks of age.
  • FIG. 4A shows survival curves for cohorts of CLN1 knockout mice intrathecally or intrathecally+intravenously administered with the CLN1 AAV vector at 4 weeks of age.
  • FIG. 4B shows survival curves for cohorts of CLN1 knockout mice intrathecally, intravenously, or intrathecally+intravenously administered with the CLN1 AAV vector at 20 weeks of age.
  • FIG. 5A shows survival curves for CLN1 knockout mice administered with the CLN1 AAV vector pre-symptom onset at different doses and via different administration routes.
  • FIG. 5B shows survival curves for CLN1 knockout mice administered with the CLN1 AAV vector post-symptom onset at different doses and via different administration routes.
  • FIGs. 6A-6B shows swim speed assessment in the Morris Water Maze.
  • FIGs. 7A-7B show time to fall from inverted wire-hang.
  • FIG. 8 shows normalized physical capacity score (PSC) vs relative survival time for various mouse treatment groups.
  • FIG. 9A shows serum PPT1 levels in heterologous mice administered scAAV9/CLNl therapy as neonates.
  • FIG. 9B shows swimming speed in heterologous mice administered scAAV9/CLNl therapy as neonates.
  • FIG. 10 shows PPT1 enzyme activities measured in different tissues of rats treated with scAAV9/CLNl vector.
  • FIG. 11 shows levels of neutralizing antibody against AAV9 in rats treated with scAAV9/CLNl vector.
  • FIG. 12 depicts a diagram of IBD symptom development in mice treated with scAAV9/CLNl vector at different time points.
  • the term“comprising” is intended to mean that the compositions and methods include the recited elements, but do not exclude others.
  • the transitional phrase consisting essentially of (and grammatical variants) is to be interpreted as encompassing the recited materials or steps and those that do not materially affect the basic and novel character! stic(s) of the recited embodiment.
  • the term“consisting essentially of’ as used herein should not be interpreted as equivalent to“comprising.”“Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions disclosed herein. Aspects defined by each of these transition terms are within the scope of the present disclosure.
  • AAV adeno-associated virus
  • AAV adeno-associated virus
  • the AAV particle comprises, or alternatively consists essentially of, or yet further consists of three major viral proteins: VP1, VP2 and VP3.
  • the AAV refers to of the serotype AAV1, AAV2, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV 12, AAV13, AAV PHP.B, or AAV rh74.
  • the AAV may be a self-complementary AAV (scAAV).
  • cell may refer to either a prokaryotic or eukaryotic cell, optionally obtained from a subject or a commercially available source.
  • Eukaryotic cells comprise, or alternatively consist essentially of, or yet further consist of all of the life kingdoms except monera. They can be easily distinguished through a membrane-bound nucleus. Animals, plants, fungi, and protists are eukaryotes or organisms whose cells are organized into complex structures by internal membranes and a cytoskeleton.
  • the term“host” includes a eukaryotic host, including, for example, yeast, higher plant, insect and mammalian cells.
  • eukaryotic cells or hosts include simian, bovine, porcine, murine, rat, avian, reptilian and human, e.g., HEK293 cells and 293T cells.
  • Prokaryotic cells that usually lack a nucleus or any other membrane-bound organelles and are divided into two domains, bacteria and archaea. In addition to chromosomal DNA, these cells can also contain genetic information in a circular loop called on episome. Bacterial cells are very small, roughly the size of an animal mitochondrion (about 1-2 pm in diameter and 10 pm long). Prokaryotic cells feature three major shapes: rod shaped, spherical, and spiral. Instead of going through elaborate replication processes like eukaryotes, bacterial cells divide by binary fission. Examples include but are not limited to Bacillus bacteria, E. coli bacterium, and Salmonella bacterium.
  • nucleic acid sequences refers to a polynucleotide which is said to“encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof.
  • the antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
  • equivalent polypeptides or polynucleotides include those having at least 60%, or alternatively at least 65%, or alternatively at least 70%, or alternatively at least 75%, or alternatively 80%, or alternatively at least 85%, or alternatively at least 90%, or alternatively at least 95% identity thereto or for polypeptide or polynucleotide sequence, or a polypeptide which is encoded by a polynucleotide or its complement that hybridizes under conditions of high stringency to a polynucleotide encoding such polypeptide sequences.
  • an equivalent thereof is a polypeptide encoded by a polynucleotide or a complement thereto, having at least 70%, or alternatively at least 75%, or alternatively at least 80%, or alternatively at least 85%, or alternatively at least 90%, or alternatively at least 95% identity, or at least 97% sequence identity to the reference polynucleotide, e.g., the wild-type polynucleotide.
  • a biological equivalent has the desired percent identity while maintaining unchanged the nucleotide(s) or amino acid(s) of the reference nucleotide(s) or amino acid(s) (e.g., having at least 60%, or alternatively at least 65%, or alternatively at least 70%, or alternatively at least 75%, or alternatively at least 80%, or alternatively at least 85%, or alternatively at least 90%, or alternatively at least 95% identity thereto or for polypeptide or polynucleotide sequence), or a polypeptide which is encoded by a polynucleotide or its complement that hybridizes under conditions of high stringency to a polynucleotide encoding such polypeptide sequences.
  • a polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) having a certain percentage (for example, 80%, 85%, 90%, or 95%) of“sequence identity” to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences.
  • the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1. default parameters are used for alignment.
  • a non-limiting exemplary alignment program is BLAST, using default parameters.
  • GenBank+EMBL+DDBJ+PDB+GenBank CDS translations+SwissProtein+SPupdate+PIR Details of these programs can be found at the following Internet address: ncbi.nlm.nih.gov/cgi- bin/BLAST. Sequence identity and percent identity can be determined by incorporating them into clustalW (available at the web address:genome.jp/tools/clustalw/, last accessed on Jan. 13, 2017).
  • Homology or“identity” or“similarity” refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence that may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences. An“unrelated” or“non- homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences of the present disclosure.
  • expression refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.
  • A“gene” refers to a polynucleotide containing at least one open reading frame (ORF) that is capable of encoding a particular polypeptide or protein after being transcribed and translated.
  • A“gene product” or alternatively a“gene expression product” refers to the amino acid (e.g., peptide or polypeptide) generated when a gene is transcribed and translated.
  • “Under transcriptional control” is a term well understood in the art and indicates that transcription of a polynucleotide sequence, usually a DNA sequence, depends on it being operatively linked to an element which contributes to the initiation of, or promotes, transcription. “Operatively linked” intends the polynucleotides are arranged in a manner that allows them to function in a cell. In one aspect, this invention provides promoters operatively linked to the downstream sequences, e.g., suicide gene, VEGF, 165A VEGF, tet activator, etc.
  • the term“encode” as it is applied to polynucleotides refers to a polynucleotide which is said to“encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, it can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof.
  • the antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
  • isolated refers to molecules or biologicals or cellular materials being substantially free from other materials.
  • the term“functional” may be used to modify any molecule, biological, or cellular material to intend that it accomplishes a particular, specified effect.
  • nucleic acid sequence and“polynucleotide” are used interchangeably to refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides.
  • this term includes, but is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising, or alternatively consisting essentially of, or yet further consisting of purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
  • promoter refers to any sequence that regulates the expression of a coding sequence, such as a gene. Promoters may be constitutive, inducible, repressible, or tissue-specific, for example.
  • A“promoter” is a control sequence that is a region of a polynucleotide sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors.
  • Non-limiting exemplary promoters include Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), a cytomegalovirus (CMV) promoter, an SV40 promoter, a dihydrofolate reductase promoter, a b-actin promoter, a phosphoglycerol kinase (PGK) promoter, a U6 promoter, or an EF1 promoter.
  • the promoter is a chicken b-actin (“CBA”) promoter.
  • promoters with certain target specificity are provided herein below including but not limited to CMV, EFla, SV40, PGK1 (human or mouse), P5, Ubc, human beta actin, CAG, TRE, UAS, Ac5, Polyhedrin, CaMKIIa, Gall, TEF1, GDS, ADH1, CaMV35S, Ubi, HI, U6, and Alpha-l-antitrypsin.
  • Synthetically-derived promoters may be used for ubiquitous or tissue specific expression.
  • virus-derived promoters some of which are noted above, may be useful in the methods disclosed herein, e.g., CMV, HIV, adenovirus, and AAV promoters.
  • the promoter is coupled to an enhancer to increase the transcription efficiency.
  • enhancers include an RSV enhancer or a CMV enhancer.
  • An enhancer is a regulatory element that increases the expression of a target sequence.
  • A“promoter/enhancer” is a polynucleotide that contains sequences capable of providing both promoter and enhancer functions. For example, the long terminal repeats of retroviruses contain both promoter and enhancer functions.
  • the enhancer/promoter may be“endogenous” or “exogenous” or“heterologous.”
  • An“endogenous” enhancer/promoter is one which is naturally linked with a given gene in the genome.
  • An“exogenous” or“heterologous” enhancer/promoter is one which is placed in juxtaposition to a gene by means of genetic manipulation (i.e., molecular biological techniques) such that transcription of that gene is directed by the linked enhancer/promoter.
  • the term“protein”,“peptide” and“polypeptide” are used interchangeably and in their broadest sense to refer to a compound of two or more subunits of amino acids, amino acid analogs or peptidomimetics.
  • the subunits may be linked by peptide bonds.
  • the subunit may be linked by other bonds, e.g., ester, ether, etc.
  • a protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise, or alternatively consist essentially of, or yet further consist of a protein’s or peptide’s sequence.
  • amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics.
  • vector refers to a non-chromosomal nucleic acid
  • Vectors may be viral or non-viral.
  • Viral vectors include retroviruses, adenoviruses, herpesvirus, bacculoviruses, modified bacculoviruses, papovirus, AAV vectors, lentiviral vectors, adenovirus vectors, alphavirus vectors and the like.
  • Alphavirus vectors such as Semliki Forest virus-based vectors and Sindbis virus-based vectors, have also been developed for use in gene therapy and immunotherapy. See, Schlesinger and Dubensky (1999) Curr. Opin.
  • non-viral vectors for delivering nucleic acid include naked DNA; DNA complexed with cationic lipids, alone or in combination with cationic polymers; anionic and cationic liposomes; DNA-protein complexes and particles comprising, or alternatively consisting essentially of, or yet further consisting of DNA condensed with cationic polymers such as heterogeneous polylysine, defmed-length oligopeptides, and polyethylene imine, in some cases contained in liposomes; and the use of ternary complexes comprising, or alternatively consisting essentially of, or yet further consisting of a virus and polylysine-DNA.
  • viral vectors include retroviral vectors.
  • the vector comprises an inducible promoter.
  • the inducible promoter is an inducible tetracycline promoter.
  • Tet-Off tetracycline
  • Dox doxycycline
  • Tet-On a Tc derivative
  • Both systems permit gene expression to be tightly regulated in response to varying concentrations of Tc or Dox.
  • Maximal expression levels in Tet systems are very high and compare favorably with the maximal levels obtainable from strong, constitutive mammalian promoters such as CMV (Yin et al., 1996).
  • TetR Tet repressor protein
  • TetR blocks transcription of these genes by binding to the tet operator sequences (tetO) in the absence of Tc.
  • TetR and tetO provide the basis of regulation and induction for use in mammalian experimental systems.
  • the regulatory protein is based on a“reverse” Tet repressor (rTetR) which was created by four amino acid changes in TetR (Hillen & Berens, 1994; Gossen et al., 1995).
  • the resulting protein, rtTA (reverse tTA also referred to tetracycline activator protein), is encoded by the pTet-On regulator plasmid. This gene may be in a separate vector as the therapeutic gene or encoded on the same gene.
  • the vector further comprises, or alternatively consists essentially of, or yet further consists of a nucleic acid encoding a tetracycline activator protein; and a promoter that regulates expression of the tetracycline activator protein.
  • inducible systems useful in vectors, isolated cells, viral packaging systems, and methods described herein include regulation by ecdysone, by estrogen, progesterone, chemical inducers of dimerization, and isopropyl-beta-Dl-thiogalactopyranoside (EPTG).
  • recombinant expression system or“recombinant vector” refers to a genetic construct or constructs for the expression of certain genetic material formed by recombination.
  • a population of cells intends a collection of more than one cell that is identical (clonal) or non-identical in phenotype and/or genotype.
  • a substantially homogenous population of cells is a population having at least 70 %, or alternatively at least 75 %, or alternatively at least 80%, or alternatively at least 85%, or alternatively at least 90 %, or alternatively at least 95 %, or alternatively at least 98% identical phenotype, as measured by pre-selected markers.
  • A“gene delivery vehicle” is defined as any molecule that can carry inserted polynucleotides into a host cell.
  • Examples of gene delivery vehicles are liposomes, micelles biocompatible polymers, including natural polymers and synthetic polymers; lipoproteins;
  • polypeptides polypeptides; polysaccharides; lipopolysaccharides; artificial viral envelopes; metal particles; and bacteria, or viruses, such as baculovirus, adenovirus and retrovirus, bacteriophage, cosmid, plasmid, fungal vectors and other recombination vehicles typically used in the art which have been described for expression in a variety of eukaryotic and prokaryotic hosts, and may be used for gene therapy as well as for simple protein expression.
  • viruses such as baculovirus, adenovirus and retrovirus, bacteriophage, cosmid, plasmid, fungal vectors and other recombination vehicles typically used in the art which have been described for expression in a variety of eukaryotic and prokaryotic hosts, and may be used for gene therapy as well as for simple protein expression.
  • a polynucleotide disclosed herein can be delivered to a cell or tissue using a gene delivery vehicle.“Gene delivery,”“gene transfer,”“transducing,” and the like as used herein, are terms referring to the introduction of an exogenous polynucleotide (sometimes referred to as a “transgene”) into a host cell, irrespective of the method used for the introduction.
  • Such methods include a variety of well-known techniques such as vector-mediated gene transfer (by, e.g., viral infection/transfection, or various other protein-based or lipid-based gene delivery complexes) as well as techniques facilitating the delivery of“naked” polynucleotides (such as electroporation, “gene gun” delivery and various other techniques used for the introduction of polynucleotides).
  • vector-mediated gene transfer by, e.g., viral infection/transfection, or various other protein-based or lipid-based gene delivery complexes
  • techniques facilitating the delivery of“naked” polynucleotides such as electroporation, “gene gun” delivery and various other techniques used for the introduction of polynucleotides.
  • the introduced polynucleotide may be stably or transiently maintained in the host cell.
  • Stable maintenance typically requires that the introduced polynucleotide either contains an origin of replication compatible with the host cell or integrates into a replicon of the host cell such as an extrachromosomal replicon (e.g., a plasmid) or a nuclear or mitochondrial chromosome.
  • a replicon of the host cell such as an extrachromosomal replicon (e.g., a plasmid) or a nuclear or mitochondrial chromosome.
  • a number of vectors are known to be capable of mediating transfer of genes to mammalian cells, as is known in the art and described herein.
  • the term“codon-optimized” refers to a coding sequence that is optimized relative to a wild type coding sequence (e.g., a coding sequence for PPT1) to increase expression of the coding sequence by substituting one or more codons normally present in the coding sequence with a codon for the same (synonymous) amino acid.
  • the substitutions minimize rare codons (e.g., human codons), increase total GC content, decrease CpG content, remove cryptic splice donor or acceptor sites, and/or add or remove ribosomal entry sites, such as Kozak sequences.
  • International PCT Publication No.: WO 2017/218450, published December 21, 2017 discloses codon-optimized CLN 1 gene sequences, methods for producing and general methods for delivery of a
  • A“plasmid” is an extra-chromosomal DNA molecule separate from the chromosomal DNA which is capable of replicating independently of the chromosomal DNA. In many cases, it is circular and double-stranded. Plasmids provide a mechanism for horizontal gene transfer within a population of microbes and typically provide a selective advantage under a given environmental state. Plasmids may carry genes that provide resistance to naturally occurring antibiotics in a competitive environmental niche, or alternatively the proteins produced may act as toxins under similar circumstances.
  • Plasmids used in genetic engineering are called“plasmid vectors”. Many plasmids are commercially available for such uses. The gene to be replicated is inserted into copies of a plasmid containing genes that make cells resistant to particular antibiotics and a multiple cloning site (MCS, or polylinker), which is a short region containing several commonly used restriction sites allowing the easy insertion of DNA fragments at this location.
  • MCS multiple cloning site
  • Another major use of plasmids is to make large amounts of proteins. In this case, researchers grow bacteria containing a plasmid harboring the gene of interest. Just as the bacterium produces proteins to confer its antibiotic resistance, it can also be induced to produce large amounts of proteins from the inserted gene.
  • a vector construct refers to the polynucleotide comprising, or alternatively consisting essentially of, or yet further consisting of the viral genome or part thereof, and a transgene.
  • Ads adenoviruses
  • Ads are a relatively well characterized, homogenous group of viruses, including over 50 serotypes. Ads do not require integration into the host cell genome.
  • Recombinant Ad derived vectors particularly those that reduce the potential for recombination and generation of wild-type virus, have also been constructed. Such vectors are commercially available from sources such as Takara Bio USA (Mountain View,
  • Wild-type AAV has high infectivity and specificity integrating into the host cell’s genome. See, Wold and Toth (2013) Curr. Gene. Ther. 13(6):421-433, Hermonat & Muzyczka (1984) Proc. Natl. Acad. Sci. USA 81 :6466-6470, and Lebkowski et al. (1988) Mol. Cell. Biol. 8:3988-3996.
  • Vectors that contain both a promoter and a cloning site into which a polynucleotide can be operatively linked are well known in the art. Such vectors are capable of transcribing RNA in vitro or in vivo, and are commercially available from sources such as Agilent Technologies (Santa Clara, Calif) and Promega Biotech (Madison, Wis.). In order to optimize expression and/or in vitro transcription, it may be necessary to remove, add or alter 5’ and/or 3’ untranslated portions of the clones to eliminate extra, potential inappropriate alternative translation initiation codons or other sequences that may interfere with or reduce expression, either at the level of transcription or translation. Alternatively, consensus ribosome binding sites can be inserted immediately 5’ of the start codon to enhance expression.
  • Gene delivery vehicles also include DNA/liposome complexes, micelles and targeted viral protein-DNA complexes.
  • Liposomes that also comprise, or alternatively consist essentially of, or yet further consist of a targeting antibody or fragment thereof can be used in the methods disclosed herein.
  • direct introduction of the proteins described herein to the cell or cell population can be done by the non-limiting technique of protein transfection, alternatively culturing conditions that can enhance the expression and/or promote the activity of the proteins disclosed herein are other non-limiting techniques.
  • the term“signal peptide” or“signal polypeptide” intends an amino acid sequence usually present at the N-terminal end of newly synthesized secretory or membrane polypeptides or proteins. It acts to direct the polypeptide to a specific cellular location, e.g. across a cell membrane, into a cell membrane, or into the nucleus. In some embodiments, the signal peptide is removed following localization. Examples of signal peptides are well known in the art. Non-limiting examples are those described in U.S. Patent Nos. 8,853,381, 5,958,736, and 8,795,965.
  • the term“viral capsid” or“capsid” refers to the proteinaceous shell or coat of a viral particle. Capsids function to encapsidate, protect, transport, and release into host cell a viral genome. Capsids are generally comprised of oligomeric structural subunits of protein (“capsid proteins”). As used herein, the term“encapsidated” means enclosed within a viral capsid.
  • helper in reference to a virus or plasmid refers to a virus or plasmid used to provide the additional components necessary for replication and packaging of a viral particle or recombinant viral particle, such as the modified AAV disclosed herein.
  • the components encoded by a helper virus may include any genes required for virion assembly, encapsidation, genome replication, and/or packaging.
  • the helper virus may encode necessary enzymes for the replication of the viral genome.
  • helper viruses and plasmids suitable for use with AAV constructs include pHELP (plasmid), adenovirus (virus), or herpesvirus (virus).
  • AAV is a standard abbreviation for adeno-associated virus.
  • Adeno-associated virus is a single-stranded DNA parvovirus that grows only in cells in which certain functions are provided by a co-infecting helper virus.
  • General information and reviews of AAV can be found in, for example, Carter, 1989, Handbook of Parvoviruses, Vol. 1, pp. 169- 228, and Berns, 1990, Virology, pp. 1743-1764, Raven Press, (New York).
  • An "AAV vector” as used herein refers to a vector comprising, consisting essentially of, or consisting of one or more heterologous nucleic acid (HNA) sequences and one or more AAV inverted terminal repeat sequences (ITRs).
  • HNA heterologous nucleic acid
  • ITRs AAV inverted terminal repeat sequences
  • AAV vectors can be replicated and packaged into infectious viral particles when present in a host cell that provides the functionality of rep and cap gene products; for example, by transfection of the host cell.
  • AAV vectors contain a promoter, at least one nucleic acid that may encode at least one protein or RNA, and/or an enhancer and/or a terminator within the flanking ITRs that is packaged into the infectious AAV particle.
  • the encapsidated nucleic acid portion may be referred to as the AAV vector genome.
  • Plasmids containing AAV vector may also contain elements for manufacturing purposes, e.g., antibiotic resistance genes, etc., but these are not encapsidated and thus do not form part of the AAV particle.
  • An "AAV virion” or "AAV viral particle” or “AAV viral vector” or “AAV vector particle” or“AAV particle” refers to a viral particle composed of at least one AAV capsid protein and an encapsidated polynucleotide AAV vector.
  • production of AAV vector particle necessarily includes production of AAV vector, as such a vector is contained within an AAV vector particle.
  • the AAV is a replication-deficient parvovirus, the single- stranded DNA genome of which is about 4.7 kb in length including two 145 nucleotide inverted terminal repeat (ITRs).
  • ITRs nucleotide inverted terminal repeat
  • the nucleotide sequences of the genomes of the AAV serotypes are known.
  • the complete genome of AAV-1 is provided in GenBank Accession No. NC_002077
  • the complete genome of AAV-2 is provided in GenBank Accession No. NC_001401 and Srivastava et ah, J. Virol., 45: 555-564 (1983)
  • the complete genome of AAV-3 is provided in GenBank Accession No.
  • AAV-4 is provided in GenBank Accession No. NC_001829
  • AAV-5 genome is provided in GenBank Accession No. AF085716
  • the complete genome of AAV-6 is provided in GenBank Accession No. NC_00 1862
  • at least portions of AAV-7 and AAV-8 genomes are provided in GenBank Accession Nos. AX753246 and AX753249, respectively
  • the AAV-9 genome is provided in Gao et ak, J. Virol., 78: 6381-6388 (2004)
  • the AAV-10 genome is provided in Mol. Ther., 13(1): 67-76 (2006)
  • the AAV-11 genome is provided in Virology, 330(2): 375-383 (2004).
  • the sequence of the AAV rh.74 genome is provided in U.S. Patent 9,434,928, incorporated herein by reference. US Patent No. 9,434,928 also provide the sequences of the capsid proteins and a self-complementary genome. In one aspect, the genome is a self-complementary genome.
  • Cis-acting sequences directing viral DNA replication (rep), encapsidation/packaging and host cell chromosome integration are contained within the AAV ITRs.
  • Three AAV promoters (named p5, pi 9, and p40 for their relative map locations) drive the expression of the two AAV internal open reading frames encoding rep and cap genes.
  • the two rep promoters (p5 and pi 9), coupled with the differential splicing of the single AAV intron (at nucleotides 2107 and 2227), result in the production of four rep proteins (rep 78, rep 68, rep 52, and rep 40) from the rep gene.
  • Rep proteins possess multiple enzymatic properties that are ultimately responsible for replicating the viral genome.
  • the cap gene is expressed from the p40 promoter and it encodes the three capsid proteins VP1, VP2, and VP3.
  • Alternative splicing and non-consensus translational start sites are responsible for the production of the three related capsid proteins.
  • a single consensus polyadenylation site is located at map position 95 of the AAV genome. The life cycle and genetics of AAV are reviewed in Muzyczka, Current Topics in Microbiology and Immunology, 158: 97-129 (1992).
  • AAV possesses unique features that make it attractive as a vector for delivering foreign DNA to cells, for example, in gene therapy.
  • AAV infection of cells in culture is noncytopathic, and natural infection of humans and other animals is silent and asymptomatic.
  • AAV infects many mammalian cells allowing the possibility of targeting many different tissues in vivo.
  • AAV transduces slowly dividing and non-dividing cells, and can persist essentially for the lifetime of those cells as a transcriptionally active nuclear episome
  • AAV proviral genome is inserted as cloned DNA in plasmids, which makes construction of recombinant genomes feasible. Furthermore, because the signals directing AAV replication and genome encapsidation are contained within the ITRs of the AAV genome, some or all of the internal approximately 4.3 kb of the genome (encoding replication and structural capsid proteins, rep-cap) may be replaced with foreign DNA. To generate AAV vectors, the rep and cap proteins may be provided in trans. Another significant feature of AAV is that it is an extremely stable and hearty virus. It easily withstands the conditions used to inactivate adenovirus (56° to 65°C for several hours), making cold preservation of AAV less critical. AAV may even be lyophilized. Finally, AAV-infected cells are not resistant to superinfection.
  • AAV DNA in the rAAV genomes may be from any AAV serotype for which a recombinant virus can be derived including, but not limited to, AAV serotypes AAV-1, AAV-2, AAV-3, AAV-4, AAV-5, AAV-6, AAV-7, AAV-8, AAV-9, AAV- 10, AAV-11, AAV- 12, AAV-13, AAV PHP.B and AAV rh74.
  • rAAV pseudotyped rAAV
  • Other types of rAAV variants for example rAAV with capsid mutations, are also contemplated. See, for example, Marsic et al., Molecular Therapy, 22(11): 1900-1909 (2014).
  • the nucleotide sequences of the genomes of various AAV serotypes are known in the art.
  • Other suitable AAV particles are described in PCT/US2019/064396 filed December 4, 2019, which is hereby incorporated by reference in its entirety, but with particularity with respect to the AAV particles and AAV capsid proteins.
  • the term“label” intends a directly or indirectly detectable compound or composition that is conjugated directly or indirectly to the composition to be detected, e.g., polynucleotide or protein such as an antibody so as to generate a“labeled” composition.
  • the term also includes sequences conjugated to the polynucleotide that will provide a signal upon expression of the inserted sequences, such as green fluorescent protein (GFP) and the like.
  • the label may be detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
  • the labels can be suitable for small scale detection or more suitable for high-throughput screening.
  • suitable labels include, but are not limited to radioisotopes, fluorochromes, chemiluminescent compounds, dyes, and proteins, including enzymes.
  • the label may be simply detected or it may be quantified.
  • a response that is simply detected generally comprises, or alternatively consists essentially of, or yet further consists of a response whose existence merely is confirmed, whereas a response that is quantified generally comprises, or alternatively consists essentially of, or yet further consists of a response having a quantifiable (e.g., numerically reportable) value such as an intensity, polarization, and/or other property.
  • a quantifiable e.g., numerically reportable
  • the detectable response may be generated directly using a luminophore or fluorophore associated with an assay component actually involved in binding, or indirectly using a luminophore or fluorophore associated with another (e.g., reporter or indicator) component.
  • luminescent labels that produce signals include, but are not limited to bioluminescence and chemiluminescence.
  • Detectable luminescence response generally comprises, or alternatively consists essentially of, or yet further consists of a change in, or an occurrence of, a luminescence signal.
  • Suitable methods and luminophores for luminescently labeling assay components are known in the art and described for example in Haugland, Richard P. (1996) Handbook of Fluorescent Probes and Research Chemicals (6th ed.).
  • luminescent probes include, but are not limited to, aequorin and luciferases.
  • fluorescent labels include, but are not limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malacite green, stilbene, Lucifer Yellow, Cascade Blue.TM., and Texas Red.
  • suitable optical dyes are described in the Haugland, Richard P. (1996) Handbook of Fluorescent Probes and Research Chemicals (6th ed.).
  • the fluorescent label is functionalized to facilitate covalent attachment to a cellular component present in or on the surface of the cell or tissue such as a cell surface marker.
  • Suitable functional groups including, but not are limited to, isothiocyanate groups, amino groups, haloacetyl groups, maleimides, succinimidyl esters, and sulfonyl halides, all of which may be used to attach the fluorescent label to a second molecule.
  • the choice of the functional group of the fluorescent label will depend on the site of attachment to either a linker, the agent, the marker, or the second labeling agent.
  • Attachment of the fluorescent label may be either directly to the cellular component or compound or alternatively, can by via a linker.
  • Suitable binding pairs for use in indirectly linking the fluorescent label to the intermediate include, but are not limited to,
  • antigens/antibodies e.g., rhodamine/anti-rhodamine, biotin/avidin and biotin/strepavidin.
  • composition is intended to mean a combination of active polypeptide
  • polynucleotide or antibody and another compound or composition, inert (e.g., a detectable label) or active (e.g., a gene delivery vehicle).
  • inert e.g., a detectable label
  • active e.g., a gene delivery vehicle
  • A“pharmaceutical composition” is intended to include the combination of an active polypeptide, polynucleotide or antibody with a carrier, inert or active such as a solid support, making the composition suitable for diagnostic or therapeutic use in vitro, in vivo or ex vivo.
  • the term“pharmaceutically acceptable carrier” encompasses any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, and emulsions, such as an oil/water or water/oil emulsion, and various types of wetting agents.
  • the compositions also can include stabilizers and preservatives.
  • stabilizers and adjuvants see Martin (1975) Remington’s Pharm. Sci., 15th Ed. (Mack Publ. Co., Easton).
  • A“subject” of diagnosis or treatment is a cell or an animal such as a mammal, or a human.
  • a subject is not limited to a specific species and includes non-human animals subject to diagnosis or treatment and are those subject to infections or animal models, for example, simians, murines, such as, rats, mice, chinchilla, canine, such as dogs, leporids, such as rabbits, livestock, sport animals, and pets. Human patients are included within the term as well.
  • tissue is used herein to refer to tissue of a living or deceased organism or any tissue derived from or designed to mimic a living or deceased organism.
  • the tissue may be healthy, diseased, and/or have genetic mutations.
  • the biological tissue may include any single tissue (e.g., a collection of cells that may be interconnected) or a group of tissues making up an organ or part or region of the body of an organism.
  • the tissue may comprise, or alternatively consist essentially of, or yet further consist of a homogeneous cellular material or it may be a composite structure such as that found in regions of the body including the thorax which for instance can include lung tissue, skeletal tissue, and/or muscle tissue.
  • Exemplary tissues include, but are not limited to those derived from liver, lung, thyroid, skin, pancreas, blood vessels, bladder, kidneys, brain, biliary tree, duodenum, abdominal aorta, iliac vein, heart and intestines, including any combination thereof
  • IBD related disorder refers to a disease, disorder, syndrome, or condition that is caused by or a symptom of decreased or altered expression of the CLN1 gene in a subject relative to the expression level or activity in a normal subject, a subject not exhibiting symptoms, or in a population.
  • “treating” or“treatment” of a disease in a subject refers to (1) preventing the symptoms or disease from occurring in a subject that is predisposed or does not yet display symptoms of the disease; (2) inhibiting the disease or arresting its development; or (3) ameliorating or causing regression of the disease or the symptoms of the disease.
  • “treatment” is an approach for obtaining beneficial or desired results, including clinical results.
  • beneficial or desired results can include one or more, but are not limited to, alleviation or amelioration of one or more symptoms, diminishment of extent of a condition (including a disease), stabilized (i.e., not worsening) state of a condition (including disease), delay or slowing of condition (including disease), progression, amelioration or palliation of the condition (including disease), states and remission (whether partial or total), whether detectable or undetectable.
  • the term“effective amount” intends to mean a quantity sufficient to achieve a desired effect. In the context of therapeutic or prophylactic applications, the effective amount will depend on the type and severity of the condition at issue and the characteristics of the individual subject, such as general health, age, sex, body weight, and tolerance to
  • the effective amount is the amount sufficient to result in regaining part or full function of a gene that is deficient in a subject.
  • the effective amount of an AAV viral particle is the amount sufficient to result in expression of a gene in a subject. The skilled artisan will be able to determine appropriate amounts depending on these and other factors.
  • vg refers to viral units provided for gene therapy and are typically noted as vg/kg of the subject.
  • the experiments described herein are amounts that were used to treat mice, and it is inferred that when the subject being treated is not a mouse, the amount is converted to an amount that is appropriate for the subject being treated, e.g., a human, an infant or newborn.
  • the amount administered is in vg/kg and therefore accounts for difference in size and body weight of the subject being treated.
  • the effective amount will depend on the size and nature of the application in question. It will also depend on the nature and sensitivity of the target subject and the methods in use. The skilled artisan will be able to determine the effective amount based on these and other considerations.
  • the effective amount may comprise, or alternatively consist essentially of, or yet further consist of one or more administrations of a composition depending on the embodiment.
  • administer intends to mean delivery of a substance to a subject such as an animal or human. Administration can be effected in one dose, continuously or intermittently throughout the course of treatment. Methods of determining the most effective means and dosage of administration are known to those of skill in the art and will vary with the composition used for therapy, the purpose of the therapy, as well as the age, health or gender of the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician or in the case of pets and animals, treating veterinarian. Suitable dosage formulations and methods of administering the agents are known in the art.
  • Route of administration can also be determined and method of determining the most effective route of administration are known to those of skill in the art and will vary with the composition used for treatment, the purpose of the treatment, the health condition or disease stage of the subject being treated and the target cell or tissue.
  • route of administration include intravenous, intra-arterial, intramuscular, intracardiac, intrathecal, subventricular, epidural, intracerebral, intracerebroventricular, sub- retinal, intravitreal, intraarticular, intraocular, intraperitoneal, intrauterine, intradermal, subcutaneous, transdermal, transmuccosal, and inhalation.
  • the term“modified,” as applied to a polynucleotide or polypeptide sequence refers to a sequence that differs from a wild-type sequence due to one or more deletions, additions, substitutions, or any combination thereof.
  • kits for treating IBD or an IBD related disorder in a subject in need thereof comprising, or consisting essentially of, or yet further consisting of, intrathecal administration of a polynucleotide comprising a CLN1 open reading frame and subsequent intravenous administration of the polynucleotide, thereby treating IBD or an IBD related disorder.
  • the intravenous administration may precede the intrathecal administration.
  • the polynucleotide comprising the CLN1 open reading frame is part of a vector genome, and delivery of the polynucleotide is achieved by administering a viral particle comprising the vector genome. Therefore, in one aspect, provided herein are methods for treating infantile Batten disease (IBD) or an IBD related disorder in a subject comprising combined intrathecal and intravenous administration of effective amounts of viral particles comprising the polynucleotide.
  • IBD infantile Batten disease
  • IBD infantile Batten disease
  • AAV vector particles AAV vectors, AAV vectors, and capsid proteins that find use in delivering the polynucleotide.
  • the viral particle may be an AAV viral particle; for example, an AAV9 viral particle.
  • the polynucleotide comprising the CLN1 open reading frame comprises a wild-type CLN1 polynucleotide.
  • the polynucleotide comprising the CLN1 open reading frame comprises a codon-optimized polynucleotide sequence of CLN1 or its complement is codon-optimized for expression in a human cell.
  • the amino acid sequence of CLN1 or its complement is codon-optimized for expression in a human cell.
  • polynucleotide comprises the nucleotide sequence of SEQ ID NO: 1 or SEQ ID NO: 2, or a nucleotide sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, or at least about 99% identity of each thereto or their complements, wherein the equivalent is identical at the codon-optimized nucleotides.
  • the polynucleotide comprises the nucleotide sequence encoding a polypeptide sequence having at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100% identity to SEQ ID NO: 3.
  • SEQ ID NO: 1 Human codon-optimized CLN1 open reading frame (added stop codon is underlined)
  • SEQ ID NO: 2 (Wild-type CLN1) - is known in the art, e.g., as disclosed by provided by genenames. org/data/gene-symbol -report/# !/hgnc_id/HGNC: 9325 (last accessed on April 29, 2019), which is shown below:
  • Suitable CLN1 genes encode a PPT1 protein having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95% identity, at least about 99% identity or 100% identity to SEQ ID NO: 3 : MASPGCLWLLAVALLPWTCASRALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKM VEKKIPGIYVLSLEIGKTLMEDVEN SFFLNVNSQ VTT VCQ AL AKDPKLQQGYNAMGF SQ GGQFLRAVAQRCPSPPMINLIS VGGQHQGVF GLPRCPGES SHICDFIRKTLNAGAY SKVV QERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSI VDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLS EEWFYAHI
  • the subject may be a mammal; for example, a human.
  • the human may be an infant human; for example, from about 2 months to about 24 months, about 2 years to 12 years old, about 2 years to 5 years old, or 2 years to 5 years old.
  • the polynucleotide can be operably linked to additional elements, e.g., wherein the polynucleotide is operably linked to a promoter; and/or wherein the promoter is a chicken beta actin promoter; and/or wherein the polynucleotide is operably linked to an enhancer; and/or wherein the enhancer is a cytomegalovirus enhancer; and/or wherein the polynucleotide is operably linked to an intron; and/or wherein the intron is a hybrid/modified MVM intron; and/or wherein the polynucleotide is operably linked to a polyadenylation signal; and/or wherein the polyadenylation signal is a bovine growth hormone polyadenylation signal.
  • the polynucleotide may be part of a vector genome for delivery of the polynucleotide, and optionally the vector genome comprising the polynucleotide is packaged into viral particles comprising one or more of wild-type capsid proteins, mutated capsid proteins, tissue tropic capsid protein, and a modified capsid protein with altered tropism compared to a wild-type capsid protein, and wherein the modified capsid protein is optionally liver-detargeted.
  • the vector may comprise at least one adeno-associated virus (AAV) inverted terminal repeat (ITR), e.g., the vector comprises two AAV ITRs; and/or wherein the two AAV ITRs have the same nucleotide sequence; and/or wherein the two AAV ITRs have different nucleotide sequences; and/or wherein the AAV ITRs are AAV2 ITRs; and/or wherein the viral vector is self-complementary AAV genome.
  • AAV adeno-associated virus
  • ITR inverted terminal repeat
  • the vector genome comprising the polynucleotide comprises an enhancer, a promoter, an intron, a human CLN1 open reading frame, and a polyadenylation site.
  • the polynucleotide comprises an AAV ITR, an enhancer, a promoter, an intron, a human CLN 1 open reading frame, a polyadenylation site, and an AAV ITR.
  • the polynucleotide comprises a CMV enhancer, a chicken beta actin promoter, a hybrid/modified MVM intron, a human CLN1 open reading frame, and a bovine growth hormone polyadenylation site.
  • the polynucleotide comprises a mutant AAV ITR, a CMV enhancer, a chicken beta actin promoter, a hybrid/modified MVM intron, a human CLN1 open reading frame, a bovine growth hormone polyadenylation site, and a wild- type AAV ITR.
  • the polynucleotide comprises SEQ ID NO: 1 or 2, or an equivalent of each thereof.
  • the polynucleotide or the viral particle comprising the polynucleotide is administered in an amount to express functional CLN1 (i.e., a PPT1 protein) in the subject.
  • the amount administered can be for transient or for extended expression of the functional CLN1 (i.e., a PPT1 protein) in the subject.
  • the amount administered intrathecally is the same as or different than the amount delivered intravenously.
  • the polynucleotide or the viral particle comprising the
  • polynucleotide is administered intrathecally and intravenously to the subject pre-symptom or post-symptom onset.
  • Children with IBD generally develop symptoms between 2 and 24 months; often by about 18 months of age.
  • the amount to be delivered will vary with the subject and the disease being treated. In one aspect, the amount is considered median or high dose.
  • the amounts to be delivered (using a mouse as an example) is from about 2.0xl0 u vg to about 8.0xl0 u vg or 2.0xl0 u vg/kg to about 8.0xl0 u vg/kg.
  • the polynucleotide is delivered in an amount from about 7.0xl0 10 vg to about 8.0xl0 u vg or from 7.0xl0 10 vg/kg to about 8.0xl0 u vg/kg.
  • the administration is delivered pre-symptom onset and in an amount from about 7.0xl0 10 vg (or vg/kg) to about 8.0xl0 u vg (or vg/kg).
  • the polynucleotide is administered in an amount from about 7.0x10 11 vg (or vg/kg) to about 8.0xl0 u vg (or vg/kg).
  • the amount of viral particles for intrathecal administration in human is from about l.OxlO 12 vg to about l.OxlO 17 vg.
  • the amount for intrathecal administration in human is about l.OxlO 12 vg to about l.OxlO 14 vg, about l.OxlO 13 vg to about l.OxlO 15 vg, about l.OxlO 14 vg to about l.OxlO 16 vg, about l.OxlO 15 vg to about l.OxlO 17 vg, about l.OxlO 13 vg to about l.OxlO 14 vg, about l.OxlO 14 vg to about l.OxlO 15 vg, or about l.OxlO 15 vg to about l.OxlO 16 vg.
  • the amount of viral particles for intravenous administration in human is about l.OxlO 11 vg/kg to about 2.0xl0 16 vg/kg.
  • the amount for intravenous administration in human is about l.OxlO 11 vg/kg to about 2.0xl0 13 vg/kg, about l.OxlO 12 vg/kg to about 2.0xl0 14 vg/kg, about l.OxlO 13 vg/kg to about 2.0xl0 15 vg/kg, about l.OxlO 14 vg/kg to about 2.0xl0 16 vg/kg, about l.OxlO 12 vg/kg to about 2.0xl0 13 vg/kg, about l.OxlO 13 vg/kg to about 2.0xl0 14 vg/kg, about l.OxlO 14 vg/kg to about 2.0xl0 15 vg/kg.
  • the methods may be used to treat any disorder associated with expression of the CLN1 gene such as infantile, late-infantile, juvenile, or adult- onset neuronal ceroid lipofuscinosis. They can be used for other IBD related disorders that result from low or aberrant expression of CLN1, some of which are described in WO 2017/218450, incorporated herein by reference.
  • kits comprising a pharmaceutical composition comprising the CLN1 polynucleotide in a pharmaceutically acceptable carrier and instructions for use in the methods as disclosed herein.
  • a variety of approaches may be used to produce AAV viral vectors.
  • packaging is achieved by using a helper virus or helper plasmid and a cell line.
  • the helper virus or helper plasmid contains elements and sequences that facilitate viral vector production.
  • the helper plasmid is stably incorporated into the genome of a packaging cell line, such that the packaging cell line does not require additional transfection with a helper plasmid.
  • the cell is a packaging or helper cell line.
  • the helper cell line is eukaryotic cell; for example, an HEK 293 cell or 293T cell.
  • the helper cell is a yeast cell or an insect cell.
  • the cell comprises a nucleic acid encoding a tetracycline activator protein; and a promoter that regulates expression of the tetracycline activator protein.
  • the promoter that regulates expression of the tetracycline activator protein is a constitutive promoter.
  • the promoter is a phosphoglycerate kinase promoter (PGK) or a CMV promoter.
  • a helper plasmid may comprise, for example, at least one viral helper DNA sequence derived from a replication-incompetent viral genome encoding in trans all virion proteins required to package a replication incompetent AAV, and for producing virion proteins capable of packaging the replication-incompetent AAV at high titer, without the production of replication- competent AAV.
  • Helper plasmids for packaging AAV are known in the art, see, e.g., U.S. Patent Pub.
  • an AAV helper plasmid may contain as helper virus DNA sequences, by way of non-limiting example, the Ad5 genes E2A, E4 and VA, controlled by their respective original promoters or by heterologous promoters.
  • AAV helper plasmids may additionally contain an expression cassette for the expression of a marker protein such as a fluorescent protein to permit the simple detection of transfection of a desired target cell.
  • the disclosure provides methods of producing AAV particles comprising transfecting a packaging cell line with any one of the AAV helper plasmids disclosed herein; and any one of the AAV vectors disclosed herein.
  • the AAV helper plasmid and AAV vector are co-transfected into the packaging cell line.
  • the cell line is a mammalian cell line, for example, human embryonic kidney (HEK) 293 cell line.
  • the disclosure provides cells comprising any one of the AAV vectors and/or AAV particles disclosed herein.
  • compositions comprising any one of the AAV vectors, AAV capsids and/or AAV particles described herein. Typically, the AAV particles are administered for therapy.
  • the pharmaceutical composition may be formulated by any methods known or developed in the art of pharmacology, which include but are not limited to contacting the active ingredients (e.g., viral particles or recombinant vectors) with an excipient or other accessory ingredient, dividing or packaging the product to a dose unit.
  • the viral particles of this disclosure may be formulated with desirable features, e.g., increased stability, increased cell transfection, sustained or delayed release, biodistributions or tropisms, modulated or enhanced translation of encoded protein in vivo, and the release profile of encoded protein in vivo.
  • the pharmaceutical composition may further comprise saline, lipidoids, liposomes, lipid nanoparticles, polymers, lipoplexes, core-shell nanoparticles, peptides, proteins, cells transfected with viral vectors (e.g., for transplantation into a subject), nanoparticle mimics or combinations thereof.
  • the pharmaceutical composition is formulated as a nanoparticle.
  • the nanoparticle is a self-assembled nucleic acid nanoparticle.
  • a pharmaceutical composition in accordance with the present disclosure may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
  • the amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage such as, for example, one -half or one-third of such a dosage.
  • the formulations of the invention can include one or more excipients, each in an amount that together increases the stability of the viral vector, increases cell transfection or transduction by the viral vector, increases the expression of viral vector encoded protein, and/or alters the release profile of viral vector encoded proteins.
  • the pharmaceutical composition comprises an excipient.
  • excipients include solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, or combination thereof.
  • the pharmaceutical composition comprises a cryoprotectant.
  • cryoprotectant refers to an agent capable of reducing or eliminating damage to a substance during freezing.
  • Non-limiting examples of cryoprotectants include sucrose, trehalose, lactose, glycerol, dextrose, raffinose and/or mannitol.
  • Embodiment 1 A method for treating infantile Batten disease (IBD) or an IBD related disorder in a subject in need thereof, comprising intrathecal administration of a first
  • polynucleotide comprising a CLN1 open reading frame and intravenous administration of a second polynucleotide comprising a CLN1 open reading frame, thereby treating IBD or an IBD related disorder.
  • Embodiment 2 The method of Embodiment 1, wherein the intrathecal administration precedes the intravenous administration.
  • Embodiment 3 The method of Embodiment 1 or 2, wherein the CLN1 open reading frame comprises a wild-type CLN1 polynucleotide, a codon-optimized sequence, or a nucleotide sequence having at least about 90% identity of each thereto.
  • Embodiment 4 The method of Embodiment 3, wherein the codon-optimized sequence is SEQ ID NO: E
  • Embodiment 5 The method of any one of Embodiments 1-4, wherein the CLN1 open reading frame encodes a polypeptide sequence having at least about 90% identity to SEQ ID NO: 3.
  • Embodiment 6 The method of any one of Embodiments 1-5, wherein the subject is a human patient.
  • Embodiment 7 The method of any one of Embodiments 1-6, wherein the CLN1 open reading frame is operably linked to a promoter.
  • Embodiment 8 The method of Embodiment 7, wherein the promoter is a chicken beta actin promoter.
  • Embodiment 9 The method of any one of Embodiments 1-8, wherein the CLN1 open reading frame is operably linked to an enhancer.
  • Embodiment 10 The method of Embodiment 9, wherein the enhancer is a
  • Embodiment 11 The method of any one of Embodiments 1-10, wherein the CLN1 open reading frame is operably linked to an intron.
  • Embodiment 12 The method of Embodiment 11, wherein the intron is a
  • Embodiment 13 The method of any one of Embodiments 1-12, wherein the CLN1 open reading frame is operably linked to a polyadenylation signal.
  • Embodiment 14 The method of Embodiment 13, wherein the polyadenylation signal is a bovine growth hormone polyadenylation signal.
  • Embodiment 15 The method of any one of Embodiments 1-14, wherein administration of the polynucleotide comprises administering a vector comprising the polynucleotide.
  • Embodiment 16 The method of Embodiment 15, wherein the vector is packaged into viral particles comprising one or more of wild-type capsid proteins, mutated capsid proteins, tissue tropic capsid proteins, or modified capsid proteins, wherein the modified capsid protein has altered tropism compared to a wild-type capsid protein.
  • Embodiment 17 The method of Embodiment 15, wherein the vector further comprises at least one adeno-associated virus (AAV) inverted terminal repeat (ITR).
  • Embodiment 18 The method of Embodiment 17, wherein the vector comprises two AAV ITRs.
  • AAV adeno-associated virus
  • Embodiment 19 The method of Embodiment 18, wherein the two AAV ITRs have the same nucleotide sequence.
  • Embodiment 20 The method of Embodiment 18, wherein the two AAV ITRs have different nucleotide sequences.
  • Embodiment 21 The method of Embodiment 19 and 20, wherein the AAV ITRs are AAV2 ITRs.
  • Embodiment 22 The method of any one of Embodiments 16-21, wherein the viral vector is self-complementary AAV genome.
  • Embodiment 23 The method of any one of Embodiments 15-22, wherein the vector comprises a polynucleotide comprising an enhancer, a promoter, an intron, a human CLN1 open reading frame, and a polyadenylation site.
  • Embodiment 24 The method of any one of Embodiments 15-22, wherein the vector comprises a polynucleotide comprising an AAV ITR, an enhancer, a promoter, an intron, a human CLN1 open reading frame, a polyadenylation site, and an AAV ITR.
  • Embodiment 25 The method of any one of Embodiment 15-22, wherein the vector comprises a polynucleotide comprising a CMV enhancer, a chicken beta actin promoter, a hybrid/modified MVM intron, a human CLN1 open reading frame, and a bovine growth hormone polyadenylation site.
  • the vector comprises a polynucleotide comprising a CMV enhancer, a chicken beta actin promoter, a hybrid/modified MVM intron, a human CLN1 open reading frame, and a bovine growth hormone polyadenylation site.
  • Embodiment 26 The method of any one of Embodiments 15-22, wherein the vector comprises a polynucleotide comprising a mutant AAV ITR, a CMV enhancer, a chicken beta actin promoter, a hybrid/modified MVM intron, a human CLN1 open reading frame, a bovine growth hormone polyadenylation site, and a wild-type AAV ITR.
  • the vector comprises a polynucleotide comprising a mutant AAV ITR, a CMV enhancer, a chicken beta actin promoter, a hybrid/modified MVM intron, a human CLN1 open reading frame, a bovine growth hormone polyadenylation site, and a wild-type AAV ITR.
  • Embodiment 27 The method of any one of Embodiments 1-26, wherein the polynucleotide is administered in an amount to express functional CLN1 in the subject.
  • Embodiment 28 The method of Embodiment 27, wherein the polynucleotide is administered in an amount for an extended expression of the functional CLN1 in the subject.
  • Embodiment 29 The method of any one of Embodiments 1-28, wherein the amount administered intrathecally is the same or different than the amount delivered intravenously.
  • Embodiment 30 The method of any of Embodiments 1-29, wherein the polynucleotide is administered intrathecally to the subject pre-symptom.
  • Embodiment 31 The method of any one of Embodiments 15-30, wherein the amount of vector for intrathecal administration is from about l.OxlO 14 vg to about l.OxlO 15 vg. .
  • Embodiment 32 The method of any one of Embodiments 15-31, wherein the amount of vector for intravenous administration is from about l.OxlO 13 vg/kg to about 2.0xl0 14 vg/kg.
  • Embodiment 33 The method of any one of Embodiments 1-32, wherein the intrathecal administration and the intravenous administration are performed post-symptom onset.
  • Embodiment 34 The method of any one of Embodiments 1-32, wherein the intrathecal administration and the intravenous administration are performed pre-symptom onset.
  • Embodiment 35 The method of any one of Embodiments 1-34, wherein the disorder is infantile, late-infantile, juvenile, or adult-onset neuronal ceroid lipofuscinosis.
  • Embodiment 36 The method of any one of Embodiments 15-35, wherein the vector is an AAV vector.
  • Embodiment 37 The method of Embodiment 37, wherein the AAV vector is an AAV9 vector.
  • Embodiment 38 The method of Embodiment 36 or 37, wherein the AAV vector is encapsidated in a wild-type capsid protein.
  • Embodiment 39 The vector of Embodiment 36 or 37, wherein the AAV vector is encapsidated in a modified capsid protein with altered tropism compared to a wild-type capsid protein.
  • Embodiment 40 The method of Embodiment 49, wherein the modified capsid protein is liver-detargeted.
  • Embodiment 41 A kit comprising a pharmaceutical composition comprising the CLN polynucleotide in a pharmaceutically acceptable carrier and instructions for use in the methods of any one of Embodiments 1-40.
  • An AAV vector genome cassette was developed to express a PPT1 protein encoded by a CLN1 ORF. This cassette was designed to provide maximal expression from a self
  • the cassette comprises, in 5’ to 3’ orientation: mutant AAV2 ITR, CMV enhancer, chicken beta actin promoter, hybrid/modified MVM intron, codon optimized human CLN1 ORF, bovine growth hormone polyadenylation site, and wild-type (WT) AAV2 ITR (FIG. 1).
  • the expression of CLN1 was verified by transfecting the expression cassette into HEK293 cells and the expressed protein was detected in the cells and media by Western blot.
  • CLN1 expression cassette was packaged within a wild-type AAV9 capsid and the resulting AAV viral particle was used to dose CLN1 knockout mice intrathecally and/or intravenously.
  • FIG. 2 shows serum enzyme activity of PPT1 in mice administered scAAV9/CLNl therapy.
  • the vector was injected intrathecally into wild-type, heterologous and CLN1 knockout mice at doses of 7xl0 10 or 7xlO u vector genomes, or intravenously at a dose of 7xlO u vector genomes.
  • Vectors were administered at 20 weeks.
  • PPT1 serum enzyme activity was measured at 4 weeks, 8 weeks, and 17-37 weeks post treatment. Supraphysiological PPT1 serum enzyme activity levels were observed at all time points and dosages.
  • AAV viral particles expressing PPT1 protein were prepared as described in Example 1 and tested for their effect on the life span of CLN1 knockout mice when administered intrathecally and/or intravenously.
  • FIGs. 3A-3B show the lifespan of CLN1 knockout mice intrathecal administered with scAAV9/CLNl. Shaded area shows survival range for untreated heterologous mice.
  • various doses of vector genomes were at 1, 4, and 12 weeks, before the onset of symptom.
  • the results showed that intrathecal administration of scAAV9/CLNl dose-dependently prolongs survival when given at an early age.
  • the vector was injected intrathecally into CLN1 knockout mice at doses of 7xl0 10 or 7xlO u vector genomes at 20 or 26 weeks, after the onset of symptom.
  • FIGs. 4A-5B show the lifespan of CLN1 knockout mice that received various doses of scAAV9/CLNl via intrathecal, intravenous, or combined intrathecal and intravenous administration. Shaded area shows survival range for untreated heterologous mice.
  • FIGs. 4B and 5B show that for CLN1 knockout mice that received scAAV9/CLNl at 20 weeks (post-symptom onset), the combined intrathecal and intravenous administration offered significantly larger survival benefit as compared to intrathecal or intravenous administration only.
  • AAV viral particles expressing PPT1 protein were prepared as described in Example 1.
  • mice In a test of swimming ability, mice (heterologous untreated, knockout untreated, knockout treated with various doses of vector at 4 or 20 weeks) were placed in a Morris Water Maze consisting of a 122 cm diameter pool filled with 45 cm deep water located in a room with numerous visual cues. Each mouse was given 4 trials per day, across 2-3 days, to swim to an escape platform cued by a patterned cylinder extending above the surface of the water. For each trial, the mouse was placed in the pool at 1 of 4 possible locations (randomly ordered), and then given 60 seconds to find the visible platform. If the mouse found the platform, the trial ended, and the animal was allowed to remain 10 seconds on the platform before the next trial began.
  • FIGs. 6A-6B show the results. Notably, among knockout mice treated with vector at 20 weeks, those that received the combined intrathecal and intravenous administration of vector displayed significantly slower disease progression, and largely maintained swim speed beyond 52-week age (FIG. 6B), at which point most of the knockout mice that received only intrathecal or only intravenous administration of vector had died.
  • FIGs. 7A-7B show the results. Notably, among knockout mice treated with vector at 20 weeks, those that received combined intrathecal and intravenous administration of vector displayed significantly slower strength loss and performed better on these tasks than the knockout mice that received only intrathecal or only intravenous administration of vector (FIG. 7B).
  • FIG. 8 shows normalized physical capacity score (PSC) vs relative survival time for various mouse treatment groups.
  • PSC was derived from the area under the curve (splines approximation) for the within-treatment averages across time, normalized to heterologous mice at 1.
  • PSC combined data from weight accelerating rotarod, and wirehang. Median survival for heterologous mice was set to 712 days. The results showed a strong correlation between the relative survival time and the relative physical capacity of mice.
  • PPT1 enzyme activities were also measured in different tissues of rats treated with scAAV9/CLNl vector. Rats were treated with either vehicle control or scAAV9/CLNl vector according to doses and administration routes indicated in FIG. 10. The results show that rats treated with scAAV9/CLNl vector displayed sustained supraphysiological levels of PPT1 enzyme activity across tissues.
  • FIG. 12 shows a diagram of symptom development in mice treated with
  • scAAV9/CLNl vector at different time points (1, 4, 12, 20, and 26 weeks) and via different administration routes (intrathecal or intrathecal+intravenous combo). Shaded area shows survival range for untreated heterologous mice.
  • early treatment with scAAV9/CLNl vector provided higher benefit, however, the combined intrathecal and intravenous administration provided significantly higher benefit than intrathecal administration alone when the treatment was administered at a later time point (e.g., 20 weeks).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Organic Chemistry (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Molecular Biology (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Pain & Pain Management (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Virology (AREA)
  • Biochemistry (AREA)
  • Dermatology (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2020/030427 2019-04-29 2020-04-29 Intrathecal and intravenous combination gene therapy for the treatment of infantile batten disease Ceased WO2020223322A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
KR1020217038864A KR20220046513A (ko) 2019-04-29 2020-04-29 유아 바텐병의 치료를 위한 척수강내 및 정맥내 조합 유전자 요법
EP20798198.6A EP3963081A4 (en) 2019-04-29 2020-04-29 COMBINED INTRATHECAL AND INTRAVENOUS GENE THERAPY FOR THE TREATMENT OF JUVENILE BATTEN'S DISEASE
SG11202111908XA SG11202111908XA (en) 2019-04-29 2020-04-29 Intrathecal and intravenous combination gene therapy for the treatment of infantile batten disease
CN202080047719.4A CN114269935A (zh) 2019-04-29 2020-04-29 用于治疗婴儿贝敦氏病的鞘内和静脉内组合基因疗法
AU2020264438A AU2020264438A1 (en) 2019-04-29 2020-04-29 Intrathecal and intravenous combination gene therapy for the treatment of infantile batten disease
BR112021021632A BR112021021632A8 (pt) 2019-04-29 2020-04-29 Terapia de gene de combinação intratecal e intravenosa para o tratamento da doença de batten infantil
US17/607,315 US20220193268A1 (en) 2019-04-29 2020-04-29 Intrathecal and intravenous combination gene therapy for the treatment of infantile batten disease
MX2021013275A MX2021013275A (es) 2019-04-29 2020-04-29 Terapia genica intratecal e intravenosa para el tratamiento de la enfermedad de batten infantil.
JP2021564486A JP7788594B2 (ja) 2019-04-29 2020-04-29 乳児バッテン病の治療のための髄腔内および静脈内組合せ遺伝子療法
CA3138274A CA3138274A1 (en) 2019-04-29 2020-04-29 Intrathecal and intravenous combination gene therapy for the treatment of infantile batten disease
IL287608A IL287608A (en) 2019-04-29 2021-10-27 Intrathecal and intravenous combination gene therapy for the treatment of infantile batten disease

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962840360P 2019-04-29 2019-04-29
US62/840,360 2019-04-29

Publications (1)

Publication Number Publication Date
WO2020223322A1 true WO2020223322A1 (en) 2020-11-05

Family

ID=73029200

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/030427 Ceased WO2020223322A1 (en) 2019-04-29 2020-04-29 Intrathecal and intravenous combination gene therapy for the treatment of infantile batten disease

Country Status (12)

Country Link
US (1) US20220193268A1 (cg-RX-API-DMAC7.html)
EP (1) EP3963081A4 (cg-RX-API-DMAC7.html)
JP (1) JP7788594B2 (cg-RX-API-DMAC7.html)
KR (1) KR20220046513A (cg-RX-API-DMAC7.html)
CN (1) CN114269935A (cg-RX-API-DMAC7.html)
AU (1) AU2020264438A1 (cg-RX-API-DMAC7.html)
BR (1) BR112021021632A8 (cg-RX-API-DMAC7.html)
CA (1) CA3138274A1 (cg-RX-API-DMAC7.html)
IL (1) IL287608A (cg-RX-API-DMAC7.html)
MX (1) MX2021013275A (cg-RX-API-DMAC7.html)
SG (1) SG11202111908XA (cg-RX-API-DMAC7.html)
WO (1) WO2020223322A1 (cg-RX-API-DMAC7.html)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024011115A1 (en) * 2022-07-06 2024-01-11 Research Institute At Nationwide Children's Hospital Adeno-associated virus delivery of cln1 polynucleotide
EP4555097A4 (en) * 2022-07-12 2026-04-29 The Res Institute At Nationwide Childrens Hospital PRODUCTS AND PROCESSES OF ADENO-ASSOCIATED VIRUS GENE THERAPY

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130195800A1 (en) * 2010-03-23 2013-08-01 Intrexon Corporation Vectors Conditionally Expressing Therapeutic Proteins, Host Cells Comprising the Vectors, and Uses Thereof
WO2017218450A1 (en) * 2016-06-13 2017-12-21 The University Of North Carolina At Chapel Hill Optimized cln1 genes and expression cassettes and their use

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016100575A1 (en) * 2014-12-16 2016-06-23 Board Of Regents Of The University Of Nebraska Gene therapy for juvenile batten disease
WO2019011817A1 (en) * 2017-07-08 2019-01-17 Genethon TREATMENT OF SPINAL AMYOTROPHY
WO2019046815A1 (en) * 2017-08-31 2019-03-07 Poseida Therapeutics, Inc. TRANSPOSON SYSTEM AND METHODS OF USE

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130195800A1 (en) * 2010-03-23 2013-08-01 Intrexon Corporation Vectors Conditionally Expressing Therapeutic Proteins, Host Cells Comprising the Vectors, and Uses Thereof
WO2017218450A1 (en) * 2016-06-13 2017-12-21 The University Of North Carolina At Chapel Hill Optimized cln1 genes and expression cassettes and their use

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024011115A1 (en) * 2022-07-06 2024-01-11 Research Institute At Nationwide Children's Hospital Adeno-associated virus delivery of cln1 polynucleotide
EP4555097A4 (en) * 2022-07-12 2026-04-29 The Res Institute At Nationwide Childrens Hospital PRODUCTS AND PROCESSES OF ADENO-ASSOCIATED VIRUS GENE THERAPY

Also Published As

Publication number Publication date
CN114269935A (zh) 2022-04-01
MX2021013275A (es) 2022-03-17
KR20220046513A (ko) 2022-04-14
SG11202111908XA (en) 2021-11-29
JP7788594B2 (ja) 2025-12-19
AU2020264438A1 (en) 2021-12-16
BR112021021632A2 (cg-RX-API-DMAC7.html) 2021-12-21
US20220193268A1 (en) 2022-06-23
IL287608A (en) 2021-12-01
BR112021021632A8 (pt) 2022-06-28
EP3963081A4 (en) 2023-07-26
EP3963081A1 (en) 2022-03-09
JP2022530264A (ja) 2022-06-28
CA3138274A1 (en) 2020-11-05

Similar Documents

Publication Publication Date Title
JP2019525758A (ja) 新規アデノ随伴ウイルスキャプシドタンパク質
JP2022547197A (ja) アデノ随伴ウイルス(aav)の生体内分布の変更に向けた、aavとaav受容体(aavr)との間の相互作用を調節するための方法および組成物
US12077772B2 (en) Transgene cassettes, AAV vectors and AAV viral vectors for the expression of human codon-optimized SLC6A1
US20230287458A1 (en) Recombinant adeno-associated viral vectors for multipartite gene delivery
JP2025004107A (ja) ガラクトース血症の処置のための遺伝子治療
US20240269161A1 (en) Methods and compositions for tau reduction gene therapy
US12534741B2 (en) Compositions and methods for treatment of neurological disorders
US20250283111A1 (en) Recombinant adeno-associated viral vector for gene delivery
JP7788594B2 (ja) 乳児バッテン病の治療のための髄腔内および静脈内組合せ遺伝子療法
EP4188404A1 (en) Transgene cassettes, aav vectors, and aav viral vectors for expression of human codon-optimized cstb
WO2024220719A1 (en) Modified aav capsids for gene delivery
US20240318198A1 (en) Gene therapy for angelman syndrome
WO2023081683A1 (en) Gene therapy for prader willi syndrome
WO2024163335A2 (en) Pten gene therapy vectors and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20798198

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3138274

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021564486

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021021632

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2020264438

Country of ref document: AU

Date of ref document: 20200429

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112021021632

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20211028

ENP Entry into the national phase

Ref document number: 2020798198

Country of ref document: EP

Effective date: 20211129