WO2020163225A1 - Anti-cd228 antibodies and antibody-drug conjugates - Google Patents
Anti-cd228 antibodies and antibody-drug conjugates Download PDFInfo
- Publication number
- WO2020163225A1 WO2020163225A1 PCT/US2020/016381 US2020016381W WO2020163225A1 WO 2020163225 A1 WO2020163225 A1 WO 2020163225A1 US 2020016381 W US2020016381 W US 2020016381W WO 2020163225 A1 WO2020163225 A1 WO 2020163225A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- cancer
- antigen
- binding fragment
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C*(CC(C)(C)COc1c(*)cc(C(N(CC2)C=C2c2ccc(C)cc2)=O)c([N-][N+](C)=N)c1)COc(c(OC)c1)cc(N=C[C@](C2)N3C=C2c(cc2)ccc2N)c1C3=O Chemical compound C*(CC(C)(C)COc1c(*)cc(C(N(CC2)C=C2c2ccc(C)cc2)=O)c([N-][N+](C)=N)c1)COc(c(OC)c1)cc(N=C[C@](C2)N3C=C2c(cc2)ccc2N)c1C3=O 0.000 description 2
- FULQVJGBONWPHP-KYHHOPLUSA-N CC(C([C@H]1C=CC=CC1)OC)N Chemical compound CC(C([C@H]1C=CC=CC1)OC)N FULQVJGBONWPHP-KYHHOPLUSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39566—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against immunoglobulins, e.g. anti-idiotypic antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68031—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68035—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a pyrrolobenzodiazepine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6843—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6883—Polymer-drug antibody conjugates, e.g. mitomycin-dextran-Ab; DNA-polylysine-antibody complex or conjugate used for therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6889—Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to novel anti-CD228 antibodies and antibody-drug conjugates and methods of using such anti-CD228 antibodies and antibody-drug conjugates to treat cancer.
- CD228, which is also known as melanotransferrin, MELTF, p97 and MF12, is a glycosylphosphatidylinositol-anchored glycoprotein and was first identified as a 97-kDa cell- surface marker for malignant melanoma cells.
- CD228 is overexpressed on a majority of clinical melanoma isolates and is also observed on many human carcinomas. CD228 has been shown to be expressed in a variety of cancers.
- CD228 belongs to the transferrin family of iron-binding proteins.
- Melanoma also known as malignant melanoma, is a type of cancer that develops from melanocytes, which are pigment-containing cells. Melanoma is the most dangerous type of skin cancer. In 2015, were 3.1 million people with active disease and melanoma resulted in 59,800 deaths. Surgery can be effective for early stage melanoma, but may not be a treatment option for disease that has metastasized to distant organs. Melanomas that spread often do so to the lymph nodes in the area before spreading elsewhere. Attempts to improve survival by removing lymph nodes surgically were associated with many complications, but no overall survival benefit.
- an isolated anti-CD228 antibody, or antigen-binding fragment thereof, comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises:
- the light chain variable region comprises:
- a CDR-L3 comprising the amino acid sequence of SEQ ID NO:6.
- the antibody is humanized.
- a humanized anti-CD228 antibody or antigen-binding fragment thereof, comprising a heavy chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 7 provided that position H27 is occupied by D, position H30 is occupied by T, position H47 is occupied by Y, position H71 is occupied by R, and position H78 is occupied by Y, and a light chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO: 8, provided that position L2 is occupied by F, position L36 is occupied by Y and position L46 is occupied by L.
- position L28 is occupied by D.
- a humanized anti-CD228 antibody, or antigen-binding fragment thereof comprising a heavy chain variable region comprising the three Kabat CDRs of SEQ ID NO: 7, wherein position H27 is occupied by D, position H30 is occupied by T, position H47 is occupied by Y, position H71 is occupied by R, and position H78 is occupied by Y, and a light chain variable region comprising the three Kabat CDRs of SEQ ID NO: 8, wherein position L2 is occupied by F, position L36 is occupied by Y and position L46 is occupied by L.
- the heavy chain variable region comprises an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 7 and the light chain variable region comprises an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 8.
- the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 7 and the light chain variable region comprises the amino acid sequence of SEQ ID NO: 8.
- the antibody or antigen-binding fragment is an antigen-binding fragment. In some of any of the embodiments herein, the antibody or antigen binding fragment is a full-length antibody.
- an antibody-drug conjugate comprising the antibody or antigen-binding fragment provided herein conjugated to a cytotoxic or cytostatic agent.
- the linker is a MDpr-PEG(12)-gluc linker.
- the cytotoxic or cytostatic agent is a monomethyl auristatin.
- the monomethyl auristatin is monomethyl auristatin E (MMAE).
- MMAE monomethyl auristatin E
- the he linker is attached to monomethyl auristatin E forming an antibody- drug conjugate having the structure:
- Ab is the antibody hL49, n is 12, R PR is hydrogen, R 21 is CH3, and p denotes a number from 1 to 16.
- the antibody-drug conjugate is hL49- MDpr-PEG( 12)-gluc-MMAE.
- nucleic acid encoding the heavy chain variable region and/or the light chain variable region of an antibody described herein.
- a vector comprising a nucleic acid provided herein.
- a host cell comprising a nucleic acid provided herein.
- Also provided herein is a method of producing an anti-CD228 antibody or antigen binding fragment provided herein, comprising culturing a host cell provided herein under a condition suitable for production of the anti- CD228 antibody or antigen-binding fragment thereof.
- Also provided herein is a method of producing an anti- CD228 antibody-drug conjugate provided herein, comprising culturing a host cell provided herein under a condition suitable for production of an anti-CD228 antibody; isolating the anti-CD228 antibody produced from the host cell; and conjugating the anti-CD228 antibody to a cytotoxic or cytostatic agent.
- a method of treating cancer in a subject comprising administering to the subject an antibody or antigen-binding fragment provided herein or an antibody-drug conjugate provided herein.
- the cancer is selected from the group consisting of melanoma, pancreatic cancer, mesothelioma, colorectal cancer, lung cancer, thyroid cancer, breast cancer, choliangiocarcinoma, esophageal cancer and head and neck cancer.
- the subject is a human.
- kits comprising: (a) an antibody or antigen-binding fragment provided herein or an antibody-drug conjugate provided herein; and (b) instructions for using the antibody or antigen-binding fragment or antibody-drug conjugate according to a method provided herein.
- composition comprising an antibody or antigen-binding fragment provided herein or an antibody-drug conjugate provided herein and one or more agents selected from the group consisting of a physiologically acceptable carrier, a diluent, an excipient and an auxiliary.
- FIG. 1 shows an analysis of CD228 protein expression by IHC on melanoma cancer patient samples.
- FIG. 2 shows an analysis of CD228 protein expression by IHC on mesothelioma cancer patient samples.
- FIG. 3 shows an analysis of CD228 protein expression by IHC on colorectal cancer patient samples.
- FIG. 4 shows an analysis of CD228 protein expression by IHC on breast cancer patient samples.
- Upper panel shows an analysis of CD228 protein expression by IHC on triple negative breast cancer patient samples.
- Fower panel an analysis of CD228 protein expression by IHC on Her2-HR+ breast cancer patient samples.
- FIG. 5 shows an analysis of CD228 protein expression by IHC on pancreatic cancer patient samples.
- FIG. 6 shows an analysis of CD228 protein expression by IHC on non-small cell lung cancer patient samples.
- Upper panel shows an analysis of CD228 protein expression by IHC on squamous NSCLC cancer patient samples.
- Lower panel shows an analysis of CD228 protein expression by IHC on adenocarcinoma NSCLC cancer patient samples.
- FIG. 7 shows a comparison of the percent of patient samples that are positive for CD228 expression as determined by IHC and by RNA levels as reported by The Cancer Genome Atlas for various tumor types.
- FIG. 8 shows an alignment of the heavy chain variable region amino acid sequences of the parental murine anti-CD228 monoclonal antibody (referred to as Mu L49 vH (SEQ ID NO: 21)) with the human acceptor sequence (referred to as Hu IGHV4-59/HJ4 (SEQ ID NO:
- hvHA SEQ ID NO: 7
- hvHB SEQ ID NO: 24
- hvHC SEQ ID NO: 25
- FIG. 9 shows an alignment of the heavy chain variable region amino acid sequences of humanized versions of the L49 antibody (referred to as hvHA (SEQ ID NO: 7), hvHB (SEQ ID NO: 24) and hvHC (SEQ ID NO: 25)).
- the CDR positions are designated using both the Kabat and IMGT numbering schemes.
- FIG. 10 shows an alignment of the light chain variable region amino acid sequences of the parental murine anti-CD228 monoclonal antibody (referred to as Mu L49 vL (SEQ ID NO: 31)) with the human acceptor sequence (referred to as Hu IGKV2-30/KJ2 (SEQ ID NO:
- hvLA SEQ ID NO: 33
- hvLB SEQ ID NO: 34
- hvLC SEQ ID NO: 35
- FIG. 11 shows an alignment of the light chain variable region amino acid sequences of humanized versions of the L49 antibody (referred to as hvLA (SEQ ID NO: 33), hvLB (SEQ ID NO: 34) and hvLC (SEQ ID NO: 35)).
- the CDR positions are designated using both the Kabat and IMGT numbering schemes.
- FIG. 12A-12F shows the results of competition binding studies of recombinant humanized anti-CD228 antibodies, the parental murine antibody (referred to as mL49), and a chimeric antibody (cL49ec).
- FIG. 13 shows results of saturation binding studies for recombinant humanized anti- CD228 antibodies.
- FIG. 14A-14C shows the percent of viable cells over time in A2058, A375 and Colo- 853 cell lines treated with hL49-MC-val-cit-PAB-MMAE (4), hL49-MP-gluc-MMAE (4), and hL49-MP-gluc-MMAE (8).
- FIG. 15 shows A2058 tumor volumes over time for untreated mice and mice treated with 3 mg/kg hL49-HALC, hL49-HALC-Auristatin T (8), hL49-HALC-Lipophillic MMAF (8), hL49-HALC-Tubulysin M (8), and hL49-HALC-MDpr-PEG(12)-gluc-MMAE (8).
- FIG. 16 shows A2058 tumor volumes over time for untreated mice and mice treated with 6 mg/kg IgG-MDpr-gluc-MMAE (2), 6 mg/kg hL49ec-MDpr-gluc-MMAE (2), 3 mg/kg hL49ec-MDpr-gluc-MMAE (2), 1 mg/kg hL49ec-MDpr-gluc-MMAE (2), 3 mg/kg IgG-MDpr- gluc-MMAE (4), 3 mg/kg hL49-MDpr-gluc-MMAE (4), and 3 mg/kg hL49- MDpr-gluc-MMAE (8) ⁇
- FIG. 17 shows A2058 tumor volumes over time for untreated mice and mice treated with 1 mg/kg hL49-MC-val-cit-PAB-MMAE (4), 3 mg/kg hL49-MC-val-cit-PAB-MMAE (4), 1 mg/kg hL49-MDpr-gluc-MMAE (8), and 3 mg/kg hL49-MDpr-gluc-MMAE (8).
- FIG. 18 shows Colo-853 tumor volumes over time for untreated mice and mice treated with 1 mg/kg hL49-MC-val-cit-PAB-MMAE (4), 3 mg/kg hL49-MC-val-cit-PAB- MMAE (4), 1 mg/kg hL49-MDpr-gluc-MMAE (8), and 3 mg/kg hL49-MDpr-gluc-MMAE (8).
- FIG. 19 shows A2058 tumor volumes over time for untreated mice and mice treated with 3 mg/kg IgG-MDpr-PEG(12)-gluc-MMAE (8), 3 mg/kg IgG-Tubulysin M (8), 1 mg/kg or 3 mg/kg hL49-Tubulysin M (8), or 1 mg/kg or 3 mg/kg hL49-MDpr-PEG(12)-gluc-MMAE (8).
- FIG. 20 shows SK-MEL-5 tumor volumes over time for untreated mice and mice treated with 3 mg/kg IgG-MDpr-PEG(12)-gluc-MMAE (8), 3 mg/kg IgG-Tubulysin M (8), 0.3 mg/kg, 1 mg/kg, or 3 mg/kg hL49-Tubulysin M (8), or 0.3 mg/kg, 1 mg/kg or 3 mg/kg hL49- MDpr-PEG( 12) -gluc-MMAE (8) [0039] FIG.
- mice 21 shows IGR-37 tumor volumes over time for untreated mice and mice treated with 1 mg/kg or 3 mg/kg hL49-Tubulysin M (8), or 1 mg/kg or 3 mg/kg hL49-MDpr-PEG(12)- gluc-MMAE (8).
- FIG. 22 shows Colo-853 tumor volumes over time for untreated mice and mice treated with 0.3, 1 mg/kg or 3 mg/kg hL49-MDpr-PEG(12)-gluc-MMAE (8), or 3 mg/kg IgG- MDpr-PEG( 12) -gluc-MMAE (8).
- FIG. 23 shows LU0697 squamous NSCL PDX model tumor volumes over time for untreated mice and mice treated with 1 mg/kg or 3 mg/kg hL49-MDpr-PEG(12)-gluc-MMAE (8), or 3 mg/kg IgG-MDpr-PEG(12)-gluc-MMAE (8).
- FIG. 24 shows LU0697 adenocarcinoma NSCL PDX model tumor volumes over time for untreated mice and mice treated with 1 mg/kg or 3 mg/kg hL49-MDpr-PEG(12)-gluc-MMAE (8), or 3 mg/kg IgG-MDpr-PEG(12)-gluc-MMAE (8).
- FIG. 25 shows MDA-MB-231 TNBC tumor volumes over time for untreated mice and mice treated with 0.5 mg/kg or 1 mg/kg hL49-MDpr-PEG(12)-gluc-MMAE (8), or 0.5 mg/kg or 1 mg/kg IgG-MDpr-PEG(12)-gluc-MMAE (8).
- FIG. 26 shows HPAF-II tumor volumes over time for untreated mice and mice treated with 3 mg/kg IgGhL49-MDpr-PEG(12)-gluc-MMAE (8), or 0.3 mg/kg, 1 mg/kg or 3 mg/kg hL49-MDpr-PEG( 12)-gluc-MMAE (8).
- FIG. 27 shows the percent change in tumor volume in response to treatment with hL49-MDpr-PEG(12)-gluc-MMAE (8) in 22 different mouse PDX models of triple- negative breast cancer.
- FIG. 28 A-28B shows the % specific lysis (ADCC activity) of hL49 and another CD228 antibody, cL235, alone or conjugated to MDpr-PEG(12)-gluc-MMAE for two patients.
- FIG. 29 A shows the plasma concentrations of the ADC over time in nude mice.
- FIG. 29B shows the plasma concentrations of the ADC over time in rats.
- FIG. 30A shows A2058 tumor volumes over time for untreated mice and mice treated with various CD228 antibodies.
- FIG. 30B shows the percent of animals with ⁇ 4-fold tumor increase over time for each treatment condition.
- FIG. 31 A-31B shows the rate of conjugate cleavage over time in A375 and Colo-853 cells.
- FIG. 32 shows that CD228 is replenished on the cell surface over time by comparing the rates of conjugate cleavage over time in cells treated with fluorescently labeled hL49 antibodies using either a pulse or continuous treatment of labeled antibody.
- FIG. 33A-33B shows the average fluorescence intensity per cell over time in cells incubated with fluorescently labeled hL49 antibodies in the presence or absence of
- FIG. 34A-34F shows binding of various anti-CD228 antibodies to CD228 at pH values ranging from 4 to 7.4.
- FIG. 35A-35B shows the ability of antibodies with similar binding affinities to internalize and catabolize drug.
- FIG. 36A-36B shows that a single dose of hL49-MDpr-PEG(12)-gluc-MMAE (8) has anti-tumor activity in patient derived tumor (PDX) models.
- CD228 “p97,”“melanotransferrm,”“MELTF,” and“MF12” are used interchangeably herein, and, unless specified otherwise, include any variants, isoforms and species homologs of human CD228 which are generally expressed by cells or expressed on cells transfected with the CD228 gene.
- immunoglobulin refers to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) low molecular weight chains and one pair of heavy (H) chains, all four inter-connected by disulfide bonds.
- L light
- H heavy
- each heavy chain typically is comprised of a heavy chain variable region (abbreviated herein as VH or VH) and a heavy chain constant region (CH or CH).
- VH or VH heavy chain variable region
- CH heavy chain constant region
- the heavy chain constant region typically is comprised of three domains, CHI , CH2, and CH3.
- the heavy chains are generally inter-connected via disulfide bonds in the so-called“hinge region.”
- Each light chain typically is comprised of a light chain variable region (abbreviated herein as VL or VL) and a light chain constant region (CL or CL).
- the light chain constant region typically is comprised of one domain, CL.
- the CL can be of k (kappa) or l (lambda) isotype.
- the terms“constant domain” and“constant region” are used interchangeably herein.
- An immunoglobulin can derive from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG, and IgM.
- IgG subclasses are also well known to those in the art and include but are not limited to human IgGl, IgG2, IgG3 and IgG4.
- immunotype refers to the antibody class or subclass (e.g ., IgM or IgGl) that is encoded by the heavy chain constant region genes.
- variable region or“variable domain” refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen.
- the variable regions of the heavy chain and light chain (VH and VL, respectively) of a native antibody may be further subdivided into regions of hypervariability (or hypervariable regions, which may be
- CDRs complementarity-determining regions
- FRs framework regions
- FR-H1, FR-H2, FR-H3, and FR-H4 there are four FRs in each full-length heavy chain variable region
- FR-L1, FR-L2, FR-L3, and FR-L4 four FRs in each full-length light chain variable region.
- three CDRs and four FRs are typically arranged from amino- terminus to carboxy -terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 ⁇ See also Chothia and Lesk J. Mot. Biol., 195, 901-917 (1987)).
- antibody in the context of the present invention refers to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen under typical physiological conditions with a half-life of significant periods of time, such as at least about 30 min, at least about 45 min, at least about one hour (h), at least about two hours, at least about four hours, at least about eight hours, at least about 12 hours (h), about 24 hours or more, about 48 hours or more, about three, four, five, six, seven or more days, etc., or any other relevant functionally- defined period (such as a time sufficient to induce, promote, enhance, and/or modulate a physiological response associated with antibody binding to the antigen and/or time sufficient for the antibody to recruit an effector activity).
- significant periods of time such as at least about 30 min, at least about 45 min, at least about one hour (h), at least about two hours, at least about four hours, at least about eight hours, at least about 12 hours (h), about
- variable regions of the heavy and light chains of the immunoglobulin molecule contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells) and components of the complement system such as Clq, the first component in the classical pathway of complement activation.
- An antibody may also be a bispecific antibody, diabody, multispecific antibody or similar molecule.
- the term "monoclonal antibody” as used herein refers to a preparation of antibody molecules that are recombinantly produced with a single primary amino acid sequence.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- the term “human monoclonal antibody” refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences.
- the human monoclonal antibodies may be generated by a hybridoma which includes a B cell obtained from a transgenic or
- transchromosomal non-human animal such as a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene, fused to an immortalized cell.
- an "isolated antibody” refers to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g ., an isolated antibody that binds specifically to CD228 is substantially free of antibodies that bind specifically to antigens other than CD228).
- An isolated antibody that binds specifically to CD228 can, however, have cross reactivity to other antigens, such as CD228 molecules from different species.
- an isolated antibody can be substantially free of other cellular material and/or chemicals.
- an isolated antibody includes an antibody conjugate attached to another agent (e.g., small molecule drug).
- an isolated anti- CD228 antibody includes a conjugate of an anti- CD228 antibody with a small molecule drug (e.g., MMAE or MMAF).
- Human antibody refers to an antibody having variable regions in which both the FRs and CDRs are derived from human germline immunoglobulin sequences.
- the constant region also is derived from human germline immunoglobulin sequences.
- the human antibodies of the disclosure can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g ., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- the term "human antibody,” as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- humanized antibody refers to a genetically engineered non-human antibody, which contains human antibody constant domains and non-human variable domains modified to contain a high level of sequence homology to human variable domains.
- a humanized antibody may comprise non-human CDR sequences, primarily human framework regions optionally comprising one or more amino acid back-mutations to the non-human amino acid sequence, and fully human constant regions.
- additional amino acid modifications which are not necessarily back-mutations, may be applied to obtain a humanized antibody with preferred characteristics, such as affinity and biochemical properties.
- chimeric antibody refers to an antibody wherein the variable region is derived from a non-human species (e.g. derived from rodents) and the constant region is derived from a different species, such as human.
- Chimeric antibodies may be generated by antibody engineering.“Antibody engineering” is a term used generic for different kinds of modifications of antibodies, and which is a well-known process for the skilled person.
- a chimeric antibody may be generated by using standard DNA techniques as described in Sambrook et al., 1989, Molecular Cloning: A laboratory Manual, New York: Cold Spring Harbor Laboratory Press, Ch. 15.
- the chimeric antibody may be a genetically or an enzymatically engineered recombinant antibody. It is within the knowledge of the skilled person to generate a chimeric antibody, and thus, generation of the chimeric antibody according to the present invention may be performed by other methods than described herein.
- Chimeric monoclonal antibodies for therapeutic applications are developed to reduce antibody
- immunogenicity may typically contain non-human (e.g. murine) variable regions, which are specific for the antigen of interest, and human constant antibody heavy and light chain domains.
- variable region or“variable domains” as used in the context of chimeric antibodies, refers to a region which comprises the CDRs and framework regions of both the heavy and light chains of the immunoglobulin.
- an anti-antigen antibody refers to an antibody that binds to the antigen.
- an anti-CD228 antibody is an antibody that binds to the antigen CD228.
- an "antigen-binding portion" or antigen-binding fragment” of an antibody refers to one or more fragments of an antibody that retain the ability to bind specifically to the antigen bound by the whole antibody.
- antibody fragments include but are not limited to Fv, Fab, Fab', Fab’-SH, F(ab')2; diabodies; linear antibodies; single chain antibody molecules (e.g. scFv); and multispecific antibodies formed from antibody fragments.
- Papain digestion of antibodies produces two identical antigen-binding fragments, called“Fab” fragments, each with a single antigen-binding site, and a residual“Fc” fragment, whose name reflects its ability to crystallize readily.
- Pepsin treatment yields an F(ab’)2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
- Percent (%) sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- % sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
- binding typically is a binding with an affinity corresponding to a KD of about 10 6 M or less, e.g.
- the amount with which the KD of binding is lower is dependent on the KD of the antibody, so that when the KD of the antibody is very low, then the amount with which the KD of binding to the antigen is lower than the KD of binding to a non-specific antigen may be at least 10,000-fold (that is, the antibody is highly specific).
- KD refers to the dissociation equilibrium constant of a particular antibody-antigen interaction. Affinity, as used herein, and KD are inversely related, that is that higher affinity is intended to refer to lower KD, and lower affinity is intended to refer to higher KD.
- ADC refers to an antibody-drug conjugate, which in the context of the present invention refers to an anti-CD228 antibody, which is coupled to a drug moiety (e.g., MMAE or MMAF) as described in the present application.
- PAB refers to the self-immolative spacer
- a “cancer” refers to a broad group of various diseases characterized by the uncontrolled growth of abnormal cells in the body.
- a “cancer” or “cancer tissue” can include a tumor. Unregulated cell division and growth results in the formation of malignant tumors that invade neighboring tissues and can also metastasize to distant parts of the body through the lymphatic system or bloodstream. Following metastasis, the distal tumors can be said to be "derived from” the pre-metastasis tumor.
- AJDCC antibody-dependent cellular cytotoxicity
- immune cells possessing lytic activity also referred to as effector cells.
- effector cells include natural killer cells, monocytes/' macrophages and neutrophils.
- the effector cells attach to an Fc effector domain(s) of Ig bound to target cells via their antigen-combining sites. Death of the antibody-coated target ceil occurs as a result of effector cell activity
- ADCF antibody-dependent cellular phagocytosis
- complement-dependent cytotoxicity refers to a mechanism for inducing cell death in which an Fc effector domain(s) of a target-bound antibody activates a senes of enzymatic reactions culminating in the formation of holes m the target ceil membrane.
- antigen-antibody complexes such as those on antibody- coaled target cells bind arid activate complement component Clq which in turn activates the complement cascade leading to target cell death.
- Activation of complement may also result in deposition of complement components on the target cell surface that facilitate ADCC by binding complement receptors (e.g., CRB) on leukocytes.
- complement receptors e.g., CRB
- a “cytostatic effect” refers to the inhibition of cell proliferation.
- a “cytostatic agent” refers to an agent that has a cytostatic effect on a cell, thereby inhibiting the growth and/or expansion of a specific subset of cells. Cytostatic agents can be conjugated to an antibody or administered in combination with an antibody
- Treatment refers to any type of intervention or process performed on, or the administration of an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, slowing down, or preventing the onset, progression, development, severity, or recurrence of a symptom, complication, condition, or biochemical indicia associated with a disease.
- the disease is cancer.
- a “subject” includes any human or non-human animal.
- the term “non-human animal” includes, but is not limited to, vertebrates such as non-human primates, sheep, dogs, and rodents such as mice, rats, and guinea pigs. In some embodiments, the subject is a human.
- the terms “subject” and “patient” and“individual” are used interchangeably herein.
- an“effective amount” or “therapeutically effective amount” or “therapeutically effective dosage” of a drug or therapeutic agent is any amount of the drug that, when used alone or in combination with another therapeutic agent, protects a subject against the onset of a disease or promotes disease regression evidenced by a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
- the ability of a therapeutic agent to promote disease regression can be evaluated using a variety of methods known to the skilled practitioner, such as in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or by assaying the activity of the agent in in vitro assays.
- a therapeutically effective amount of an anti-cancer agent inhibits cell growth or tumor growth by at least about 10%, by at least about 20%, by at least about 30%, by at least about 40%, by at least about 50%, by at least about 60%, by at least about 70%, or by at least about 80%, by at least about 90%, by at least about 95%, by at least about 96%, by at least about 97%, by at least about 98%, or by at least about 99% in a treated subject(s) (e.g ., one or more treated subjects) relative to an untreated subject(s) (e.g., one or more untreated subjects).
- a therapeutically effective amount of an anti cancer agent inhibits cell growth or tumor growth by 100% in a treated subject(s) (e.g., one or more treated subjects) relative to an untreated subject(s) (e.g., one or more untreated subjects).
- tumor regression can be observed and continue for a period of at least about 20 days, at least about 30 days, at least about 40 days, at least about 50 days, or at least about 60 days.
- a therapeutically effective amount of a drug includes a "prophy tactically effective amount," which is any amount of the drug that, when administered alone or in combination with an anti-cancer agent to a subject at risk of developing a cancer (e.g ., a subject having a pre-malignant condition) or of suffering a recurrence of cancer, inhibits the development or recurrence of the cancer.
- a proliferatively effective amount is any amount of the drug that, when administered alone or in combination with an anti-cancer agent to a subject at risk of developing a cancer (e.g ., a subject having a pre-malignant condition) or of suffering a recurrence of cancer, inhibits the development or recurrence of the cancer.
- the prophylactically effective amount prevents the development or recurrence of the cancer entirely.
- “Inhibiting" the development or recurrence of a cancer means either lessening the likelihood of the cancer’s development or recurrence, or preventing the
- subtherapeutic dose means a dose of a therapeutic compound (e.g., an anti-CD228 antibody-drug conjugate) that is lower than the usual or typical dose of the therapeutic compound when administered alone for the treatment of a hyperproliferative disease (e.g., cancer).
- a therapeutic compound e.g., an anti-CD228 antibody-drug conjugate
- an "immune-related response pattern” refers to a clinical response pattern often observed in cancer patients treated with immunotherapeutic agents that produce antitumor effects by inducing cancer-specific immune responses or by modifying native immune processes.
- This response pattern is characterized by a beneficial therapeutic effect that follows an initial increase in tumor burden or the appearance of new lesions, which in the evaluation of traditional chemotherapeutic agents would be classified as disease progression and would be synonymous with drug failure. Accordingly, proper evaluation of immunotherapeutic agents can require long term monitoring of the effects of these agents on the target disease.
- an "anti-cancer agent” promotes cancer regression in a subject.
- a therapeutically effective amount of the drug promotes cancer regression to the point of eliminating the cancer.
- Promote cancer regression means that administering an effective amount of the drug, alone or in combination with an anti-cancer agent, results in a reduction in tumor growth or size, necrosis of the tumor, a decrease in severity of at least one disease symptom, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
- the terms “effective” and “effectiveness” with regard to a treatment includes both pharmacological effectiveness and physiological safety.
- Pharmacological effectiveness refers to the ability of the drug to promote cancer regression in the patient.
- Physiological safety refers to the level of toxicity or other adverse physiological effects at the cellular, organ and/or organism level (adverse effects) resulting from administration of the drug.
- sustained response refers to the sustained effect on reducing tumor growth after cessation of a treatment.
- the tumor size may remain to be the same or smaller as compared to the size at the beginning of the administration phase.
- the sustained response has a duration that is at least the same as the treatment duration, or at least 1.5, 2.0, 2.5, or 3 times longer than the treatment duration.
- complete response or “CR” refers to disappearance of all target lesions
- partial response or “PR” refers to at least a 30% decrease in the sum of the longest diameters (SLD) of target lesions, taking as reference the baseline SLD
- stable disease or “SD” refers to neither sufficient shrinkage of target lesions to qualify for PR, nor sufficient increase to qualify for PD, taking as reference the smallest SLD since the treatment started.
- progression free survival refers to the length of time during and after treatment during which the disease being treated (e.g, cancer) does not get worse. Progression-free survival may include the amount of time patients have experienced a complete response or a partial response, as well as the amount of time patients have experienced stable disease.
- ORR all response rate
- overall survival or“OS” refers to the percentage of individuals in a group who are likely to be alive after a particular duration of time.
- phrases "pharmaceutically acceptable” indicates that the substance or composition must be compatible chemically and/or toxicologically, with the other ingredients comprising a formulation, and/or the mammal being treated therewith.
- Exemplary salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bi sulfate, phosphate, acid phosphate, isonicotmate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentismate, fumarate, gluconate, gluctsronate, saccharate, formate, benzoate, glutamate, metiianesuifonate "mesylate", ethanesulfonate, benzenesulfonate, p-toluenesulfonate, pamoate (f.e., 4,4’-methylene-bis -(2-hydroxy-3-naphthoate)) salts, alkali metal (e.g., sodium and potassium)
- a pharmaceutically acceptable salt may involve the inclusion of another molecule such as an acetate ion, a succinate ion or other counter ion.
- the counter ion may be any organic or inorganic moiety that stabilizes the charge on the parent compound.
- a pharmaceutically acceptable salt may have more than one charged atom in its structure. Instances where multiple charged atoms are part of the pharmaceutically acceptable salt can have multiple counter ions. Hence, a pharmaceutically acceptable salt can have one or more charged atoms and/or one or more counter ion.
- administering refers to the physical introduction of a therapeutic agent to a subject, using any of the various methods and delivery systems known to those skilled in the art.
- exemplary routes of administration for the anti-CD228 antibody-drug conjugate include intravenous, intramuscular, subcutaneous, intraperitoneal, spinal or other parenteral routes of administration, for example by injection or infusion (e.g., intravenous infusion).
- parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion, as well as in vivo electroporation.
- a therapeutic agent can be administered via a non- parenteral route, or orally.
- non-parenteral routes include a topical, epidermal or mucosal route of administration, for example, intranasally, vaginally, rectally, sublingually or topically. Administration can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
- baseline or “baseline value” used interchangeably herein can refer to a measurement or characterization of a symptom before the administration of the therapy (e.g., an anti-CD228 antibody-drug conjugate as described herein) or at the beginning of administration of the therapy.
- the baseline value can be compared to a reference value in order to determine the reduction or improvement of a symptom of a CD228-associated disease contemplated herein ( e.g ., cancer).
- reference or “reference value” used interchangeably herein can refer to a measurement or characterization of a symptom after administration of the therapy (e.g., an anti-CD228 antibody-drug conjugate as described).
- the reference value can be measured one or more times during a dosage regimen or treatment cycle or at the completion of the dosage regimen or treatment cycle.
- a "reference value” can be an absolute value; a relative value; a value that has an upper and/or lower limit; a range of values; an average value; a median value: a mean value; or a value as compared to a baseline value.
- a “baseline value” can be an absolute value; a relative value; a value that has an upper and/or lower limit; a range of values; an average value; a median value; a mean value; or a value as compared to a reference value.
- the reference value and/or baseline value can be obtained from one individual, from two different individuals or from a group of individuals (e.g., a group of two, three, four, five or more individuals).
- the term“monotherapy” as used herein means that the anti-CD228 antibody-drug conjugate is the only anti-cancer agent administered to the subject during the treatment cycle.
- Other therapeutic agents can be administered to the subject.
- anti inflammatory agents or other agents administered to a subject with cancer to treat symptoms associated with cancer, but not the underlying cancer itself, including, for example inflammation, pain, weight loss, and general malaise, can be administered during the period of monotherapy.
- An "adverse event” as used herein is any unfavorable and generally unintended or undesirable sign (including an abnormal laboratory finding), symptom, or disease associated with the use of a medical treatment.
- a medical treatment can have one or more associated AEs and each AE can have the same or different level of severity.
- Reference to methods capable of "altering adverse events” means a treatment regime that decreases the incidence and/or severity of one or more AEs associated with the use of a different treatment regime.
- A“serious adverse event” or“SAE” as used herein is an adverse event that meets one of the following criteria:
- Requires inpatient hospitalization or prolongation of existing hospitalization excluding the following: 1) routine treatment or monitoring of the underlying disease, not associated with any deterioration in condition; 2) elective or pre-planned treatment for a pre-existing condition that is unrelated to the indication under study and has not worsened since signing the informed consent; and 3) social reasons and respite care in the absence of any deterioration in the patient’s general condition.
- the terms "about” or “comprising essentially of' refer to a value or composition that is within an acceptable error range for the particular value or composition as determined by one of ordinary skill in the art, which will depend in part on how the value or composition is measured or determined, i.e., the limitations of the measurement system. For example, “about” or “comprising essentially of' can mean within 1 or more than 1 standard deviation per the practice in the art. Alternatively, “about” or “comprising essentially of' can mean a range of up to 20%. Furthermore, particularly with respect to biological systems or processes, the terms can mean up to an order of magnitude or up to 5 -fold of a value. When particular values or compositions are provided in the application and claims, unless otherwise stated, the meaning of "about” or “comprising essentially of' should be assumed to be within an acceptable error range for that particular value or composition.
- Reference to“about” a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se. For example, description referring to“about X” encompasses and describes“X.”
- any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated.
- the invention provides antibodies that specifically bind CD228.
- the present invention is based, in part, on the discovery that antibody-drug conjugates, including pegylated- MMAE antibody-drug conjugates, targeted to CD228 are particularly effective at killing CD228+ expressing cells.
- CD228 has been shown to be expressed in a variety of cancers, including melanoma, thyroid cancer, lung cancer, liver cancer, pancreatic cancer, head and neck cancer, stomach cancer, colorectal cancer, urothelial cancer, breast cancer and cervical cancer.
- CD228 refers to human CD228.
- An exemplary human protein sequence is assigned UniProt ID NO. P08582.
- the invention provides antibodies, such as humanized antibodies, derived from the mouse antibody L49.
- L49 is a murine immunoglobulin G1 (IgGl) monoclonal antibody against CD228, which was derived from BALB/c mice immunized with lung carcinoma and melanoma cell lines (Siemers et al., 1997, Bioconjug. Chem. 8:510-9).
- the binding affinity of humanized forms of the mouse L49 antibody is preferably within a factor of five or a factor of two of that of the mouse antibody L 9 for human CD228.
- Humanized L49 antibodies specifically bind to human CD228 as does the mouse antibody from which they were derived. These antibodies bind CD228 both in its native form and as reeombinantiy expressed, for example from Chinese hamster ovary (CHO) ceils or Human embryonic kidney (HEK) cells.
- Preferred humanized L49 antibodies have an affinity the same as or greater than (i.e., greater than beyond margin of error in measurement) that of 1.49 for human CD228 (e.g., 1.
- Preferred humanized 1,49 antibodies bind to the same epitope and/or compete with mouse 1,49 for binding to human CD228.
- Preferred antibodies of the invention inhibit cancer (e.g., growth of cells, metastasis and/or lethality to the organisms) as shown on cancerous cells propagating in culture, in an animal model or clinical trial.
- Animal models can be formed by implanting CD228-expressing human tumor ceil lines into appropriate immunodeficient rodent strains, e.g., athymic nude mice or SC1D mice. 'These tumor cell lines can he established in immunodeficient rodent hosts either as solid tumor by subcutaneous injections or as disseminated tumors by intravenous injections.
- tumor models can be applied to evaluate the therapeutic efficacies of the anthCD228 antibodies or conjugated forms thereof as described in the Examples.
- anti-CD228 antibodies and/or anti-CD228 antibody-drug conjugates of the disclosure bind CD228, e.g., human CD228, and exert cytostatic and cytotoxic effects on malignant cells, such as cancer cells.
- Anti-CD228 antibodies of the disclosure are preferably monoclonal, and may be multispecific, human, humanized or chimeric antibodies, single chain antibodies, Fab fragments, F(ab') fragments, fragments produced by a Fab expression library, and CD228 binding fragments of any of the above.
- the anti-CD228 antibodies of the disclosure specifically bind CD228.
- the immunoglobulin molecules of the disclosure can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule.
- the anti-CD228 antibodies are antigen binding fragments (e.g., human antigen-binding fragments) as described herein and include, but are not limited to, Fab, Fab' and F(ab')2, Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv) and fragments comprising either a VL or VH domain.
- Antigen binding fragments, including single-chain antibodies may comprise the variable region(s) alone or in combination with the entirety or a portion of the following: hinge region, CHI, CH2, CH3 and CL domains.
- antigen-binding fragments comprising any combination of variable region(s) with a hinge region, CHI, CH2, CH3 and CL domains.
- the anti-CD228 antibodies or antigen-binding fragments thereof are human, murine (e.g., mouse and rat), donkey, sheep, rabbit, goat, guinea pig, camelid, horse, or chicken.
- the anti-CD228 antibodies of the present disclosure may be monospecific, bispecific, trispecific or of greater multi specificity. Multispecific antibodies may be specific for different epitopes of CD228 or may be specific for both CD228 as well as for a heterologous protein.
- Anti-CD228 antibodies of the present disclosure may be described or specified in terms of the particular CDRs they comprise.
- the precise amino acid sequence boundaries of a given CDR or FR can be readily determined using any of a number of well-known schemes, including those described by Rabat et al. (1991),“Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (“Rabat” numbering scheme); Al-Lazikani et al., (1997) JMB 273,927-948 (“Chothia” numbering scheme); MacCallum et al, J. Mol. Biol.
- a“CDR” or“complementarity determining region,” or individual specified CDRs (e.g., CDR-H1, CDR-H2, CDR-H3), of a given antibody or region thereof (e.g., variable region thereof) should be understood to encompass a (or the specific) CDR as defined by any of the aforementioned schemes.
- a particular CDR e.g., a CDR-H3
- a CDR-H3 contains the amino acid sequence of a corresponding CDR in a given VH or VL region amino acid sequence
- a CDR has a sequence of the corresponding CDR (e.g., CDR-H3) within the variable region, as defined by any of the aforementioned schemes.
- the scheme for identification of a particular CDR or CDRs may be specified, such as the CDR as defined by the Rabat, Chothia, AbM or IMGT method.
- CDR sequences of the anti-CD228 antibodies and of the anti-CD228 antibody-drug conjugates described herein are according to the Kabat numbering scheme as described in Kabat et al. (1991),“Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD.
- an anti-CD228 antibody comprising a heavy chain variable region and a light chain variable region
- the heavy chain variable region comprises (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO: l, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:2, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:3
- the light chain variable region comprises (i) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 4, (ii) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 5, and (iii) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 6, wherein the CDRs of the anti-CD228 antibody are defined by the Kabat numbering scheme.
- an anti-CD228 antibody described herein may comprise any suitable framework variable domain sequence, provided that the antibody retains the ability to bind CD228 (e.g ., human CD228).
- heavy chain framework regions are designated “HC-FR1-FR4”
- light chain framework regions are designated "LC-FR1-FR4.”
- the anti-CD228 antibody comprises a heavy chain variable domain framework sequence of SEQ ID NO:9, 10, 11, and 12 (HC-FR1, HC-FR2, HC-FR3, and HC-FR4, respectively).
- the anti-CD228 antibody comprises a light chain variable domain framework sequence of SEQ ID NO: 13, 14, 15, and 16 (LC-FR1, LC-FR2, LC-FR3, and LC-FR4, respectively).
- the heavy chain variable domain comprises the amino acid sequence of
- the heavy chain CDR sequences comprise the following:
- the heavy chain FR sequences comprise the following:
- HC-FR1 QVQLQESGPGLVKPSETLSLTCTVSGDSIT (SEQ ID NO: 9)
- HC-FR3 RVTISRDTSKNQYSLKLSSVTAADTAVYYCAR (SEQ ID NO: 11)
- HC-FR4 W GQGTLVTV S S (SEQ ID NO: 12)
- the light chain CDR sequences comprise the following:
- the light chain FR sequences comprise the following:
- LC-FR3 GVPDRF S GS GS GTDFTLKISRVEAED V GV YY C (SEQ ID NO: 15)
- LC-FR4 FGQGTKLEIK (SEQ ID NO: 16)
- an anti-CD228 antibody and/or anti-CD228 antibody-drug conjugate that binds to CD228 (e.g ., human CD228), wherein the antibody or antibody-drug conjugate comprises a heavy chain variable region and a light chain variable region, wherein the antibody comprises:
- HC-FR1 comprising the amino acid sequence of SEQ ID NO:9;
- HC-FR4 comprising the amino acid sequence of SEQ ID NO: 12, and/or
- an LC-FR1 comprising the amino acid sequence of SEQ ID NO: 13;
- an anti-CD228 antibody and/or anti-CD228 antibody-drug conjugate comprising a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 7 or comprising a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 8.
- the N-terminal glutamine of the heavy chain variable domain is cyclized to form pyroglutamic acid.
- an anti-CD228 antibody comprising a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 7 and comprising a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 8.
- the N-terminal glutamine of the heavy chain variable domain is cyclized to form pyroglutamic acid.
- an anti-CD228 antibody and/or anti-CD228 antibody-drug conjugate comprising a heavy chain variable domain comprising an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 7.
- the N-terminal glutamine of the heavy chain variable domain is cyclized to form pyroglutamic acid.
- a heavy chain variable domain comprising an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO:7 contains substitutions ( e.g ., conservative substitutions), insertions, or deletions relative to the reference sequence and retains the ability to bind to a CD228 (e.g., human CD228).
- a CD228 e.g., human CD2228
- the anti-CD228 antibody comprises a heavy chain variable domain sequence of SEQ ID NO: 7 including post-translational modifications of that sequence.
- the N- terminal glutamine of the heavy chain variable domain is cyclized to form pyroglutamic acid.
- the heavy chain variable domain comprises one, two or three CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO: l, (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, and (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO:3.
- an anti-CD228 antibody and/or anti-CD228 antibody-drug conjugate comprising a light chain variable domain comprising an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 8.
- a light chain variable domain comprising an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 8 contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence and retains the ability to bind to a CD228 (e.g., human CD228). In certain embodiments, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 8.
- the anti-CD228 antibody comprises a light chain variable domain sequence of SEQ ID NO: 8 including post- translational modifications of that sequence.
- the light chain variable domain comprises one, two or three CDRs selected from: (a) CDR-L1 comprising the amino acid sequence of SEQ ID NO:4, (b) CDR-L2 comprising the amino acid sequence of SEQ ID NO:5, and (c) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 6.
- the anti-CD228 antibody and/or the anti-CD228 antibody-drug conjugate comprises a heavy chain variable domain as in any of the embodiments provided above, and a light chain variable domain as in any of the embodiments provided above.
- the antibody comprises the heavy chain variable domain sequence of SEQ ID NO: 7 and the light chain variable domain sequence of SEQ ID NO: 8, including post-translational modifications of those sequences.
- the N-terminal glutamine of the heavy chain variable domain is cyclized to form pyroglutamic acid.
- the anti-CD228 antibody and/or the anti-CD228 antibody-drug conjugate comprises: i) a heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 1, a heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 2, a heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 3; and ii) a light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 6, wherein the CDRs of the anti-CD228 antibody are defined by the Rabat numbering scheme.
- the anti-CD228 antibody and/or the anti-CD228 antibody-drug conjugate comprises: i) an amino acid sequence having at least 85% sequence identity to a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7, and ii) an amino acid sequence having at least 85% sequence identity to a light chain variable region comprising the amino acid sequence of SEQ ID NO: 8.
- the N-terminal glutamine of the heavy chain variable domain is cyclized to form pyroglutamic acid.
- the anti-CD228 antibody or the anti-CD228 antibody of the anti-CD228 antibody-drug conjugate is a monoclonal antibody.
- Anti-CD228 antibodies of the present invention may also be described or specified in terms of their binding affinity to CD228 (e.g ., human CD228).
- Preferred binding affinities include those with a dissociation constant or KD less than 5 xlO 2 M, 10 2 M, 5x10 3 M, 10 3 M, 5x1 O 4 M, 10 4 M, 5x10 5 M, 10 5 M, 5x1 O 6 M, 10 6 M, 5x1 O 7 M, 10 7 M, 5x10 8 M, 10 8 M, 5x1 O 9 M, 10 9 M, 5xl O 10 M, 10 10 M, 5xl0 n M, 10 11 M, 5xl0 12 M, 10 12 M, 5xlO 13 M, 10 13 M,
- the binding of an anti-CD228 antibody of the present invention is pH dependent, such that the antibody displays differential binding across a pH gradient.
- the anti-CD228 antibody displays maximal binding between a pH of about 5.5 and a pH of about 6.3.
- the anti-CD228 antibody displays maximal binding at a pH of about 5.6.
- the anti-CD228 antibody displays maximal binding at a pH of about 6.3.
- the anti-CD228 antibody displays minimal binding at a pH of about 5.1 or less.
- immunoglobulins There are five classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, having heavy chains designated a, d, e, g and m, respectively.
- the g and a classes are further divided into subclasses e.g., humans express the following subclasses: IgGl, IgG2, IgG3, IgG4, IgAl and IgA2.
- IgGl antibodies can exist in multiple polymorphic variants termed allotypes
- the antibody may comprise a heavy chain Fc region comprising a human IgG Fc region.
- the human IgG Fc region comprises a human IgGl.
- the anti-CD228 antibody and/or the anti-CD228 antibody-drug conjugate comprises a heavy chain variable domain as in any of the embodiments provided above, and a light chain variable domain as in any of the embodiments provided above.
- the antibody comprises a heavy chain constant region comprising the amino acid sequence of
- the antibody comprises a heavy chain constant region comprising the amino acid sequence of ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLS S WTVPS S SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP APELLGG PCVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRW S VLTVLFIQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQ VYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNYFSCSVMHEALHNHYTQKSLSPG (SEQ ID NO: 19) and a light chain constant region comprising the amino acid sequence of
- SEQ ID NO: 19 comprises a serine to cysteine substitution at amino acid position 239 of human IgGl isotype. The presence of an additional cysteine residue allows interchain disulfide bond formation. Such interchain disulfide bond formation can cause steric hindrance, thereby reducing the affinity of the Fc region-FeyR binding interaction.
- the cysteine residue introduced in or in proximity to the Fc region of an IgG constant region can also serve as a site for conjugation to therapeutic agents (i.e , coupling cytotoxic drugs using thiol specific reagents such as raa!eimide derivatives of drugs).
- therapeutic agents i.e , coupling cytotoxic drugs using thiol specific reagents such as raa!eimide derivatives of drugs.
- the presence of a therapeutic agent causes steric hindrance, thereby further reducing the affinity of the Fc region-FcyR binding interaction.
- Other substitutions at any of positions 234, 235, 236 and/or 237 reduce affinity for Fey receptors, particularly FcyRI receptor (see, e.g., US 6 624,821 , US 5,624,821.)
- the anti-CD228 antibody or the anti-CD228 antibody of the antibody-drug conjugate is the humanized antibody hL49 HALC.
- hL49 HALC comprises a heavy chain variable region sequence of SEQ ID NO: 7 and a light chain variable region sequence of SEQ ID NO: 8.
- the N-terminal glutamine of the heavy chain variable domain is cyclized to form pyroglutamic acid.
- the anti-CD228 antibody or the anti-CD228 antibody of the antibody-drug conjugate is the humanized antibody hL49.
- hL49 comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7, a light chain variable region comprising the amino acid sequence of SEQ ID NO:8, a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 17, and a light chain constant region comprising the amino acid sequence of SEQ ID NO: 18.
- the antibodies also include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from binding to CD228 or from exerting a cytostatic or cytotoxic effect on HD cells.
- the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, PEGylation, phosphylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.
- a humanized antibody is a genetically engineered antibody in which the CDRs from a non-human "donor” antibody are grafted into human "acceptor” antibody sequences (see, e.g., Queen, US 5,530,101 and 5,585,089; Winter, US 5,225,539; Carter, US 6,407,213; Adair, US 5,859,205; and Foote, US 6,881,557).
- the acceptor antibody sequences can be, for example, a mature human antibody sequence, a composite of such sequences, a consensus sequence of human antibody sequences, or a germline region sequence.
- a preferred acceptor sequence for the heavy chain is the germline VH exon VH1-2 (also referred to in the literature as HV1-2) (Shin et al, 1991, EMBO J. 10:3641-3645) and for the hinge region (JH), exon JH-6 (Mattila et al, 1995, Eur. J. Immunol. 25:2578-2582).
- a preferred acceptor sequence is exon VK2- 30 (also referred to in the literature as KV2-30) and for the hinge region exon JK-4 (Hieter et al, 1982, J. Biol. Chem. 257: 1516-1522).
- a humanized antibody is an antibody having some or all CDRs entirely or substantially from a donor antibody and variable region framework sequences and constant regions, if present, entirely or substantially from human antibody sequences.
- a humanized heavy chain has at least one, two and usually all three CDRs entirely or substantially from a donor antibody heavy chain, and a heavy chain variable region framework sequence and heavy chain constant region, if present, substantially from human heavy chain variable region framework and constant region sequences.
- a humanized light chain has at least one, two and usually all three CDRs entirely or substantially from a donor antibody light chain, and a light chain variable region framework sequence and light chain constant region, if present, substantially from human light chain variable region framework and constant region sequences.
- a humanized antibody comprises a humanized heavy chain and a humanized light chain.
- a CDR in a humanized antibody is substantially from a corresponding CDR in a non-human antibody when at least 60%, 85%, 90%, 95% or 100% of corresponding residues (as defined by Rabat) are identical between the respective CDRs.
- the variable region framework sequences of an antibody chain or the constant region of an antibody chain are substantially from a human variable region framework sequence or human constant region respectively when at least 85%, 90%, 95% or 100% of corresponding residues defined by Rabat are identical.
- humanized antibodies often incorporate all six CDRs (preferably as defined by Rabat) from a mouse antibody, they can also be made with less than all CDRs (e.g., at least 3, 4, or 5) CDRs from a mouse antibody (e.g., Pascalis et al, J. Immunol. 169:3076, 2002; Vajdos et al, Journal of Molecular Biology, 320: 415-428, 2002; Iwahashi et al., Mol. Immunol.
- CDRs e.g., Pascalis et al, J. Immunol. 169:3076, 2002; Vajdos et al, Journal of Molecular Biology, 320: 415-428, 2002; Iwahashi et al., Mol. Immunol.
- Certain amino acids from the human variable region framework residues can be selected for substitution based on their possible influence on CDR conformation and/or binding to antigen. Investigation of such possible influences is by modeling, examination of the characteristics of the amino acids at particular locations, or empirical observation of the effects of substitution or mutagenesis of particular amino acids.
- the human framework amino acid when an amino acid differs between a murine variable region framework residue and a selected human variable region framework residue, the human framework amino acid can be substituted by the equivalent framework amino acid from the mouse antibody when it is reasonably expected that the amino acid:
- CDR region otherwise interacts with a CDR region (e.g. is within about 6 A of a CDR region);
- HALC humanized forms of the mouse antibody L49.
- One such humanized variant of the mouse antibody L49 is designated HALC.
- HALC comprises a mature heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7 and a mature light chain variable region comprising the amino acid sequence of SEQ ID NO: 8.
- the N-terminal glutamine of the heavy chain variable domain is cyclized to form pyroglutamic acid.
- Humanized antibodies of the invention include variants of the HALC humanized antibody in which the humanized heavy chain mature variable region shows at least 90%, 95% or 99% identity to SEQ ID NO: 7 and the humanized light chain mature variable region shows at least 90%, 95% or 99% sequence identity to SEQ ID NO: 8.
- the humanized heavy chain mature variable region shows at least 90%, 95% or 99% identity to SEQ ID NO: 7
- the humanized light chain mature variable region shows at least 90%, 95% or 99% sequence identity to SEQ ID NO: 8.
- some or all of the backmutations in HALC are retained. In other words, at least 1 , 2,
- position L36 is preferably occupied by Y and position L46 is preferably occupied by L.
- position L2 is preferably occupied by F.
- the CDR regions of such humanized antibodies are identical or substantially identical to the CDR regions of the mouse donor antibody.
- the light chain CDR1 position L28 is occupied by D.
- the CDR regions can be defined by any conventional definition (e.g., Chothia) but are preferably as defined by Rabat.
- the humanized antibody comprises a heavy chain comprising the 3 CDRs of SEQ ID NO: 7 and variable region frameworks with at least 95% identity to the variable region frameworks of SEQ ID NO: 7.
- the humanized antibody comprises a light chain comprising the 3 CDRs of SEQ ID NO: 8 and variable region frameworks with at least 95% identity to variable region frameworks of SEQ ID NO: 8.
- the humanized antibody comprises a heavy chain comprising the 3 CDRs of SEQ ID NO: 7 and variable region frameworks with at least 95% identity to the variable region frameworks of SEQ ID NO: 7, and a light chain comprising the 3 CDRs of SEQ ID NO: 8, and variable region frameworks with at least 95% identity to the variable region frameworks of SEQ ID NO: 8.
- the humanized antibody comprises a heavy chain comprising the 3 CDRs of SEQ ID NO: 7 and variable region frameworks with at least 98% identity to the variable region frameworks of SEQ ID NO: 7.
- the humanized antibody comprises a light chain comprising the 3 CDRs of SEQ ID NO: 8 and variable region frameworks with at least 98% identity to variable region frameworks of SEQ ID NO: 8.
- the humanized antibody comprises a heavy chain comprising the 3 CDRs of SEQ ID NO: 7 and variable region frameworks with at least 98% identity to the variable region frameworks of SEQ ID NO: 7, and a light chain comprising the 3 CDRs of SEQ ID NO: 8, and variable region frameworks with at least 98% identity to the variable region frameworks of SEQ ID NO: 8.
- the humanized antibody comprises a heavy chain comprising the 3 CDRs of SEQ ID NO: 7 and variable region frameworks with at least 99% identity to the variable region frameworks of SEQ ID NO: 7.
- the humanized antibody comprises a light chain comprising the 3 CDRs of SEQ ID NO: 8 and variable region frameworks with at least 99% identity to variable region frameworks of SEQ ID NO: 8.
- the humanized antibody comprises a heavy chain comprising the 3 CDRs of SEQ ID NO: 7 and variable region frameworks with at least 99% identity to the variable region frameworks of SEQ ID NO: 7, and a light chain comprising the 3 CDRs of SEQ ID NO: 8, and variable region frameworks with at least 99% identity to the variable region frameworks of SEQ ID NO: 8.
- the humanized antibody HALC comprises an asparagine to aspartic acid substitution at amino acid position L28 compared to the mouse antibody L49, which is in the light chain CDR1. This substitution eliminates the deamidation observed in the humanized L49 variant HALB, and has limited isomerization.
- the light chain variable region lacks this substitution at position L28.
- the light chain variable region comprises the amino acid sequence
- the humanized antibody is HALB, which comprises a heavy chain variable region comprising SEQ ID NO: 7 and a light chain variable region comprising SEQ ID NO:20.
- CDR residues not contacting antigen and not in the SDRs can be identified based on previous studies (for example residues H60-H65 in CDR H2 are often not required), from regions of Rabat CDRs lying outside Chothia hypervariable loops (Chothia, J. Mol. Biol. 196:901, 1987), by molecular modeling and/or empirically, or as described in Gonzales et al., Mol. Immunol. 41 : 863 (2004).
- the amino acid occupying the position can be an amino acid occupying the corresponding position (by Rabat numbering) in the acceptor antibody sequence.
- substitutions of acceptor for donor amino acids in the CDRs to include reflects a balance of competing considerations. Such substitutions are potentially advantageous in decreasing the number of mouse amino acids in a humanized antibody and consequently decreasing potential immunogenicity. However, substitutions can also cause changes of affinity, and significant reductions in affinity are preferably avoided. Positions for substitution within CDRs and amino acids to substitute can also be selected empirically.
- substitutions can be made, for example, in framework residues not in contact with the CDRs, or even some potential CDR-contact residues amino acids within the CDRs.
- the replacements made in the variant humanized sequences are conservative with respect to the replaced HALC amino acids.
- replacements relative to HALC have no substantial effect on the binding affinity or potency of the humanized mAh, that is, its ability to bind human CD228 and inhibit growth of cancer cells.
- Variants typically differ from the heavy and light chain mature variable region sequences of HALC by a small number (e.g., typically no more than 1, 2, 3, 5 or 10 in either the light chain or heavy chain mature variable region, or both) of replacements, deletions or insertions.
- a small number e.g., typically no more than 1, 2, 3, 5 or 10 in either the light chain or heavy chain mature variable region, or both
- the heavy and light chain variable regions of humanized antibodies can be linked to at least a portion of a human constant region.
- the choice of constant region depends, in part, whether antibody-dependent cell-mediated cytotoxicity, antibody dependent cellular
- phagocytosis and/or complement dependent cytotoxicity are desired.
- human isotopes IgGl and IgG3 have strong complement-dependent cytotoxicity
- human isotype IgG2 weak complement-dependent cytotoxicity
- IgG4 lacks complement-dependent cytotoxicity.
- Human IgGl and IgG3 also induce stronger cell mediated effector functions than human IgG2 and IgG4.
- Light chain constant regions can be lambda or kappa.
- Antibodies can be expressed as tetramers containing two light and two heavy chains, as separate heavy chains, light chains, as Fab, Fab', F(ab')2, and Fv, or as single chain antibodies in which heavy and light chain variable domains are linked through a spacer.
- One or several amino acids at the amino or carboxy terminus of the light and/or heavy chain may be missing or derivatized in a proportion or all of the molecules. Substitutions can be made in the constant regions to reduce or increase effector function such as complement-mediated cytotoxicity or ADCC (see, e.g., Winter et al., US Patent No. 5,624,821; Tso et al., US Patent No. 5,834,597; and Lazar et al, Proc. Natl. Acad. Sci. USA 103:4005, 2006), or to prolong half-life in humans (see, e.g., Hinton et al, J. Biol. Chem. 279:6213, 2004).
- ADCC complement-mediated cytotoxicity
- Exemplary substitution include the amino acid substitution of the native amino acid to a cysteine residue is introduced at amino acid position 234, 235, 237, 239, 267, 298, 299, 326, 330, or 332, preferably an S239C mutation in a human IgGl isotype (US 20100158909).
- the presence of an additional cysteine residue allows interchain disulfide bond formation. Such interchain disulfide bond formation can cause steric hindrance, thereby reducing the affinity of the Fc region-FcyR binding interaction.
- the cysteine residue(s) introduced in or in proximity to the Fc region of an IgG constant region can also serve as sites for conjugation to therapeutic agents (i.e., coupling cytotoxic drugs using thiol specific reagents such as maleimide derivatives of drugs.
- therapeutic agents i.e., coupling cytotoxic drugs using thiol specific reagents such as maleimide derivatives of drugs.
- the presence of a therapeutic agent causes steric hindrance, thereby further reducing the affinity of the Fc region-FcyR binding interaction.
- Other substitutions at any of positions 234, 235, 236 and/or 237 reduce affinity for Fey receptors, particularly FcyRI receptor (see, e.g., US 6,624,821, US 5,624,821.)
- FcRn is a receptor that is structurally similar to MHC Class I antigen that non- covalently associates with b2 -microglobulin. FcRn regulates the catabolism of IgGs and their transcytosis across tissues (Ghetie and Ward, 2000, Annu. Rev. Immunol. 18:739- 766; Ghetie and Ward, 2002, Immunol. Res. 25:97-113).
- the IgG-FcRn interaction takes place at pH 6.0 (pH of intracellular vesicles) but not at pH 7.4 (pH of blood); this interaction enables IgGs to be recycled back to the circulation (Ghetie and Ward, 2000, Ann. Rev. Immunol. 18:739-766; Ghetie and Ward, 2002, Immunol. Res. 25:97-113).
- the region on human IgGl involved in FcRn binding has been mapped (Shields et al, 2001, J. Biol. Chem. 276:6591-604).
- IgGl molecules harboring these substitutions have longer serum half-lives. Consequently, these modified IgGl molecules may be able to carry out their effector functions, and hence exert their therapeutic efficacies, over a longer period of time compared to unmodified IgGl .
- Other exemplary substitutions for increasing binding to FcRn include a Gin at position 250 and/or a Leu at position 428. EU numbering is used for all position in the constant region.
- Oligosaccharides covalently attached to the conserved Asn297 are involved in the ability of the Fc region of an IgG to bind FcyR (Lund et al, 1996, J. Immunol. 157:4963-69; Wright and Morrison, 1997, Trends Biotechnol. 15:26-32).
- Engineering of this glycoform on IgG can significantly improve IgG-mediated ADCC. Addition of bisecting N-acetylglucosamine modifications (Umana et al, 1999, Nat. Biotechnol. 17: 176-180; Davies et al, 2001, Biotech. Bioeng.
- an anti-CD228 antibody or an anti-CD228 antibody of the antibody-drug conjugate described herein has a glycan attached to the conserved Asn297 residue of the constant region, wherein the numbering of amino acid residues in the constant region is according to the EU-index as described in Kabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991).
- the glycan is biantennary. In some embodiments, the glycan is core fucosylated. In some embodiments, the glycan has zero terminal galactose residues. In some embodiments, the glycan is biantennary and core fucosylated. In some embodiments, the glycan is biantennary and has zero terminal galactose residues. In some embodiments, the glycan is core fucosylated and has zero terminal galactose residues. In some embodiments, the glycan is biantennary, core fucosylated and has zero galactose residues.
- the conserved Asn297 residues of the constant regions wherein the numbering of amino acid residues in the constant region is according to the EU-index as described in Kabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991), are predominantly occupied by biantennary, core fucosylated glycans with zero terminal galactose residues.
- a systemic substitution of solvent-exposed amino acids of human IgGl Fc region has generated IgG variants with altered FcyR binding affinities (Shields et al, 2001, J. Biol. Chem. 276:6591-604).
- a subset of these variants involving substitutions at Thr256/Ser298, Ser298/Glu333, Ser298/Lys334, or Ser298/Glu333 Lys334 to Ala demonstrate increased in both binding affinity toward FcyR and ADCC activity (Shields et al, 2001, J. Biol. Chem. 276:6591-604; Okazaki et al, 2004, J. Mol. Biol. 336: 1239-49).
- Complement fixation activity of antibodies can be improved by substitutions at Lys326 and Glu333 (Idusogie et al., 2001 , J. Immunol.
- Complement activity can be reduced by mutating at least one of the amino acid residues 318, 320, and 322 of the heavy chain to a residue having a different side chain, such as Ala.
- a residue having a different side chain such as Ala.
- Other alkyl-substituted non-ionic residues such as Gly, He, Leu, or Val, or such aromatic non-polar residues as Phe, Tyr, Trp and Pro in place of any one of the three residues also reduce or abolish Clq binding.
- Ser, Thr, Cys, and Met can be used at residues 320 and 322, but not 318, to reduce or abolish Clq binding activity.
- Reference to a human constant region includes a constant region with any natural allotype or any permutation of residues occupying polymorphic positions in natural allotypes. Also, up to 1, 2, 5, or 10 mutations may be present relative to a natural human constant region, such as those indicated above to reduce Fcgamma receptor binding or increase binding to FcRN.
- an anti-CD228 and/or anti-CD228 antibody-drug conjugate antibody described herein comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 17.
- an anti-CD228 and/or anti-CD228 antibody- drug conjugate antibody described herein comprises a light chain constant region comprising the amino acid sequence of SEQ ID NO: 18.
- an anti-CD228 and/or anti- CD228 antibody-drug conjugate antibody described herein comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 17 and a light chain constant region comprising the amino acid sequence of SEQ ID NO: 18.
- an anti-CD228 and/or anti-CD228 antibody-drug conjugate antibody described herein comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 19. In some embodiments, an anti-CD228 and/or anti-CD228 antibody-drug conjugate antibody described herein comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 19 and a light chain constant region comprising the amino acid sequence of SEQ ID NO: 18.
- Humanized antibodies are typically produced by recombinant expression.
- Recombinant polynucleotide constructs typically include an expression control sequence operably linked to the coding sequences of antibody chains, including naturally- associated or heterologous promoter regions.
- the expression control sequences are eukaryotic promoter systems in vectors capable of transforming or transfecting eukaryotic host cells. Once the vector has been incorporated into the appropriate host, the host is maintained under conditions suitable for high level expression of the nucleotide sequences, and the collection and purification of the crossreacting antibodies.
- Mammalian cells are a preferred host for expressing nucleotide segments encoding immunoglobulins or fragments thereof. See Winnacker, From Genes to Clones, (VCH
- suitable host cell lines capable of secreting intact heterologous proteins include CHO cell lines (e.g., DG44), various COS cell lines, HeLa cells, HEK293 cells, L cells, and non- antibody-producing myelomas including Sp2/0 and NSO.
- the cells are nonhuman.
- Expression vectors for these cells can include expression control sequences, such as an origin of replication, a promoter, an enhancer (Queen et al, Immunol. Rev. 89:49 (1986)), and necessary processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences.
- Preferred expression control sequences are promoters derived from endogenous genes, cytomegalovirus, SV40, adenovirus, bovine papillomavirus, and the like. See Co et al., J. Immunol. 148: 1149 (1992). [0167] Once expressed, antibodies can be purified according to standard procedures of the art, including HPLC purification, column chromatography, gel electrophoresis and the like (see generally, Scopes, Protein Purification (Springer- Verlag, NY, 1982)).
- the invention further provides nucleic acids encoding any of the humanized heavy and light chains described above.
- the nucleic acids also encode a signal peptide fused to the mature heavy and light chains. Coding sequences on nucleic acids can be in operable linkage with regulatory sequences to ensure expression of the coding sequences, such as a promoter, enhancer, ribosome binding site, transcription termination signal and the like.
- the nucleic acids encoding heavy and light chains can occur in isolated form or can be cloned into one or more vectors.
- the nucleic acids can be synthesized by for example, solid state synthesis or PCR of overlapping oligonucleotides. Nucleic acids encoding heavy and light chains can be joined as one contiguous nucleic acid, e.g., within an expression vector, or can be separate, e.g., each cloned into its own expression vector.
- nucleic acids encoding an anti-CD228 antibody or antigen-binding fragment thereof as described herein are vectors comprising the nucleic acids encoding an anti-CD228 antibody or antigen-binding fragment thereof as described herein.
- vectors comprising the nucleic acids encoding an anti-CD228 antibody or antigen-binding fragment thereof as described herein.
- host cells expressing the nucleic acids encoding an anti-CD228 antibody or antigen-binding fragment thereof as described herein.
- host cells comprising the vectors comprising the nucleic acids encoding an anti-CD228 antibody or antigen-binding fragment thereof as described herein.
- the anti-CD228 antibodies described herein may be prepared by well-known recombinant techniques using well known expression vector systems and host cells.
- the antibodies are prepared in a CHO cell using the GS expression vector system as disclosed in De la Cruz Edmunds et al, 2006, Molecular Biotechnology 34; 179-190, EP216846, U.S. Pat. No. 5,981,216, WO 87/04462, EP323997, U.S. Pat. No. 5,591,639, U.S. Pat. No.
- Monoclonal anti-CD228 antibodies described herein may e.g. be produced by the hybridoma method first described by Kohler et ah, Nature , 256, 495 (1975), or may be produced by recombinant DNA methods. Monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in, for example, Clackson et al, Nature, 352, 624-628 (1991) and Marks et al, JMol, Biol., 222(3):581-597 (1991). Monoclonal antibodies may be obtained from any suitable source.
- monoclonal antibodies may be obtained from hybridomas prepared from murine splenic B cells obtained from mice immunized with an antigen of interest, for instance in form of cells expressing the antigen on the surface, or a nucleic acid encoding an antigen of interest.
- Monoclonal antibodies may also be obtained from hybridomas derived from antibody-expressing cells of immunized humans or non-human mammals such as rats, dogs, primates, etc.
- Anti-CD228 antibodies can be conjugated to cytotoxic or cytostatic moieties
- an antibody drug conjugate ADC
- cytotoxic agents e.g., chemotherapeutic agents
- prodrug converting enzymes e.g., prodrug converting enzymes
- radioactive isotopes or compounds e.g., ribulose, ribulose, ribulose, ribulose, ribulose, ribulose, ribulose, ribulose, ribulose, ribuenta, or toxins (these moieties being collectively referred to as a therapeutic agent).
- an anti- CD288 antibody can be conjugated to a cytotoxic agent such as a chemotherapeutic agent, or a toxin (e.g., a cytostatic or cytocidal agent such as, e.g., abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin).
- a cytotoxic agent such as a chemotherapeutic agent
- a toxin e.
- An anti-CD228 antibody can be conjugated to a pro-drug converting enzyme.
- the pro-drug converting enzyme can be recombinantly fused to the antibody or chemically conjugated thereto using known methods.
- Exemplary pro-drug converting enzymes are carboxypeptidase G2, beta-glucuronidase, penicillin- V-amidase, penicillin- G-amidase, b- lactamase, b-glucosidase, nitroreductase and carboxypeptidase A.
- the therapeutic agent can be conjugated in a manner that reduces its activity unless it is cleaved off the antibody (e.g., by hydrolysis, by antibody degradation or by a cleaving agent).
- Such therapeutic agent is attached to the antibody with a cleavable linker that is sensitive to cleavage in the intracellular environment of the CD228-expressing cancer cell but is not substantially sensitive to the extracellular environment, such that the conjugate is cleaved from the antibody when it is internalized by the CD228-expressing cancer cell (e.g., in the endosomal or, for example by virtue of pH sensitivity or protease sensitivity, in the lysosomal environment or in the caveolear environment).
- the ADC comprises a linker region between the therapeutic agent and the anti-CD228 antibody.
- the linker is cleavable under intracellular conditions, such that cleavage of the linker releases the therapeutic agent from the antibody in the intracellular environment (e.g., within a lysosome or endosome or caveolea).
- the linker can be, e.g., a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including a lysosomal or endosomal protease.
- the peptidyl linker is at least two amino acids long or at least three amino acids long.
- Cleaving agents can include cathepsins B and D and plasmin (see, e.g., Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123). Most typical are peptidyl linkers that are cleavable by enzymes that are present in CD228-expressing cells.
- a peptidyl linker that is cleavable by the thiol-dependent protease cathepsin-B, which is highly expressed in cancerous tissue can be used (e.g., a linker comprising a Phe-Leu or a Gly-Phe-Leu-Gly peptide (SEQ ID NO: 30)).
- linker comprising a Phe-Leu or a Gly-Phe-Leu-Gly peptide (SEQ ID NO: 30)
- Other such linkers are described, e.g., in U.S. Patent No. 6,214,345.
- the peptidyl linker cleavable by an intracellular protease comprises a Val-Cit linker or a Phe-Lys dipeptide (see, e.g., U.S.
- the cleavable linker can be pH-sensitive, i.e., sensitive to hydrolysis at certain pH values.
- the pH-sensitive linker is hydrolyzable under acidic conditions.
- an acid-labile linker that is hydrolyzable in the lysosome e.g., a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like
- an acid-labile linker that is hydrolyzable in the lysosome (e.g., a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like) can be used.
- U.S. Patent Nos. 5,122,368; 5,824,805; 5,622,929; Dubowchik and Walker 1999, Pharm.
- the hydrolyzable linker is a thioether linker (such as, e.g., a thioether attached to the therapeutic agent via an acylhydrazone bond (see, e.g., U.S. Patent No. 5,622,929)).
- linkers are cleavable under reducing conditions (e.g., a disulfide linker).
- Disulfide linkers include those that can be formed using SATA (N-succinimidyl-S- acetylthioacetate), SPDP (N-succinimidyl-3-(2-pyridyldithio)propionate), SPDB (N- succinimidyl-3-(2-pyridyldithio)butyrate) and SMPT (N-succinimidyl-oxycarbonyl- alpha- methyl-alpha-(2-pyridyl-dithio)toluene), SPDB and SMPT.
- SATA N-succinimidyl-S- acetylthioacetate
- SPDP N-succinimidyl-3-(2-pyridyldithio)propionate
- SPDB N- succinimidyl-3-(2-pyridyldithio)butyrate
- SMPT N-succinimidyl-oxycarbonyl-
- the linker can also be a malonate linker (Johnson et al, 1995, Anticancer Res.
- the linker can also be a malonate linker (Johnson et al, 1995, Anticancer Res. 15: 1387-93), a maleimidobenzoyl linker (Lau et al, 1995, Bioorg-Med-Chem. 3(10): 1299-1304), or a 3'-N-amide analog (Lau et al, 1995, Bioorg-Med-Chem. 3(10): 1305-12).
- the linker can also be a malonate linker (Johnson et al, 1995, Anticancer Res. 15: 1387-93), a maleimidobenzoyl linker (Lau et al, 1995, Bioorg-Med-Chem. 3(10): 1299-1304), or a 3'-N-amide analog (Lau et al, 1995, Bioorg-Med-Chem. 3(10): 1305-12).
- the linker also can be a non-cleavable linker, such as an maleimido-alkylene- or maleimide-aryl linker that is directly attached to the therapeutic agent (e.g., a drug).
- the therapeutic agent e.g., a drug
- An active drug-linker is released by degradation of the antibody.
- the linker is not substantially sensitive to the extracellular environment meaning that no more than about 20%, typically no more than about 15%, more typically no more than about 10%, and even more typically no more than about 5%, no more than about 3%, or no more than about 1% of the linkers in a sample of the ADC is cleaved when the ADC present in an extracellular environment (e.g., in plasma).
- Whether a linker is not substantially sensitive to the extracellular environment can be determined, for example, by incubating independently with plasma both (a) the ADC (the “ADC sample”) and (b) an equal molar amount of unconjugated antibody or therapeutic agent (the “control sample”) for a predetermined time period (e.g., 2, 4, 8, 16, or 24 hours) and then comparing the amount of unconjugated antibody or therapeutic agent present in the ADC sample with that present in control sample, as measured, for example, by high performance liquid chromatography.
- a predetermined time period e.g. 2, 4, 8, 16, or 24 hours
- the linker can also promote cellular internalization.
- the linker can promote cellular internalization when conjugated to the therapeutic agent (i.e., in the milieu of the linker- therapeutic agent moiety of the ADC or ADC derivative as described herein).
- the linker can promote cellular internalization when conjugated to both the therapeutic agent and the anti-CD228 antibody (i.e., in the milieu of the ADC as described herein).
- the anti-CD228 antibody can be conjugated to the linker via a heteroatom of the antibody. These heteroatoms can be present on the antibody in its natural state or can be introduced into the antibody. In some aspects, the anti-CD228 antibody will be conjugated to the linker via a nitrogen atom of a lysine residue. In other aspects, the anti-CD228 antibody will be conjugated to the linker via a sulfur atom of a cysteine residue. The cysteine residue can be naturally-occurring or one that is engineered into the antibody. Methods of conjugating linkers and drug-linkers to antibodies via lysine and cysteine residues are known in the art.
- Exemplary antibody-drug conjugates include auristatin based antibody-drug conjugates (i.e., the drug component is an auristatin drug).
- Auristatins bind tubulin, have been shown to interfere with microtubule dynamics and nuclear and cellular division, and have anticancer activity.
- the auristatin based antibody-drug conjugate comprises a linker between the auristatin drug and the anti-CD228 antibody.
- the linker can be, for example, a cleavable linker (e.g., a peptidyl linker, a carbohydrate linker) or a non-cleavable linker (e.g., linker released by degradation of the antibody).
- Auristatins include auristatin T, MMAF, and MMAE.
- the synthesis and structure of exemplary auristatins are described in U.S. Publication Nos. 7,659,241, 7,498,298, 2009-0111756, 2009-0018086, and 7,968, 687 each of which is incorporated herein by reference in its entirety and for all purposes.
- exemplary antibody-drug conjugates include maytansinoid antibody-drug conjugates (i.e., the drug component is a maytansinoid drug), and benzodiazepine antibody drug conjugates (i.e., the drug component is a benzodiazepine (e.g., pyrrolo[l,4]benzodiazepine dimers (PBD dimer), indolinobenzodiazepine dimers, and oxazolidinobenzodiazepine dimers)).
- PBD dimer pyrrolo[l,4]benzodiazepine dimers
- indolinobenzodiazepine dimers e.g., indolinobenzodiazepine dimers
- oxazolidinobenzodiazepine dimers e.g., pyrrolo[l,4]benzodiazepine dimers (PBD dimer), indolinobenzodiazepine dimers, and oxazolidinobenzodiazepine dimers
- a PBD dimer for use in the present invention is represented by formula I.
- the preferred stereochemistry of the PBD dimer is as shown in formula la:
- n 1 or 3.
- Solvates of formula (I) and (la) are typically formed from addition of water or alcoholic solvent across the imine functional group of one or both PBD monomers to form carbinolamine(s) and/or carbinolamine ethers.
- carbinolamine NH-CH(OH)
- carbinolamine ether NH-CH(OMe)
- R 10 is H, and R 11 is OH or OR A , where R A is saturated Ci-4 alkyl (preferably methyl); or
- R 10 and R 11 form a nitrogen-carbon double bond between the nitrogen and carbon atoms to which they are bound;
- R 10 is H, and R 11 is OH or OR A , where R A is saturated Ci-4 alkyl (preferably methyl); and the other of R 10 and R 11 form a nitrogen-carbon double bond between the nitrogen and carbon atoms to which they are bound.
- the PBD dimer of formula I or la is typically linked to the antibody via a Linker Unit, LU.
- the Linker Unit acts to release the PBD dimer of formula I or la (or a pharmaceutically salt, solvate, or solvate of the salt thereof ) at the target site (e.g., inside the cancer cell) .
- a PBD drug-linker compound for use in the present invention is represented below by formula II (preferred stereochemistry as shown in Ila) wherein LU is a Linker Unit.
- the Linker Unit can be, for example, a cleavable peptide Linker Unit (e.g., a linker comprising the valine- alanine peptide) or a cleavable disulfide Linker Unit:
- n 1 or 3
- a preferred PBD drug-linker compound for use in the present invention is represented by Formula III below:
- the PBD drug-linker is conjugated to an anti-CD228 antibody to produce a CD228 targeted antibody-drug conjugate.
- the antibody can be conjugated to a drug-linker of formula II or formula III.
- An exemplary C2248 targeted antibody-drug conjugate is shown below in formulas IV, IVa, and IVb:
- Exemplary drug-linkers include MMAE drug-linkers.
- the present inventors have found that the incorporation of a polyethylene glycol polymer as a side chain into a cleavable b- glucuronide MMAE drug-linker provides antibody drug-conjugates with descreased plasma clearance and increased antitumor activity in xenograft models as compared to a non-PEGylated control. Accordingly, particularly advantageous drug-linkers for attachment to the antibodies of the present invention are as follows in formula V:
- Z represents an organic moiety having a reactive site capable of reacting with a functional group on the antibody to form a covalent attachment thereto
- n ranges from 8 to 36 and most preferably ranges from 8 to 14 (most preferably 12)
- R i is a capping unit for tire polyethylene glycol moiety, preferably- Ci h or-CHrCH CChH.
- a preferred Z moiety is a maleimido-containing moiety. Particularly preferred Z moieties are shown in the drug-linkers below:
- R VR is hydrogen or a protecting group e.g., acid labile protecting group, e.g., BOC
- R 2 is a capping unit for the polyethylene glycol moiety, preferably-CIB or -CH2CH2CO2H.
- R PR can be hydrogen or a protecting group.
- Protective groups as used herein refer to groups which selectively block, either temporarily or permanently, a reactive site in a multifunctional compound.
- a protecting group is a suitable protecting group when it is capable of preventing or avoiding unwanted side-reactions or premature loss of the protecting group under reaction conditions required to effect desired chemical transformation elsewhere in the molecule and during purification of the newly formed molecule when desired, and can be removed under conditions that do not adversely affect the structure or stereochemical integrity of that newly formed molecule.
- Suitable amine protecting groups include acid-labile nitrogen protecting groups, including those provided by Isidro-Llobel et al. "Amino acid-protecting groups" Chem. Rev. (2009) 109: 2455-2504.
- an acid-labile nitrogen-protecting group transforms a primary or secondary amino group to its corresponding carbamate and includes t- butyl, allyl, and benzyl carbamates.
- R 21 is a capping unit for the polyethylene glycol moiety.
- polyethylene glycol units can be terminally capped with a wide diversity of organic moieties, typically those that are relatively non-reactive. Alkyl and substituted alkyl groups are preferred.
- the subscript p represents the drug load and, depending on the context, can represent the number of molecules of drug- linker molecules attached to an individual antibody molecule and as such, is an integer value, or can represent an average drug load and, as such, can be an integer or non-integer value but is typically a non-integer value.
- An average drug load represents the average number of drug- linker molecules per antibody in a population. Often, but not always, when we refer to an antibody, e.g., a monoclonal antibody, we are referring to a population of antibody molecules.
- the average drug load is an important quality attribute as it determines the amount of drug that can be delivered to a target cell.
- the percentage of unconjugated antibody molecules in the composition is included in the average drug load value.
- the average drug load when referring to a composition comprising a population of antibody-drug conjugate compounds is from 1 to about 16, preferably about 2 to about 14, more preferably about 2 to about 10.
- a particularly preferred average drug load is about 2.
- the actual drug load for individual antibody molecules in the population of antibody-drug conjugate compounds is from 1 to 4, 1 to 3 or 1 to 2 with a predominant drug loading of 2.
- the average drug load of 2 is achieved via site specific conjugation techniques (e.g., engineered cysteines introduced to the antibody including at position 239, according to the EU Index numbering system).
- a particularly preferred average drug load is about 8.
- the drug-linkers are conjugated to the cysteine residues of the reduced inter-chain disulfides.
- the actual drug load for individual antibody molecules in the population of antibody-drug conjugate compounds is from 1 to 10 (or from 6 to 10 or from 6 to 8) with a predominant drug loading of 8.
- a higher drug load can be achieved, for example, if, in addition to the interchain disulfides, drug- linker is conjugated to introduced cysteine residues (such as a cysteine residue introduced at position 239, according to the EU index).
- Exemplary ADCs include the following:
- R PR is hydrogen or a protecting group, e.g., acid labile protecting group, e.g., BGC, R ; is a capping unit for the polyethylene glycol moiety, preferably- Cfib or -CH2CH2CO2H,
- Ab represents an anti-CD228 antibody and p represents an integer ranging from 1 to 16, preferably 1 to 14, 6 to 12, 6 to 10, or 8 to 10 when referring to individual antibody molecules or to an average drug load of from about 4 or about 6 to about 14, preferably about 8 when referring to a population of antibody molecules.
- the PEG (polyethylene glycol) portion of the drug linker can range from 8 to 36, however, it has been found that a PEG of 12 ethylene oxide units is particularly preferably. It has been found that longer PEG chains can result in slower clearance whereas shorter PEG chains can result in diminished activity. Accordingly, the subscript n in all of the embodiments above is preferably 8 to 14, 8 to 12, 10 to 12 or 10 to 14 and is most preferably 12.
- Polydisperse PEGS, monodisperse PEGS and discrete PEGs can be used to make the PEGylated antibody drug conjugates of the present invention.
- Polydisperse PEGs are a heteregenous mixture of sizes and molecular weights whereas monodisperse PEGs are typically purified from heterogenous mxitures and are therefore provide a single chain length and molecular weight.
- Preferred PEG Units are discrete PEGs, compounds that are synthesized in step-wise fashion and not via a polymerization process.
- Discrete PEGs provide a single molecule with defined and specified chain length.
- the value for the subscript "n" can be an average number and can be an integer or non-integer number.
- covalent attachment of the antibody to the drug-linker is accomplished through a sulfhydryl functional group of the antibody interacting with a maleimide functional group of a drug linker to form a thio-substituted succinimide.
- the sulfhydryl functional group can be present on the Ligand Unit in the Ligand' s natural state, for example, in a naturally-occurring residue (inter-chain disulfide resides), or can be introduced into the Ligand via chemical modification or by biological engineering, or a combination of the two. It will be understood that an antibody-substituted succinimide may exist in hydrolyzed form(s).
- an ADC is comprised of a succinimide moiety that when bonded to the antibody is represented by the structure of: or is comprised of its corresponding acid-amide moiety that when bonded to the antibody is represented by the structure of:
- the wavy line indicates linkage to the remainder of the drug-linker.
- cytotoxic agents to conjugate to anti-CD228 antibodies include, for example, antitubulin agents, DNA minor groove binding agents, DNA replication inhibitors, chemotherapy sensitizers, or the like.
- Other exemplary classes of cytotoxic agents include anthracyclines, auristatins, camptothecins, duocarmycins, etoposides, maytansinoids and vinca alkaloids.
- cytotoxic agents include auristatins (e.g., auristatin T, auristatin E, AFP, monomethyl auristatin F (MMAF), lipophilic monomethyl aurstatin F, monomethyl auristatin E (MMAE)), DNA minor groove binders (e.g., enediynes and lexitropsins), duocarmycins, taxanes (e.g., paclitaxel and docetaxel), vinca alkaloids, nicotinamide phosphoribosyltranferase inhibitor (NAMPTi), tubulysin M, doxorubicin, morpholino- doxorubicin, and cyanomorpholino-doxorubicin.
- auristatins e.g., auristatin T, auristatin E, AFP, monomethyl auristatin F (MMAF), lipophilic monomethyl aurstatin F, monomethyl auristatin
- the cytotoxic agent can be a chemotherapeutic such as, for example, doxorubicin, paclitaxel, melphalan, vinca alkaloids, methotrexate, mitomycin C or etoposide.
- the agent can also be a CC-1065 analogue, calicheamicin, maytansine, an analog of dolastatin 10, rhizoxin, or palytoxin.
- the cytotoxic agent can also be an auristatin.
- the auristatin can be an auristatin E derivative is, e.g., an ester formed between auristatin E and a keto acid.
- auristatin E can be reacted with paraacetyl benzoic acid or benzoylvaleric acid to produce AEB and AEVB, respectively.
- Other typical auristatins include auristatin T, AFP, MMAF, and MMAE. The synthesis and structure of various auristatins are described in, for example, US 2005-0238649 and US2006-0074008.
- the cytotoxic agent can be a DNA minor groove binding agent. (See, e.g., U.S.
- the minor groove binding agent can be a CBI compound or an enediyne (e.g., calicheamicin).
- the cytotoxic or cytostatic agent can be an anti-tubulin agent.
- anti - tubulin agents include taxanes (e.g., Taxol® (paclitaxel), Taxotere® (docetaxel)), T67 (Tularik), vinca alkyloids (e.g., vincristine, vinblastine, vindesine, and vinorelbine), and auristatins (e.g., auristatin E, AFP, MMAF, MMAE, AEB, AEVB). Exemplary auristatins are shown below in formulae III-XIII.
- antitubulin agents include, for example, baccatin derivatives, taxane analogs (e.g., epothilone A and B), nocodazole, colchicine and colcimid, estramustine, cryptophysins, cemadotin, maytansinoids, combretastatins, discodermoide and eleuthrobin.
- the cytotoxic agent can be a maytansinoid, another group of anti-tubulin agents (e.g., DM1, DM2, DM3, DM4).
- the maytansinoid can be maytansine or a maytansine containing drug linker such as DM-1 or DM-4 (ImmunoGen, Inc.; see also Chari et al., 1992, Cancer Res.)
- an anti-CD 228 antibody of the invention is conjugated to monomethyl auristatin E via a MDpr-PEG(12)-gluc linker forming an antibody-drug conjugate having the structure:
- n ranges from 8 to 36 and most preferably ranges from 8 to 14 (most preferably 12)
- R PR IS hydrogen or a protecting group, e.g., acid labile protecting group, e.g., BOC
- R 21 is a capping unit for the polyethylene glycol moiety, preferably- CEb or -CH2CH2CO2H
- Ab represents an anti-CD228 antibody
- p represents an integer ranging from 1 to 16, preferably 1 to 14, 6 to 12, 6 to 10, or 8 to 10 when referring io individual antibody molecules or to an average drug load of from about 4 or about 6 to about 14, preferably about 8 when referring to a population of antibody molecules.
- the anti- CD228 is hL49 and the resulting antibody-drug conjugate is hL49-Mdpr-PEG(12)-gluc-MMAE .
- hL49-Mdpr-PEG(12)-gluc-MMAE is also referred to as hL49-5088.
- the term hL49-5088(8) refers to the hL49-5088 with an average drug load of about 8 drug-linkers per antibody.
- the antibodies of the invention can be used to treat cancer in a subject.
- Some such cancers show detectable levels of CD228 measured at either the protein (e.g., by immunoassay using one of the exemplified antibodies) or mRNA level.
- Some such cancers show elevated levels of CD228 relative to noncancerous tissue of the same type, preferably from the same patient.
- An exemplary level of CD228 on cancer cells amenable to treatment is 5000-500,000 CD228 molecules per cell, although higher or lower levels can be treated.
- a level of CD228 in a cancer is measured before performing treatment.
- the subject has been previously treated with one or more therapeutic agents and did not respond to the treatment, wherein the one or more therapeutic agents is not the antibody, antigen-binding fragment, or antibody-drug conjugate. In some embodiments, the subject has been previously treated with one or more therapeutic agents and relapsed after the treatment, wherein the one or more therapeutic agents is not the antibody, antigen-binding fragment, or antibody-drug conjugate. In some embodiments, the subject has been previously treated with one or more therapeutic agents and has experienced disease progression during treatment, wherein the one or more therapeutic agents is not the antibody, antigen-binding fragment, or antibody-drug conjugate.
- the cancer is an advanced stage cancer. In some embodiments, the advanced stage cancer is a stage 3 or stage 4 cancer. In some embodiments, the advanced stage cancer is metastatic cancer. In some embodiments, the cancer is recurrent cancer. In some embodiments, the subject received prior treatment with standard of care therapy for the cancer and failed the prior treatment. In some embodiments, the subject is a human.
- Examples of cancers associated with CD228 expression and amenable to treatment include melanoma and other carcinomas, including pancreatic cancer, lung cancer, such as non small lung cancer, thyroid cancer, esophageal cancer, head and neck cancer, breast cancer, such as triple negative breast cancer, colorectal cancer, mesothelioma and choliangiocarcinoma.
- the antibodies or antibody-drug conjugates of the invention are used in methods of treating melanoma in a subject.
- the melanoma is cutaneous melanoma.
- the cutaneous melanoma is selected from the group consisting of superficial spreading melanoma, nodular melanoma, acral lentiginous melanoma, lentigo maligna melanoma, and desmoplastic melanoma.
- the cutaneous melanoma is superficial spreading melanoma.
- the cutaneous melanoma is nodular melanoma.
- the cutaneous melanoma is acral lentiginous melanoma.
- the acral lentiginous melanoma is subungual melanoma.
- the cutaneous melanoma is lentigo maligna melanoma.
- the cutaneous melanoma is desmoplastic melanoma.
- the subject received prior therapy with an inhibitor of PD-1 or PD-L1 for the cutaneous melanoma.
- the subject received prior therapy with an inhibitor of PD-1.
- the inhibitor of PD-1 is selected from the group consisting of nivolumab (OPDIVO®, BMS-936558 or MDX-1106), pembrolizumab (KEYTRUDA®, MK-3475), pidilizumab (CT-011) and cemiplimab (REGN2810).
- the subject received prior therapy with an inhibitor of PD-L1.
- the PD-L1 inhibitor is selected from the group consisting of atezolizumab (TECENTRIQ®, MPDL3280A), avelumab (BAVENCIO®), durvalumab and BMS-936559.
- the melanoma is sub cutaneous melanoma. In some embodiments, the sub-cutaneous melanoma is ocular melanoma or mucosal melanoma. In some embodiments, the melanoma is non-cutaneous melanoma. In some embodiments, the antibodies or antibody-drug conjugates of the invention are used in methods of treating pancreatic cancer in a subject. In some embodiments, the pancreatic cancer is an exocrine cancer or a neuroendocrine cancer. In some embodiments, the pancreatic cancer is an exocrine cancer.
- the exocrine pancreatic cancer is selected from the group consisting of pancreatic adenocarcinoma, acinar cell carcinoma, cystadenocarcinoma, pancreatoblastoma, adenosquamous carcinoma, signet ring carcinoma, hepatoid carcinoma, colloid carcinoma, undifferentiated carcinoma, and pancreatic mucinous cystic neoplasm.
- the subject received one or more prior line of therapy for the exocrine pancreatic cancer.
- the subject received one prior line of therapy for the exocrine pancreatic cancer.
- the subject received more than one prior line of therapy for the exocrine pancreatic cancer.
- the pancreatic cancer is pancreatic adenocarcinoma. In some embodiments, the pancreatic adenocarcinoma is pancreatic ductal adenocarcinoma. In some embodiments, the pancreatic cancer is acinar cell carcinoma. In some embodiments, the pancreatic cancer is cystadenocarcinoma. In some embodiments, the pancreatic cancer is pancreatoblastoma. In some embodiments, the pancreatic cancer is adenosquamous carcinoma. In some embodiments, the pancreatic cancer is signet ring carcinoma. In some embodiments, the pancreatic cancer is hepatoid carcinoma. In some embodiments, the pancreatic cancer is colloid carcinoma.
- the pancreatic cancer is undifferentiated carcinoma. In some embodiments, the pancreatic cancer is pancreatic mucinous cystic neoplasm. In some embodiments, the pancreatic cancer is a neuroendocrine cancer. In some embodiments, the antibodies or antibody-drug conjugates of the invention are used in methods of treating lung cancer in a subject. In some embodiments, the antibodies or antibody-drug conjugates of the invention are used in methods of treating non-small cell lung cancer in a subject. In some embodiments, the non-small cell lung cancer has a mutant form of epidermal growth factor receptor (EGFR). In some embodiments, the non-small cell lung cancer has wild-type EGFR.
- EGFR epidermal growth factor receptor
- the subject has received prior therapy with a platinum-based therapy for the non-small cell lung cancer.
- the platinum- based therapy is selected from the group consisting of carboplatin, cisplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin and satraplatin.
- the platinum-based therapy is carboplatin. In some embodiments, the platinum-based therapy is cisplatin. In some embodiments, the platinum-based therapy is oxaliplatin. In some embodiments, the platinum-based therapy is nedaplatin. In some embodiments, the platinum-based therapy is triplatin tetranitrate. In some embodiments, the platinum-based therapy is phenanthriplatin. In some embodiments, the platinum-based therapy is picoplatin. In some embodiments, the platinum-based therapy is satraplatin. In some embodiments, the subject received prior therapy with an inhibitor of PD-1 or PD-L1 for the non-small cell lung cancer. In some embodiments, the subject received prior therapy with an inhibitor of PD-1. In some embodiments, the PD-1 inhibitor is selected from the group consisting of nivolumab
- the subject received prior therapy with an inhibitor of PD-L1.
- the PD-L1 inhibitor is selected from the group consisting of atezolizumab (TECENTRIQ®, MPDL3280A), avelumab (BAVENCIO®), durvalumab and BMS-936559.
- the subject has received prior therapy with a platinum- based therapy and an inhibitor of PD-1 or PD-L1 for the non-small cell lung cancer.
- the antibodies or antibody-drug conjugates of the invention are used in methods of treating thyroid cancer in a subject. In some embodiments, the antibodies or antibody-drug conjugates of the invention are used in methods of treating esophageal cancer in a subject. In some embodiments, the antibodies or antibody-drug conjugates of the invention are used in methods of treating head and neck cancer in a subject. In some embodiments, the antibodies or antibody-drug conjugates of the invention are used in methods of treating breast cancer in a subject. In some embodiments, the breast cancer is selected from the group consisting of HER2 positive, HER2 negative, Estrogen Receptor (ER) positive, ER negative, Progesterone Receptor (PR) positive, PR negative, and triple negative breast cancer.
- the breast cancer is HER2 positive breast cancer. In some embodiments, the breast cancer is HER2 negative breast cancer. In some embodiments, the subject received one or more prior line of therapy for the HER2 negative breast cancer. In some embodiments, the one or more prior line of therapy comprised treatment with a taxane. In some embodiments, the taxane is selected from the group consisting of paclitaxel, docetaxel, and cabazitaxel. In some embodiments, the taxane is paclitaxel. In some embodiments, the taxane is docetaxel. In some embodiments, the taxane is cabazitaxel. In some embodiments, the subject with HER2 negative breast cancer is hormone receptor positive.
- the subject with HER2 negative, hormone receptor positive breast cancer received prior therapy with an inhibitor of CDK4/6. In some embodiments, the subject with HER2 negative, hormone receptor positive breast cancer received prior therapy with a hormonally-directed therapy.
- the breast cancer is ER positive breast cancer. In some embodiments, the breast cancer is ER negative breast cancer. In some embodiments, the breast cancer is PR positive breast cancer. In some embodiments, the breast cancer is PR negative breast cancer.
- the antibodies or antibody-drug conjugates of the invention are used in methods of treating triple negative breast cancer in a subject.
- a triple negative breast cancer is a term of art for a cancer lacking detectable estrogen and progesterone receptors and lacking overexpression of HER2/neu.
- the antibodies or antibody-drug conjugates of the invention are used in methods of treating colorectal cancer in a subject.
- the colorectal cancer is selected from the group consisting of a colorectal adenocarcinoma, a gastrointestinal stromal tumor, a primary colorectal lymphoma, a
- the colorectal cancer is a colorectal adenocarcinoma. In some embodiments, the colorectal cancer is a gastrointestinal stromal tumor. In some embodiments, the colorectal cancer is a primary colorectal lymphoma. In some embodiments, the colorectal cancer is a gastrointestinal carcinoid tumor. In some embodiments, the colorectal cancer is a leiomyosarcoma. In some embodiments, the subject received two or more prior lines of therapy for the colorectal cancer. In some embodiments, the subject received two prior lines of therapy for the colorectal cancer.
- the subject received more than two prior lines of therapy for the colorectal cancer.
- the antibodies or antibody-drug conjugates of the invention are used in methods of treating mesothelioma in a subject.
- the mesothelioma is selected from the group consisting of pleural mesothelioma, peritoneal mesothelioma, pericardial mesothelioma, and testicular mesothelioma.
- the mesothelioma is pleural mesothelioma.
- the subject has received prior therapy with a platinum- based therapy for the pleural mesothelioma.
- the platinum-based therapy is selected from the group consisting of carboplatin, cisplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin and satraplatin.
- the platinum- based therapy is carboplatin.
- the platinum-based therapy is cisplatin.
- the platinum-based therapy is oxaliplatin.
- the platinum-based therapy is nedaplatin.
- the platinum-based therapy is triplatin tetranitrate.
- the platinum-based therapy is phenanthriplatin.
- the platinum-based therapy is picoplatin. In some embodiments, the platinum-based therapy is satraplatin. In some embodiments, the subject received prior therapy with pemetrexed for the pleural mesothelioma. In some embodiments, the mesothelioma is peritoneal mesothelioma. In some embodiments, the mesothelioma is pericardial mesothelioma. In some embodiments, the mesothelioma is testicular mesothelioma. In some embodiments, the antibodies or antibody-drug conjugates of the invention are used in methods of treating choliangiocarcinoma. The treatment can be applied to patients having primary or metastatic tumors of these kinds. The treatment can also be applied to patients who are refractory to conventional treatments, or who have relapsed following a response to such treatments. In some embodiments, the subject is a human.
- Antibodies of the present invention are administered in an effective regime meaning a dosage, route of administration and frequency of administration that delays the onset, reduces the severity, inhibits further deterioration, and/or ameliorates at least one sign or symptom of cancer.
- an effective regime meaning a dosage, route of administration and frequency of administration that delays the onset, reduces the severity, inhibits further deterioration, and/or ameliorates at least one sign or symptom of cancer.
- the regime can be referred to as a therapeutically effective regime.
- the regime can be referred to as a prophylactically effective regime.
- therapeutic or prophylactic efficacy can be observed in an individual patient relative to historical controls or past experience in the same patient.
- Exemplary dosages for a monoclonal antibody are 0.1 mg/kg to 50 mg/kg of the patient's body weight, more typically 1 mg/kg to 30 mg/kg, 1 mg/kg to 20 mg/kg, 1 mg/kg to 15 mg/kg, 1 mg/kg to 12 mg/kg, or 1 mg/kg to 10 mg/kg 1, or 2 mg/kg to 30 mg/kg, 2 mg/kg to 20 mg/kg, 2 mg/kg to 15 mg/kg, 2 mg/kg to 12 mg/kg, or 2 mg/kg to 10 mg/kg, or 3 mg/kg to 30 mg/kg, 3 mg/kg to 20 mg/kg, 3 mg/kg to 15 mg/kg, 3 mg/kg to 12 mg/kg, or 3 mg/kg to 10 mg/kg .
- Exemplary dosages for a monoclonal antibody or antibody drug conjugates thereof are 1 mg/kg to 7.5 mg/kg, or 2 mg/kg to 7.5 mg/kg or 3 mg/kg to 7.5 mg/kg of the subject's body weight, or 0.1-20, or 0.5-5 mg/kg body weight (e.g., 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 mg/kg) or 10-1500 or 200-1500 mg as a fixed dosage.
- the patient is administered a dose of at least 1.5 mg/kg, at least 2 mg/kg or at least 3 mg/kg, administered once every three weeks or greater.
- the dosage depends on the frequency of administration, condition of the patient and response to prior treatment, if any, whether the treatment is prophylactic or therapeutic and whether the disorder is acute or chronic, among other factors.
- Administration can be parenteral, intravenous, oral, subcutaneous, intra-arterial, intracranial, intrathecal, intraperitoneal, topical, intranasal or intramuscular. Administration can also be localized directly into a tumor. Administration into the systemic circulation by intravenous or subcutaneous administration is preferred. Intravenous administration can be, for example, by infusion over a period such as 30-90 min or by a single bolus injection.
- the frequency of administration depends on the half-life of the antibody or conjugate in the circulation, the condition of the patient and the route of administration among other factors.
- the frequency can be daily, weekly, monthly, quarterly, or at irregular intervals in response to changes in the patient's condition or progression of the cancer being treated.
- An exemplary frequency for intravenous administration is between twice a week and quarterly over a continuous course of treatment, although more or less frequent dosing is also possible.
- Other exemplary frequencies for intravenous administration are between weekly or three out of every four weeks over a continuous course of treatment, although more or less frequent dosing is also possible.
- an exemplary dosing frequency is daily to monthly, although more or less frequent dosing is also possible.
- the number of dosages administered depends on the nature of the cancer (e.g., whether presenting acute or chronic symptoms) and the response of the disorder to the treatment.
- acute disorders or acute exacerbations of a chronic disorder between 1 and 10 doses are often sufficient.
- a single bolus dose, optionally in divided form, is sufficient for an acute disorder or acute exacerbation of a chronic disorder.
- Treatment can be repeated for recurrence of an acute disorder or acute exacerbation.
- an antibody can be administered at regular intervals, e.g., weekly, fortnightly, monthly, quarterly, every six months for at least 1,
- compositions for parenteral administration are preferably sterile and substantially isotonic and manufactured under GMP conditions.
- Pharmaceutical compositions can be provided in unit dosage form (i.e., the dosage for a single administration).
- Pharmaceutical compositions can be formulated using one or more physiologically acceptable carriers, diluents, excipients or auxiliaries. The formulation depends on the route of administration chosen.
- antibodies can be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological saline or acetate buffer (to reduce discomfort at the site of injection).
- the solution can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- antibodies can be in lyophilized form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- a suitable vehicle e.g., sterile pyrogen-free water
- concentration of antibody in a liquid formulation can be e.g., 1-100 mg/ml, such as 10 mg/ml.
- Treatment with antibodies of the invention can be combined with chemotherapy, radiation, stem cell treatment, surgery other treatments effective against the disorder being treated.
- Useful classes of other agents that can be administered with antibodies and antibody- drug conjugates to CD 228 as described herein include, for example, antibodies to other receptors expressed on cancerous cells, antitubulin agents (e.g., auristatins), DNA minor groove binders, DNA replication inhibitors, alkylating agents (e.g., platinum complexes such as cisplatin, mono(platinum), bis(platinum) and tri-nuclear platinum complexes and carboplatin), anthracyclines, antibiotics, antifolates, antimetabolites, chemotherapy sensitizers, duocarmycins, etoposides, fluorinated pyrimidines, ionophores, lexitropsins, nitrosoureas, platinols, pre-forming compounds, purine antimetabolites, puromycins, radiation sensitizers, steroids
- Treatment with the anti-CD228 antibody or antibody-drug conjugate can increase the median progression-free survival or overall survival time of patients with tumors (e.g., melanoma, pancreatic cancer, non-small lung cancer, thyroid cancer, head and neck cancer, triple negative breast cancer, colorectal cancer, mesothelioma, choliangiocarcinoma), especially when relapsed or refractory, by at least 30% or 40% but preferably 50%, 60% to 70% or even 100% or longer, compared to the same treatment (e.g., chemotherapy) but without an anti-CD228 antibody alone or as a conjugate.
- tumors e.g., melanoma, pancreatic cancer, non-small lung cancer, thyroid cancer, head and neck cancer, triple negative breast cancer, colorectal cancer, mesothelioma, choliangiocarcinoma
- treatment e.g., standard chemotherapy
- treatment including the anti-CD228 antibody alone or as a conjugate
- treatment can increase the complete response rate, partial response rate, or objective response rate (complete + partial) of patients with tumors by at least 30% or 40% but preferably 50%, 60% to 70% or even 100% compared to the same treatment (e.g., chemotherapy) but without the anti- CD 228 antibody alone or as a conjugate.
- the complete and partial response rates are determined by objective criteria commonly used in clinical trials for cancer, e.g., as listed or accepted by the National Cancer Institute and/or Food and Drug Administration.
- an article of manufacture or kit which comprises an anti-CD228 antibody or anti-CD228 antibody-drug conjugate described herein.
- the article of manufacture or kit may further comprise instructions for use of the anti-CD228 antibody or anti- CD228 antibody-drug conjugate described herein in the methods of the invention.
- the article of manufacture or kit comprises instructions for the use of an anti-CD228 antibody or anti-CD228 antibody-drug conjugate described herein in methods for treating cancer (e.g., melanoma and other carcinomas, including pancreatic cancer, non-small lung cancer, thyroid cancer, head and neck cancer, breast cancer, such as triple negative breast cancer, colorectal cancer, mesothelioma or choliangiocarcinoma) in a subject comprising administering to the subject an effective amount of an anti-CD228 antibody or anti-CD228 antibody-drug conjugate described herein.
- the cancer is melanoma.
- the cancer is pancreatic cancer.
- the cancer is non small lung cancer. In some embodiments, the cancer is thyroid cancer. In some embodiments, the cancer is head and neck cancer. In some embodiments, the cancer is breast cancer. In some embodiments, the breast cancer is triple negative breast cancer. In some embodiments, the cancer is colorectal cancer. In some embodiments, the cancer is mesothelioma. In some embodiments, the cancer is choliangiocarcinoma. In some embodiments, the subject is a human.
- the article of manufacture or kit may further comprise a container.
- Suitable containers include, for example, bottles, vials (e.g ., dual chamber vials), syringes (such as single or dual chamber syringes) and test tubes.
- the container is a vial.
- the container may be formed from a variety of materials such as glass or plastic. The container holds the formulation.
- the article of manufacture or kit may further comprise a label or a package insert, which is on or associated with the container, may indicate directions for reconstitution and/or use of the formulation.
- the label or package insert may further indicate that the formulation is useful or intended for subcutaneous, intravenous (e.g., intravenous infusion), or other modes of administration for treating cancer in a subject (e.g., melanoma and other carcinomas, including pancreatic cancer, non-small lung cancer, thyroid cancer, head and neck cancer, breast cancer, such as triple negative breast cancer, colorectal cancer, mesothelioma or choliangiocarcinoma).
- melanoma and other carcinomas including pancreatic cancer, non-small lung cancer, thyroid cancer, head and neck cancer, breast cancer, such as triple negative breast cancer, colorectal cancer, mesothelioma or choliangiocarcinoma.
- the container holding the formulation may be a single-use vial or a multi-use vial, which allows for repeat administrations of the reconstituted formulation.
- the article of manufacture or kit may further comprise a second container comprising a suitable diluent.
- the article of manufacture or kit may further include other materials desirable from a commercial, therapeutic, and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
- the article of manufacture or kit herein optionally further comprises a container comprising a second medicament, wherein the anti-CD228 antibody or anti-CD228 antibody- drug conjugate is a first medicament, and which article or kit further comprises instructions on the label or package insert for treating the subject with the second medicament, in an effective amount.
- the second medicament is for eliminating or reducing the severity of one or more adverse events.
- the anti-CD228 antibody or anti-CD228 antibody-drug conjugate is present in the container as a lyophilized powder.
- the lyophilized powder is in a hermetically sealed container, such as a vial, an ampoule or sachette, indicating the quantity of the active agent.
- an ampoule of sterile water for injection or saline can be, for example, provided, optionally as part of the kit, so that the ingredients can be mixed prior to administration.
- kits can further include, if desired, one or more of various conventional pharmaceutical components, such as, for example, containers with one or more pharmaceutically acceptable carriers, additional containers, etc., as will be readily apparent to those skilled in the art.
- Printed instructions either as inserts or as labels, indicating quantities of the components to be administered, guidelines for administration, and/or guidelines for mixing the components can also be included in the kit.
- the anti-CD228 antibodies described herein can be used for detecting CD228 in the context of clinical diagnosis or treatment or in research. Expression of CD228 on a cancer provides an indication that the cancer is amenable to treatment with the antibodies of the present invention.
- the antibodies can also be sold as research reagents for laboratory research in detecting cells bearing CD228 and their response to various stimuli. In such uses, monoclonal antibodies can be labeled with fluorescent molecules, spin-labeled molecules, enzymes or radioisotypes, and can be provided in the form of kit with all the necessary reagents to perform the assay for CD228.
- the antibodies described herein can be used to detect CD228 protein expression and determine whether a cancer is amenable to treatment with CD228 ADCs.
- hL49 HALC
- HALC hL49
- the antibodies can also be used to purify CD228, e.g., by affinity chromatography.
- the light chain variable region comprises:
- a humanized anti-CD228 antibody, or antigen-binding fragment thereof comprising a heavy chain variable region comprising the three Kabat CDRs of SEQ ID NO: 7, wherein position H27 is occupied by D, position H30 is occupied by T, position H47 is occupied by Y, position H71 is occupied by R, and position H78 is occupied by Y, and a light chain variable region comprising the three Kabat CDRs of SEQ ID NO: 8, wherein position L2 is occupied by F, position L36 is occupied by Y and position L46 is occupied by L.
- the antigen-binding fragment is selected from the group consisting of Fab, Fab’, F(ab’)2, Fab’-SH, Fv, diabody, linear antibody, and single-chain antibody fragment.
- An antibody-drug conjugate comprising the antibody or antigen-binding fragment of any one of embodiments 1-17 conjugated to a cytotoxic or cytostatic agent.
- Ab is the antibody hL49, n is 12, R PR is hydrogen, R 21 is CH3, and p denotes a number from 1 to 16.
- a vector comprising the nucleic acid of embodiment 26.
- a host cell comprising the nucleic acid of embodiment 26.
- the host cell of embodiment 29, wherein the host cell is a Chinese hamster ovary (CHO) cell.
- a method of producing an anti-CD228 antibody or antigen-binding fragment thereof comprising culturing the host cell of embodiment 29 or embodiment 30 under a condition suitable for production of the anti- CD228 antibody or antigen-binding fragment thereof.
- a method of producing an anti- CD228 antibody-drug conjugate comprising culturing the host cell of embodiment 29 or embodiment 30 under a condition suitable for production of an anti-CD228 antibody; isolating the anti-CD228 antibody produced from the host cell; and conjugating the anti-CD228 antibody to a cytotoxic or cytostatic agent.
- a method of treating cancer in a subject comprising administering to the subject the antibody or antigen-binding fragment of any one of embodiments 1-17 or the antibody-drug conjugate of any one of embodiments 18-25.
- any one of embodiments 41-50, wherein the cancer is selected from the group consisting of melanoma, pancreatic cancer, mesothelioma, colorectal cancer, lung cancer, thyroid cancer, breast cancer, choliangiocarcinoma, esophageal cancer and head and neck cancer.
- cutaneous melanoma is selected from the group consisting of superficial spreading melanoma, nodular melanoma, acral lentiginous melanoma, lentigo maligna melanoma, and desmoplastic melanoma.
- mesothelioma is selected from the group consisting of pleural mesothelioma, peritoneal mesothelioma, pericardial mesothelioma, and testicular mesothelioma.
- breast cancer is selected from the group consisting of HER2 positive, HER2 negative, Estrogen Receptor (ER) positive, ER negative, Progesterone Receptor (PR) positive, PR negative, and triple negative breast cancer.
- ER Estrogen Receptor
- PR Progesterone Receptor
- the colorectal cancer is selected from the group consisting of a colorectal adenocarcinoma, a gastrointestinal stromal tumor, a primary colorectal lymphoma, a gastrointestinal carcinoid tumor, and a leiomyosarcoma.
- pancreatic cancer is an exocrine cancer or a neuroendocrine cancer.
- exocrine cancer is selected from the group consisting of pancreatic adenocarcinoma, acinar cell carcinoma, cystadenocarcinoma, pancreatoblastoma, adenosquamous carcinoma, signet ring carcinoma, hepatoid carcinoma, colloid carcinoma, undifferentiated carcinoma, and pancreatic mucinous cystic neoplasm.
- pancreatic adenocarcinoma is pancreatic ductal adenocarcinoma.
- the subject received one or more prior line of therapy for the pancreatic cancer.
- a kit comprising:
- a pharmaceutical composition comprising the antibody or antigen-binding fragment of any one of embodiments 1-17 or the antibody-drug conjugate of any one of embodiments 18-25 and one or more agents selected from the group consisting of a physiologically acceptable carrier, a diluent, an excipient and an auxiliary.
- any one of embodiments 90-99, wherein the cancer is selected from the group consisting of melanoma, pancreatic cancer, mesothelioma, colorectal cancer, lung cancer, thyroid cancer, breast cancer, choliangiocarcinoma, esophageal cancer and head and neck cancer.
- cutaneous melanoma is selected from the group consisting of superficial spreading melanoma, nodular melanoma, acral lentiginous melanoma, lentigo maligna melanoma, and desmoplastic melanoma.
- the antibody or antigen-binding fragment of embodiment 120 wherein the subject received prior therapy with an inhibitor of PD-1.
- 122. The antibody or antigen-binding fragment of embodiment 100, wherein the breast cancer is selected from the group consisting of HER2 positive, HER2 negative, Estrogen Receptor (ER) positive, ER negative, Progesterone Receptor (PR) positive, PR negative, and triple negative breast cancer.
- the antibody or antigen-binding fragment of embodiment 128, wherein the colorectal cancer is selected from the group consisting of a colorectal adenocarcinoma, a gastrointestinal stromal tumor, a primary colorectal lymphoma, a gastrointestinal carcinoid tumor, and a leiomyosarcoma.
- pancreatic cancer is an exocrine cancer or a neuroendocrine cancer.
- exocrine cancer is selected from the group consisting of pancreatic adenocarcinoma, acinar cell carcinoma, cystadenocarcinoma, pancreatoblastoma, adenosquamous carcinoma, signet ring carcinoma, hepatoid carcinoma, colloid carcinoma, undifferentiated carcinoma, and pancreatic mucinous cystic neoplasm.
- pancreatic adenocarcinoma is pancreatic ductal adenocarcinoma.
- 134 The antibody or antigen-binding fragment of embodiment 132 or 133, wherein the subject received one or more prior line of therapy for the pancreatic cancer.
- embodiment 137 wherein the subject has been previously treated with one or more therapeutic agents and did not respond to the treatment, wherein the one or more therapeutic agents is not the antibody, antigen-binding fragment, or antibody-drug conjugate.
- embodiment 137 wherein the subject has been previously treated with one or more therapeutic agents and relapsed after the treatment, wherein the one or more therapeutic agents is not the antibody, antigen-binding fragment, or antibody-drug conjugate.
- embodiment 137 wherein the subject has been previously treated with one or more therapeutic agents and has experienced disease progression during treatment, wherein the one or more therapeutic agents is not the antibody, antigen-binding fragment, or antibody-drug conjugate.
- embodiment 141 wherein the advanced stage cancer is a stage 3 or stage 4 cancer.
- any one of embodiments 137-145 wherein the subject received prior treatment with standard of care therapy for the cancer and failed the prior treatment.
- the cancer is selected from the group consisting of melanoma, pancreatic cancer, mesothelioma, colorectal cancer, lung cancer, thyroid cancer, breast cancer, choliangiocarcinoma, esophageal cancer and head and neck cancer.
- cutaneous melanoma is selected from the group consisting of superficial spreading melanoma, nodular melanoma, acral lentiginous melanoma, lentigo maligna melanoma, and desmoplastic melanoma.
- mesothelioma is selected from the group consisting of pleural mesothelioma, peritoneal mesothelioma, pericardial mesothelioma, and testicular mesothelioma.
- embodiment 159 wherein the subject has received prior therapy with a platinum-based therapy.
- breast cancer is selected from the group consisting of HER2 positive, HER2 negative, Estrogen Receptor (ER) positive, ER negative, Progesterone Receptor (PR) positive, PR negative, and triple negative breast cancer.
- ER Estrogen Receptor
- PR Progesterone Receptor
- colorectal cancer is selected from the group consisting of a colorectal adenocarcinoma, a gastrointestinal stromal tumor, a primary colorectal lymphoma, a gastrointestinal carcinoid tumor, and a leiomyosarcoma.
- pancreatic cancer is an exocrine cancer or a neuroendocrine cancer.
- embodiment 178 wherein the exocrine cancer is selected from the group consisting of pancreatic adenocarcinoma, acinar cell carcinoma, cystadenocarcinoma, pancreatoblastoma, adenosquamous carcinoma, signet ring carcinoma, hepatoid carcinoma, colloid carcinoma, undifferentiated carcinoma, and pancreatic mucinous cystic neoplasm.
- the pancreatic adenocarcinoma is pancreatic ductal adenocarcinoma.
- CD228 copy number on the cell surface of various cancer cell lines was determined using a murine CD228 mAb as primary antibody and the DAKO QiFiKit flow cytometric indirect assay as described by the manufacturer (DAKO A/S, Glostrup, Denmark) and evaluated with a Attune NxT Flow Cytometer. The resulting number of CD228 molecules expressed per cell are shown in Table 1.
- Tumor tissue arrays were obtained from commercial sources. Tumor formalin fixed and paraffin embedded (FFPE) tissues were purchased from US Biomax Inc. All samples were processed on Bond-MaxTM autostainer (Leica).
- FFPE paraffin embedded
- FFPE slides sectioned on glass slides were de-paraffmized using BondTM Dewax solution (Leica, cat # AR9222) at 72°C and rehydrated.
- Antigen retrieval was performed using EDTA based BondTM Epitope Retrieval Solution 2 (Leica, cat # AR9640) for 20 min at 95- 100°C before incubation with the primary anti-CD228 antibody (Sigma; cat # HP .4004880)
- Isotype-matched rabbit IgGl was used as negative control for background staining.
- IHC staining we used either a Refine DAB kit or an alkaline phosphatase based detection kit: BondTM Polymer AP Red Detection kit (Leica, cat.
- FIG. 1 shows a high level of CD228 expression in melanoma cancer patient samples providing a strong rationale to treat these tumors using a CD228 ADC.
- FIG. 2 shows a high level of CD228 expression in mesothelioma cancer patient samples providing a strong rationale to treat these tumors using a CD228 ADC.
- FIG. 3 shows a high level of CD228 expression in colorectal cancer patient samples providing a strong rationale to treat these tumors using a CD228 ADC.
- FIG. 4 shows a high level of CD228 expression in triple negative (HR-, PgR-, Her2-) breast cancer patient samples (upper panel) and Her2-HR+ breast cancer patient samples (lower panel) providing a strong rationale to treat these tumors using a CD228 ADC.
- FIG. 5 shows a high level of CD228 expression in pancreatic cancer patient samples providing a strong rationale to treat these tumors using a CD228 ADC.
- FIG. 6 shows a high level of CD228 expression in squamous non-small lung cancer patient samples (upper panel) and adenocarcinoma non-small cell lung cancer patient samples (lower panel) providing a strong rationale to treat these tumors using a CD228 ADC.
- Various anti-CD228 antibodies were conjugated to the drug MMAE via the linker MDpr-PEG(12)-gluc, such that the average drug load per antibody is about 8.
- the conjugation method is described in U.S. Publ. No. 2018/0092984.
- Tumor cells were incubated with CD228 antibody drug conjugates (ADCs) for 96-144 hours at 37 °C.
- a human IgG ADC was used as a negative control.
- Cell viability was measured using Cell Titer Glo according to manufacturer’s instructions. Fluorescent signal was measured on a Fusion HT fluorescent plate reader (Perkin Elmer, Waltham, MA). The data was normalized to untreated cells, and x50 values were calculated using Graph Pad software.
- Chimeric L49 (cL49) and mouse (mL49) ADCs were superior to all other anti- CD228 ADCs, particularly in cell lines with lower CD228 expression.
- the mouse antibody mL49 (Siemers et al, 1997, Bioconjug. Chem. 8:510-9) was used as the starting point or donor antibody for humanization.
- Suitable human acceptor sequences were genomic sequences provided by hIGHV4-59 and hIGHJ4 for the heavy chain and by hIGKV2-30 and MGKJ2 for the light chain.
- the human acceptor sequences show 70 (heavy-chain) and 84 (light-chain) percentage identity to the donor sequences in the variable region frameworks, when the CDRs are defined according to the Kabat numbering scheme.
- Binding curves for each resulting antibody was determined by a competition binding assay. Briefly, lxlO 5 RPMI-7951 cells stably expressing human CD228 were aliquoted per well of a 96- well v-bottom plates on ice. The cells were incubated for 1 hour with 5 nM AlexaFluor- 647 (AF) labeled parental murine CD228 m.4b and increasing concentrations (from 0.06 nM to 1000 nM) of unlabeted humanized CD228 mAh, with various combinations of humanized light chains LA -LB and humanized heavy chains HA- HC. Cells were pelleted and washed 3 times with PBS/BSA.
- AF AlexaFluor- 647
- the cells were pelleted and resuspended in 125 m ⁇ of PBS/BSA. Fluorescence was analyzed by flow ⁇ ' cytometry, using percent of saturated fluorescent signal to determine percent labeled murine CD228 mAb bound. The binding curves for recombinant human anti- CD228 antibodies are shown in FIG. 12A-12F.
- the KD for each resulting antibody was then determined by a saturation binding assay. Briefly, lxlO 5 RPMI-7951 cells stably expressing human CD228 were aliquoted per well of a 96-well v-bottom plates. Each CD228 antibody was added in concentrations ranging from 0.05 pM to 340 nM and incubated on ice for 60 minutes. Cells were pelleted and washed 3X with PBS/BSA followed by addition of lOug/ml of a PE labeled anti-human IgG goat secondary antibody and incubated on ice for an additional 60 minutes.
- hF49-HALC was conjugated to 8-loads of either MDpr-PEG(12)-gluc-MMAE, Auristatin T, Tubulysin M, or Fipophilic MMAF, 2-loads of either MC-VC-MMAE or MDpr- gluc-MMAE, or 2-loads of PBD.
- the conjugation method is described in U.S. Publ. No.
- LC-MS was performed on two different systems.
- LC-MS system 1 consisted of a ZMD Micromass mass spectrometer interfaced to an HP Agilent 1100 HPLC instrument equipped with a 02
- LC-MS system 2 consisted of a Waters Xevo G2 Tof mass spectrometer interfaced to a Waters 2695 Separations Modide with a Waters 2996 Photodiode Array Detector; the column, mobile phases, gradient, and flow' rate were same as for LC-MS system 1.
- UPLC-MS was carried out on a Waters SQ mass detector interfaced to an Acquity Ultra Performance LC equipped with an Acquity UPLC BEH Cl 8 2.1 x50 mm, 1.7 pm reverse phase column.
- Preparative HPLC was earned out on a Varian ProStar 210 solvent delivery system configured with a Varian ProStar 330 PDA detector. Products were purified over a C12
- N-liydroxysuceimmide (178 mg, 1.5 mmol) was added, followed by l-ediyl-3-(3-dimethylaminopropyl) carbodiimkle (298 mg, 1.5 mmol).
- the reaction was stirred at room temperature under nitrogen for 3 hours.
- Aqueous workup was achieved through dilution into 120 ml. water; tire aqueous layer was then extracted three times with 60 ml. ethyl acetate. The combined organic layer was then washed with brine, dried over sodium sulfate, and concentrated to dryness.
- Compound 11 was conjugated via its interchain thiols to the anti-CD228 antibody at an average drug loading of 8 drugs per antibody using methods known in the art (see, for example, U.S. Pat. No. 7,659,241).
- ADC antibody drug conjugate
- hOO or IgG A non-binding ADC
- hL49 ADCs achieve single digit ng/ml ICso values across a panel of cell lines with CD228 expression ranging from 16,000 to 450,000.
- the percent of viable cells was determined after treatment with various concentrations of hL49 conjugated to different drug linkers with different amounts of MMAE.
- the resulting percent of viable cells for A2058 cells treated with hL49-MC-val-cit- PAB-MMAE (4), hL49-MP-gluc-MMAE (4), hL49-MP-gluc-MMAE (8) at various antibody- drug conjugate (ADC) concentrations are shown in FIG. 14A.
- the 8-load MP-gluc-MMAE is superior to the 4-load MP-gluc-MMAE and the MC-val-cit-PAB-MMAE drug linker in vitro.
- the 4-load MP-gluc-MMAE is superior to the MC-val-cit-PAB-MMAE drug linker in vitro despite containing an identical amount of the same drug (MMAE).
- FIG. 14B The resulting percent of viable cells for A375 cells treated with hL49-MC-val-cit- PAB-MMAE (4), hL49-MP-gluc-MMAE (4), hL49-MP-gluc-MMAE (8) at various antibody- drug conjugate (ADC) concentrations are shown in FIG. 14B.
- the 8-load MP-gluc-MMAE is superior to the 4-load MP-gluc-MMAE and the MC-val-cit-PAB-MMAE drug linker in vitro.
- the 4-load MP-gluc-MMAE is superior to the MC-val-cit-PAB-MMAE drug linker in vitro despite containing an identical amount of the same drug (MMAE).
- FIG. 14C The resulting percent of viable cells for Colo-853 cells treated with hL49-MC-val-cit- PAB-MMAE (4), hL49-MP-gluc-MMAE (4), hL49-MP-gluc-MMAE (8) at various antibody- drug conjugate (ADC) concentrations are shown in FIG. 14C.
- the 8-load MP-gluc-MMAE is superior to the 4-load MP-gluc-MMAE and the MC-val-cit-PAB-MMAE drug linker in vitro.
- mice 7-8 animals/group were implanted with 5xl0 6 cultured A2058 tumor cells in 25% matrigel). Dosing with 1 mg/kg, 3 mg/kg, or 6 mg/kg test ADC began when tumors reached 100 mm 3 (q4d x 4 intraperitoneal injections). Tumor volumes were monitored using calipers and animals were euthanized when tumor volume reached -800-1000 mm 3 . Mean tumor volume plots were continued for each group until one or more animals were euthanized. All animal procedures were performed under a protocol approved by the Institutional Animal Care and Use Committee in a facility accredited by the Association for Assessment and
- hF49-MDpr-gluc-MMAE (8) is superior to 1 mg/kg hF49-MDpr-gluc-MMAE (8) or either concentration of hF49-MC-val-cit-PAB-MMAE (4) in vivo.
- hF49-MDpr-gluc-MMAE (8) is superior to 1 mg/kg hF49-MDpr-gluc-MMAE (8) or either concentration of hF49-MC-val-cit-PAB-MMAE (4) in vivo.
- Example 6 In vivo comparison of ADCs with Tubulysin M and MDpr-PEG(12)-gluc- MMAE
- hL49 conjugated to Tubulysin M or MDpr-PEG(12)-gluc-MMAE showed superiority to other ADCs against A2058 cells, so these ADCs were selected for further assessment at different dosages and with different tumor cell types.
- Nude (nu/nu) mice (6-8 animals/group) were implanted with 2.5xl0 5 cultured A2058, lxl 0 6 SK-MEL-5, 1X10 5 IGR-37, lxlO 6 Colo-853, or lxl 0 6 HP AF-II tumor cells m 25% matrigel.
- NOD/SCID/gc KO (NSG) mice were implanted with 5x10 5 cultured MDA-MB-231 tumor cells.
- LU0697 squamous NSCFC model was grown in NOD/SCID mice and the LU5200 Adenocarcinoma NSCFC models was grown in BAFB/c Nude mice (3 animals/group).
- Dosing with 0.3 mg/kg, 0.5mg/kg, 1 mg/kg, or 3 mg/kg test ADC began when tumors reached approximately 100 mm 3 (single intraperitoneal injection). Tumor volumes were monitored using calipers and animals were euthanized when tumor volume reached -1000 mm 3 . For the PDX studies, they were terminated 28 days post the final dose regardless of tumor size. Mean tumor volume plots were continued for each group until one or more animals were euthanized. All animal procedures were performed under a protocol approved by the Institutional Animal Care and Use Committee in a facility accredited by the Association for Assessment and Accreditation of Laboratory Animal Care.
- hL49-Tubulysin M and hL49-MDpr-PEG(12)-gluc-MMAE have similar complete response (CR) rates at 3 mg/kg, but hL49-MDpr-PEG(12)-gluc-MMAE is superior at 1 mg/kg.
- Colo-853 tumor volumes over time for untreated mice and mice treated with 0.3, 1 mg/kg or 3 mg/kg hL49-MDpr-PEG(12)-gluc-MMAE (8), or 3 mg/kg IgG-MDpr- PEG(12)-gluc-MMAE (8) are shown in FIG. 22.
- Colo-853 tumors are responsive to treatment by hL49-MDpr-PEG( 12)-gluc-MMAE.
- LU0697 adenocarcinoma NSCLC PDX model tumor volumes over time for untreated mice and mice treated with 1 mg/kg or 3 mg/kg hL49-MDpr-PEG(12)-gluc-MMAE (8), or 3 mg/kg IgG-MDpr-PEG(12)-gluc-MMAE (8) are shown in FIG. 24.
- LU0697 adenocarcinoma NSCL PDX model tumors are responsive to treatment by hL49-MDpr- PEG(12)-gluc-MMAE.
- MDA-MB-231 TNBC tumor volumes over time for untreated mice and mice treated with 0.5 mg/kg or 1 mg/kg hL49-MDpr-PEG(12)-gluc-MMAE (8), or 0.5 mg/kg or 1 mg/kg IgG-MDpr-PEG( 12)-gluc-MMAE (8) are shown in FIG. 25.
- MDA-MB-231 TNBC tumor are responsive to treatment by hL49-MDpr-PEG(12)-gluc-MMAE.
- HPAF-II tumor volumes over time for untreated mice and mice treated with 3 mg/kg IgG-MDpr-PEG(12)-gluc-MMAE (8), or 0.3 mg/kg, 1 mg/kg or 3 mg/kg hL49- MDpr-PEG(12)-gluc-MMAE (8) are shown in FIG. 26.
- HPAF-II tumors are responsive to treatment by hL49-MDpr-PEG(12)-gluc-MMAE.
- the percent change in tumor volume in response to treatment with hL49-MDpr- PEG(12)-gluc-MMAE (8) was assessed in 22 different PDX models of triple-negative breast cancer. NCr or Nude mice were implanted with an amount of tumor cells empirically determined for each model. Dosing with 3 mg/kg of hL49-MDpr-PEG(12)-gluc-MMAE (8) began when tumors reached approximately 150-300 mm 3 . Tumor volumes were monitored using calipers. The percent change in tumor volume for each mouse was calculated at either the time of best response or 7 days post dose with hL49-MDpr-PEG(12)-gluc-MMAE (8) and is shown in FIG. 27.
- Example 7-1 Patient-derived xenograft models of various CD228-expressing cancers
- Example 7 Additional experiments were performed as described in Example 7 to assess the ability of hL49-MDpr-PEG(12)-gluc-MMAE (8) to inhibit tumor growth in various CD228- expressing cancers.
- TNBC triple negative breast cancer
- NSCLC non-small cell lung cancer
- ADCC Antibody-dependent Cellular Cytotoxicity
- NK CD16 + CD56 + cells were prepared from non-adherent peripheral blood mononuclear cells (PBMCs) obtained from normal FcyRIIIA 158V/V donors (Lifeblood, Memphis, TN) with immunomagnetic beads (EasySep, StemCell Technologies, Vancouver, BC, Canada). Viable NK cells were added to target cells at an effector to target cell ratio of 10: 1.
- a human IgG l i (Ancell, Bayport, MN) was used as negative control in this assay. After 4 hours of incubation, supernatants were collected and dried overnight on Luma plates. Gamma radiation emitted from lysed cells was then detected using the TopCount Microplate Scintillation and Luminescence Counter (Perkin Elmer, Waltham, Massachusetts). The % specific lysis (ADCC activity) for two patients is shown in FIG. 28A-28B. hL49-MDpr-PEG(12)-gluc-MMAE (hL49-5088) has reduced ADCC activity compared to hL49 mAb.
- Nude mice were intravenously administered hL49-MDpr-PEG(12)-gluc-MMAE or cL235- MDpr-PEG(12)-gluc-MMAE and Sprague-Dawley rats were intravenously administered hL49-MDpr-PEG(12)-gluc-MMAE .
- Plasma concentrations of the ADC were measured over time using Tab ELISA with an anti-human antibody as the capture antibody. The results are shown in FIG. 29A (mice) and FIG. 29B (rats). Resulting PK parameters are shown in Table 10 (mice) and Table 11 (rats).
- Additional anti-CD228 antibodies were conjugated to MDpr-PEG(12)-gluc-MMAE. These additional anti-CD228 antibodies (designated cL235 (see Rolland Y., Pigment Cell Melanoma Res 2009, 22:86-98) and Abl-9) have binding affinities that are similar to that of hL49, unlike the commercial antibodies tested in Table 2 (Santa Cruz Cat. #271633, R&D Cat. #893416, and Biolegend Cat. No. #363101).
- ADCs CD228 antibody drug conjugates
- Table 13 Percent viable cells remaining at highest dose of anti-CD228 antibody-drug conjugate for various cancer cells
- mice (6 animals/group) were implanted with lxlO 6 cultured A375, lxlO 5 IGR37, or 2.5xl0 5 A2058 tumor cells in 25% matrigel). Dosing with lmg/kg (A2058) or 3 mg/kg test ADC began when tumors reached 100 mm 3 (single dose intraperitoneal injections). Tumor volumes were monitored using calipers and animals were euthanized when tumor volume reached -800 mm 3 . Mean tumor volume plots were continued for each group until one or more animals were euthanized. All animal procedures were performed under a protocol approved by the Institutional Animal Care and Use Committee in a facility accredited by the Association for Assessment and Accreditation of Laboratory Animal Care.
- FIG. 30A The resulting A2058 tumor volumes over time for untreated mice and mice treated with various antibodies are shown in FIG. 30A.
- FIG. 30B shows the percent of animals with ⁇ 4- fold tumor increase over time for each treatment condition.
- the number of complete responses (CRs) and median tumor quadrupling time for each ADC and each cell line are shown in Table 14.
- the rate of conjugate cleavage over time was investigated using a fluorescence assay.
- the fluorescent moiety AF647 was conjugated to the anti-CD228 antibody hL49 either directly to the 8 native cysteines or via a glucuronide linker.
- a quenching reagent Tide Quencher 5WS succinimidyl ester (TQ5WS) was added via lysine residues such that there were approximately 4 per antibody.
- TQ5WS Tide Quencher 5WS succinimidyl ester
- A375 cells were treated with hF49 antibodies that were conjugated to a vcQFOl, which is comprised of the TQ5WS linked to a Cy5 fluorophore via a Val-Cit-PAB linker at an approximate ratio of 2 molecules per antibody. Similar to the reagent described in the previous section, Cy5 remains quenched when it is intact on the antibody and will only be fluorescent when it is cleaved away from the TQ5WS quencher. 2 pg/ml of hF49-vcQF01 was then added and allowed to bind to cells. For the pulse treatment, labeled hF49 antibodies were washed after 30 minutes to remove unbound labeled hF49 antibodies.
- Cycloheximide (CHX) was used to inhibit protein synthesis.
- An increase in fluorescence signal over time occurred in the presence of cycloheximide in both Colo-853 (FIG. 33A) and A375 (FIG. 33B cells), but was reduced compared to cells not treated with cycloheximide.
- CD228 is recycled back to the cell surface, even in the absence of protein synthesis.
- Various additional anti-CD228 antibodies were assessed for their ability to internalize and catabolize the fluorescent moiety AF647.
- A375 cells were treated with anti-CD228 antibodies that were conjugated to QF01, which is comprised of the quenching agent Tide Quencher 5WS succinimidyl ester (TQ5WS) linked to a Cy5 fluorophore via a glucuronide linker (glue) at an approximate ratio of 2 molecules per antibody. Cy5 remains quenched when it is intact on the antibody and will only be fluorescent when it is cleaved away from the TQ5WS quencher. Labeled anti-CD228 antibodies were washed after 30 minutes to remove unbound labeled anti-CD228 antibodies.
- QF01 which is comprised of the quenching agent Tide Quencher 5WS succinimidyl ester (TQ5WS) linked to a Cy5 fluorophore via a glucuronide linker (glue) at an approximate ratio of 2 molecules per
- anti-CD228 antibodies have binding affinities that are similar to that of hL49.
- Tumor cells were incubated with anti-CD228 antibodies and imaging assays were conducted to determine the fluorescence intensity per cell over time (FIG. 35 A).
- Similar experiments were conducted using hL49 or other anti-CD228 antibodies conjugated to MDpr-PEG(12)-gluc-MMAE (8). After 24 hours, intracellular drug concentration was measured for each ADC (FIG. 35B).
- FIG. 35B intracellular drug concentration was measured for each ADC
Landscapes
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| BR112021015477A BR112021015477A2 (pt) | 2019-02-05 | 2020-02-03 | Anticorpos anti-cd228 e conjugados anticorpo-fármaco |
| MX2021009138A MX2021009138A (es) | 2019-02-05 | 2020-02-03 | Anticuerpos anti-cd228 y conjugados de anticuerpo-farmaco. |
| KR1020217027987A KR20210125511A (ko) | 2019-02-05 | 2020-02-03 | 항-cd228 항체 및 항체-약물 컨쥬게이트 |
| EP20709016.8A EP3920968A1 (en) | 2019-02-05 | 2020-02-03 | Anti-cd228 antibodies and antibody-drug conjugates |
| CA3128097A CA3128097C (en) | 2019-02-05 | 2020-02-03 | Anti-cd228 antibodies and antibody-drug conjugates |
| AU2020219732A AU2020219732A1 (en) | 2019-02-05 | 2020-02-03 | Anti-CD228 antibodies and antibody-drug conjugates |
| EA202192173A EA202192173A1 (ru) | 2019-11-12 | 2020-02-03 | Анти-cd228 антитела и конъюгаты антитело-лекарственное средство |
| SG11202107551WA SG11202107551WA (en) | 2019-02-05 | 2020-02-03 | Anti-cd228 antibodies and antibody-drug conjugates |
| CN202080026997.1A CN113710271B (zh) | 2019-02-05 | 2020-02-03 | 抗cd228抗体和抗体-药物缀合物 |
| JP2021545378A JP7754715B2 (ja) | 2019-02-05 | 2020-02-03 | 抗cd228抗体及び抗体薬物コンジュゲート |
| IL284974A IL284974A (en) | 2019-02-05 | 2021-07-19 | Anti-cd228 antibodies and antibody-drug conjugates |
| JP2025021046A JP2025072613A (ja) | 2019-02-05 | 2025-02-12 | 抗cd228抗体及び抗体薬物コンジュゲート |
Applications Claiming Priority (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962801590P | 2019-02-05 | 2019-02-05 | |
| US62/801,590 | 2019-02-05 | ||
| US201962824923P | 2019-03-27 | 2019-03-27 | |
| US62/824,923 | 2019-03-27 | ||
| US201962879660P | 2019-07-29 | 2019-07-29 | |
| US62/879,660 | 2019-07-29 | ||
| US201962882016P | 2019-08-02 | 2019-08-02 | |
| US62/882,016 | 2019-08-02 | ||
| US201962934424P | 2019-11-12 | 2019-11-12 | |
| US62/934,424 | 2019-11-12 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020163225A1 true WO2020163225A1 (en) | 2020-08-13 |
Family
ID=69740807
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/016381 Ceased WO2020163225A1 (en) | 2019-02-05 | 2020-02-03 | Anti-cd228 antibodies and antibody-drug conjugates |
Country Status (12)
| Country | Link |
|---|---|
| US (3) | US11617798B2 (https=) |
| EP (1) | EP3920968A1 (https=) |
| JP (2) | JP7754715B2 (https=) |
| KR (1) | KR20210125511A (https=) |
| CN (1) | CN113710271B (https=) |
| AU (1) | AU2020219732A1 (https=) |
| BR (1) | BR112021015477A2 (https=) |
| IL (1) | IL284974A (https=) |
| MX (1) | MX2021009138A (https=) |
| SG (1) | SG11202107551WA (https=) |
| TW (1) | TWI872044B (https=) |
| WO (1) | WO2020163225A1 (https=) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021207701A1 (en) | 2020-04-10 | 2021-10-14 | Seagen Inc. | Charge variant linkers |
| WO2022098972A1 (en) | 2020-11-08 | 2022-05-12 | Seagen Inc. | Combination-therapy antibody drug conjugate with immune cell inhibitor |
| WO2022251850A1 (en) | 2021-05-28 | 2022-12-01 | Seagen Inc. | Anthracycline antibody conjugates |
| WO2023178289A2 (en) | 2022-03-17 | 2023-09-21 | Seagen Inc. | Camptothecin conjugates |
| WO2024064713A1 (en) * | 2022-09-21 | 2024-03-28 | Seagen Inc. | Novel fusion protein specific for cd137 and cd228 |
| WO2024064714A3 (en) * | 2022-09-21 | 2024-05-02 | Seagen Inc. | Antibodies that bind cd228 |
| US12036286B2 (en) | 2021-03-18 | 2024-07-16 | Seagen Inc. | Selective drug release from internalized conjugates of biologically active compounds |
| WO2025090774A1 (en) | 2023-10-24 | 2025-05-01 | Seagen Inc. | Chemotherapeutic compounds and methods of use |
| EP4534558A4 (en) * | 2022-05-31 | 2026-04-22 | Shandong Boan Biotechnology Co Ltd | ANTI-CD228 ANTIBODY AND ASSOCIATED DRUG CONJUGATE |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4518905A1 (en) * | 2022-05-06 | 2025-03-12 | Seagen Inc. | Immunomodulatory antibody-drug conjugates |
| WO2025025731A1 (zh) * | 2023-07-28 | 2025-02-06 | 山东博安生物技术股份有限公司 | 一种适用于免疫组化检测cd228的诊断抗体 |
Citations (42)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4474893A (en) | 1981-07-01 | 1984-10-02 | The University of Texas System Cancer Center | Recombinant monoclonal antibodies |
| EP0216846A1 (en) | 1985-04-01 | 1987-04-08 | Celltech Ltd | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same. |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4714681A (en) | 1981-07-01 | 1987-12-22 | The Board Of Reagents, The University Of Texas System Cancer Center | Quadroma cells and trioma cells and methods for the production of same |
| EP0323997A1 (en) | 1987-07-23 | 1989-07-19 | Celltech Limited | Recombinant dna expression vectors |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US4880935A (en) | 1986-07-11 | 1989-11-14 | Icrf (Patents) Limited | Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates |
| WO1989012624A2 (en) | 1988-06-14 | 1989-12-28 | Cetus Corporation | Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom |
| US4925648A (en) | 1988-07-29 | 1990-05-15 | Immunomedics, Inc. | Detection and treatment of infectious and inflammatory lesions |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| WO1992005793A1 (en) | 1990-10-05 | 1992-04-16 | Medarex, Inc. | Targeted immunostimulation with bispecific reagents |
| WO1992008802A1 (en) | 1990-10-29 | 1992-05-29 | Cetus Oncology Corporation | Bispecific antibodies, method of production, and uses thereof |
| US5122368A (en) | 1988-02-11 | 1992-06-16 | Bristol-Myers Squibb Company | Anthracycline conjugates having a novel linker and methods for their production |
| WO1992022653A1 (en) | 1991-06-14 | 1992-12-23 | Genentech, Inc. | Method for making humanized antibodies |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1993017715A1 (en) | 1992-03-05 | 1993-09-16 | Board Of Regents, The University Of Texas System | Diagnostic and/or therapeutic agents, targeted to neovascular endothelial cells |
| EP0629240A1 (en) | 1992-02-19 | 1994-12-21 | Scotgen Limited | Altered antibodies, products and processes relating thereto |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5573920A (en) | 1991-04-26 | 1996-11-12 | Surface Active Limited | Antibodies, and methods for their use |
| US5601819A (en) | 1988-08-11 | 1997-02-11 | The General Hospital Corporation | Bispecific antibodies for selective immune regulation and for selective immune cell binding |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5824805A (en) | 1995-12-22 | 1998-10-20 | King; Dalton | Branched hydrazone linkers |
| US5834597A (en) | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| US5879936A (en) | 1988-04-18 | 1999-03-09 | Aluguisse Holding A.G. | Recombinant DNA methods, vectors and host cells |
| US5891693A (en) | 1990-01-25 | 1999-04-06 | Alusuisse Holdings A.G. | Recombinant DNA methods vectors and host cells |
| US5981216A (en) | 1985-04-01 | 1999-11-09 | Alusuisse Holdings A.G. | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| US6130237A (en) | 1996-09-12 | 2000-10-10 | Cancer Research Campaign Technology Limited | Condensed N-aclyindoles as antitumor agents |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US6624821B1 (en) | 1999-02-05 | 2003-09-23 | Samsung Electronics Co., Ltd. | Image texture retrieving method and apparatus thereof |
| WO2004050867A1 (en) * | 2002-12-02 | 2004-06-17 | Seattle Genetics, Inc. | MODIFIED L49-sFv EXHIBITING INCREASED STABILITY AND METHODS OF USE THEREOF |
| US6881557B2 (en) | 2001-07-12 | 2005-04-19 | Arrowsmith Technologies Llp | Super humanized antibodies |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| WO2006036291A2 (en) | 2004-07-30 | 2006-04-06 | Rinat Neuroscience Corp. | Antibodies directed against amyloid-beta peptide and methods using same |
| US20060074008A1 (en) | 2002-07-31 | 2006-04-06 | Senter Peter D | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US20080241128A1 (en) | 2005-07-18 | 2008-10-02 | Seattle Genetics, Inc. | Beta-Glucuronide-Linker Drug Conjugates |
| US20090018086A1 (en) | 2005-07-07 | 2009-01-15 | Seattle Genetics, Inc. | Monomethylvaline Compounds Having Phenylalanine Side-Chain Replacements at the C-Terminus |
| US20090111756A1 (en) | 2005-07-07 | 2009-04-30 | Seattle Genectics, Inc. | Monomethylvaline Compounds Having Phenylalanine Carboxy Modifications at the C-Terminus |
| US20100158909A1 (en) | 2006-12-01 | 2010-06-24 | Seattle Genetics, Inc. | Variant Target Binding Agents and Uses Thereof |
| US7968687B2 (en) | 2007-10-19 | 2011-06-28 | Seattle Genetics, Inc. | CD19 binding agents and uses thereof |
| US20180092984A1 (en) | 2015-03-18 | 2018-04-05 | Seattle Genetics, Inc. | Cd48 antibodies and conjugates thereof |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2002510968A (ja) * | 1997-05-07 | 2002-04-09 | ブリストル−マイヤーズ スクイブ カンパニー | 組換え抗体−酵素融合タンパク質 |
| US20060160174A1 (en) | 2002-12-02 | 2006-07-20 | Mcdonagh Charlotte F | Modified l49-sfv exhibiting increased stability and methods of use thereof |
| TW201617368A (zh) * | 2014-09-05 | 2016-05-16 | 史坦森特瑞斯公司 | 新穎抗mfi2抗體及使用方法 |
| CR20190550A (es) * | 2017-06-05 | 2020-04-05 | Janssen Biotech Inc | Anticuerpos que se unen específicamente a pd-1 y métodos de uso |
| CN112805238A (zh) * | 2018-07-03 | 2021-05-14 | 芬内克制药股份有限公司 | 无水硫代硫酸钠和其调配物 |
| US20230270877A1 (en) * | 2020-11-08 | 2023-08-31 | Seagen Inc. | Combination Therapy |
-
2020
- 2020-02-03 WO PCT/US2020/016381 patent/WO2020163225A1/en not_active Ceased
- 2020-02-03 AU AU2020219732A patent/AU2020219732A1/en active Pending
- 2020-02-03 JP JP2021545378A patent/JP7754715B2/ja active Active
- 2020-02-03 MX MX2021009138A patent/MX2021009138A/es unknown
- 2020-02-03 EP EP20709016.8A patent/EP3920968A1/en active Pending
- 2020-02-03 CN CN202080026997.1A patent/CN113710271B/zh active Active
- 2020-02-03 BR BR112021015477A patent/BR112021015477A2/pt unknown
- 2020-02-03 KR KR1020217027987A patent/KR20210125511A/ko active Pending
- 2020-02-03 SG SG11202107551WA patent/SG11202107551WA/en unknown
- 2020-02-03 US US16/780,711 patent/US11617798B2/en active Active
- 2020-02-04 TW TW109103363A patent/TWI872044B/zh active
-
2021
- 2021-07-19 IL IL284974A patent/IL284974A/en unknown
-
2023
- 2023-02-21 US US18/172,123 patent/US20240033369A1/en not_active Abandoned
-
2024
- 2024-05-07 US US18/657,397 patent/US20240409658A1/en not_active Abandoned
-
2025
- 2025-02-12 JP JP2025021046A patent/JP2025072613A/ja not_active Withdrawn
Patent Citations (48)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4474893A (en) | 1981-07-01 | 1984-10-02 | The University of Texas System Cancer Center | Recombinant monoclonal antibodies |
| US4714681A (en) | 1981-07-01 | 1987-12-22 | The Board Of Reagents, The University Of Texas System Cancer Center | Quadroma cells and trioma cells and methods for the production of same |
| EP0216846A1 (en) | 1985-04-01 | 1987-04-08 | Celltech Ltd | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same. |
| US5981216A (en) | 1985-04-01 | 1999-11-09 | Alusuisse Holdings A.G. | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US4880935A (en) | 1986-07-11 | 1989-11-14 | Icrf (Patents) Limited | Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| EP0323997A1 (en) | 1987-07-23 | 1989-07-19 | Celltech Limited | Recombinant dna expression vectors |
| US5658759A (en) | 1987-07-23 | 1997-08-19 | Celltech Limited | Recombinant DNA expression vectors |
| US5591639A (en) | 1987-07-23 | 1997-01-07 | Celltech Ltd | Recombinant DNA expression vectors |
| US5122368A (en) | 1988-02-11 | 1992-06-16 | Bristol-Myers Squibb Company | Anthracycline conjugates having a novel linker and methods for their production |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US5879936A (en) | 1988-04-18 | 1999-03-09 | Aluguisse Holding A.G. | Recombinant DNA methods, vectors and host cells |
| WO1989012624A2 (en) | 1988-06-14 | 1989-12-28 | Cetus Corporation | Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom |
| US4925648A (en) | 1988-07-29 | 1990-05-15 | Immunomedics, Inc. | Detection and treatment of infectious and inflammatory lesions |
| US5601819A (en) | 1988-08-11 | 1997-02-11 | The General Hospital Corporation | Bispecific antibodies for selective immune regulation and for selective immune cell binding |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| US5891693A (en) | 1990-01-25 | 1999-04-06 | Alusuisse Holdings A.G. | Recombinant DNA methods vectors and host cells |
| WO1992005793A1 (en) | 1990-10-05 | 1992-04-16 | Medarex, Inc. | Targeted immunostimulation with bispecific reagents |
| WO1992008802A1 (en) | 1990-10-29 | 1992-05-29 | Cetus Oncology Corporation | Bispecific antibodies, method of production, and uses thereof |
| US5573920A (en) | 1991-04-26 | 1996-11-12 | Surface Active Limited | Antibodies, and methods for their use |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| WO1992022653A1 (en) | 1991-06-14 | 1992-12-23 | Genentech, Inc. | Method for making humanized antibodies |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| EP0629240A1 (en) | 1992-02-19 | 1994-12-21 | Scotgen Limited | Altered antibodies, products and processes relating thereto |
| WO1993017715A1 (en) | 1992-03-05 | 1993-09-16 | Board Of Regents, The University Of Texas System | Diagnostic and/or therapeutic agents, targeted to neovascular endothelial cells |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US5824805A (en) | 1995-12-22 | 1998-10-20 | King; Dalton | Branched hydrazone linkers |
| US5834597A (en) | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
| US6130237A (en) | 1996-09-12 | 2000-10-10 | Cancer Research Campaign Technology Limited | Condensed N-aclyindoles as antitumor agents |
| US6624821B1 (en) | 1999-02-05 | 2003-09-23 | Samsung Electronics Co., Ltd. | Image texture retrieving method and apparatus thereof |
| US6881557B2 (en) | 2001-07-12 | 2005-04-19 | Arrowsmith Technologies Llp | Super humanized antibodies |
| US20060074008A1 (en) | 2002-07-31 | 2006-04-06 | Senter Peter D | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US7659241B2 (en) | 2002-07-31 | 2010-02-09 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| WO2004050867A1 (en) * | 2002-12-02 | 2004-06-17 | Seattle Genetics, Inc. | MODIFIED L49-sFv EXHIBITING INCREASED STABILITY AND METHODS OF USE THEREOF |
| US7498298B2 (en) | 2003-11-06 | 2009-03-03 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| WO2006036291A2 (en) | 2004-07-30 | 2006-04-06 | Rinat Neuroscience Corp. | Antibodies directed against amyloid-beta peptide and methods using same |
| US20090111756A1 (en) | 2005-07-07 | 2009-04-30 | Seattle Genectics, Inc. | Monomethylvaline Compounds Having Phenylalanine Carboxy Modifications at the C-Terminus |
| US20090018086A1 (en) | 2005-07-07 | 2009-01-15 | Seattle Genetics, Inc. | Monomethylvaline Compounds Having Phenylalanine Side-Chain Replacements at the C-Terminus |
| US20080241128A1 (en) | 2005-07-18 | 2008-10-02 | Seattle Genetics, Inc. | Beta-Glucuronide-Linker Drug Conjugates |
| US20100158909A1 (en) | 2006-12-01 | 2010-06-24 | Seattle Genetics, Inc. | Variant Target Binding Agents and Uses Thereof |
| US7968687B2 (en) | 2007-10-19 | 2011-06-28 | Seattle Genetics, Inc. | CD19 binding agents and uses thereof |
| US20180092984A1 (en) | 2015-03-18 | 2018-04-05 | Seattle Genetics, Inc. | Cd48 antibodies and conjugates thereof |
Non-Patent Citations (61)
| Title |
|---|
| "Antibody-antigen interactions: Contact analysis and binding site topography", J. MOL. BIOL., vol. 262, pages 732 - 745 |
| "Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, and Future Prospective of the Therapeutic Use of Radiolabeled Antibody In Cancer Therapy" |
| "UniProt", Database accession no. P08582 |
| AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948 |
| ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy" |
| CHARI ET AL., CANCER RES., 1992 |
| CHOTHIA, J. MOL. BIOL., vol. 196, 1987, pages 901 |
| CHOTHIALESK, J. MOT. BIOL., vol. 195, 1987, pages 901 - 917 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| DAVIES ET AL., BIOTECH. BIOENG., vol. 74, 2001, pages 288 - 94 |
| DE LA CRUZ EDMUNDS ET AL., MOLECULAR BIOTECHNOLOGY, vol. 34, 2006, pages 179 - 190 |
| DUBOWCHIKWALKER, PHARM. THERAPEUTICS, vol. 83, 1999, pages 67 - 123 |
| GHETIEWARD, ANN. REV. IMMUNOL., vol. 18, 2000, pages 739 - 766 |
| GHETIEWARD, ANNU. REV. IMMUNOL., vol. 18, 2000, pages 739 - 766 |
| GHETIEWARD, IMMUNOL. RES., vol. 25, 2002, pages 97 - 113 |
| GONZALES ET AL., MOL. IMMUNOL., vol. 41, 2004, pages 863 |
| HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery" |
| HIETER ET AL., J. BIOL. CHEM., vol. 257, 1982, pages 1516 - 1522 |
| HINTON ET AL., J. BIOL. CHEM., vol. 279, 2004, pages 6213 |
| HONEGGER APLIICKTHUN A: "Yet another numbering scheme for immunoglobulin variable domains: an automatic modeling and analysis tool", J MOL BIOL, vol. 309, no. 3, 8 June 2001 (2001-06-08), pages 657 - 70, XP004626893, DOI: 10.1006/jmbi.2001.4662 |
| IDUSOGIE ET AL., J. IMMUNOL., vol. 166, 2001, pages 2571 - 2575 |
| ISIDRO-LLOBEL ET AL.: "Amino acid-protecting groups", CHEM. REV., vol. 109, 2009, pages 2455 - 2504, XP055559012, DOI: 10.1021/cr800323s |
| IWAHASHI ET AL., MOL. IMMUNOL., vol. 36, 1999, pages 1079 - 1091 |
| JEFFERISLEFRANC 2009, MABS, vol. 1, no. 4, pages 1 - 7 |
| JOHNSON ET AL., ANTICANCER RES., vol. 15, 1995, pages 1387 - 93 |
| KOHLER ET AL., NATURE, vol. 256, 1975, pages 495 |
| KONTERMANN, NAT. BIOTECH., vol. 15, 1997, pages 629 - 31 |
| KOSTELN ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 1553 - 22 |
| L. M. SMITH: "Potent cytotoxicity of an auristatin-containing antibody-drug conjugate targeting melanoma cells expressing melanotransferrin/p97", MOLECULAR CANCER THERAPEUTICS, vol. 5, no. 6, 1 June 2006 (2006-06-01), pages 1474 - 1482, XP055214665, ISSN: 1535-7163, DOI: 10.1158/1535-7163.MCT-06-0026 * |
| LAU ET AL., BIOORG-MED-CHEM., vol. 3, no. 10, 1995, pages 1305 - 1304 |
| LAZAR ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 4005 |
| LEFRANC MP ET AL.: "IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains", DEV COMP IMMUNOL, vol. 27, no. 1, January 2003 (2003-01-01), pages 55 - 77, XP055585227, DOI: 10.1016/S0145-305X(02)00039-3 |
| LUND ET AL., J. IMMUNOL., vol. 157, 1996, pages 4963 - 69 |
| MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745 |
| MARKS ET AL., JMOL, BIOL., vol. 222, no. 3, 1991, pages 581 - 597 |
| MARTIN ET AL.: "Modeling antibody hypervariable loops: a combined algorithm", PNAS, vol. 86, no. 23, 1989, pages 9268 - 9272, XP000165667, DOI: 10.1073/pnas.86.23.9268 |
| MATTILA ET AL., EUR. J. IMMUNOL., vol. 25, 1995, pages 2578 - 2582 |
| MCDONAGH C F ET AL: "Improved yield and stability of L49-sFv-beta-lactamase, a single-chain antibody fusion protein for anticancer prodrug activation, by protein engineering", BIOCONJUGATE CHEMISTRY, AMERICAN CHEMICAL SOCIETY, US, vol. 14, no. 5, 25 July 2003 (2003-07-25), pages 860 - 869, XP002378783, ISSN: 1043-1802, DOI: 10.1021/BC0340316 * |
| NATURE BIOTECHNOLOGY, vol. 32, 2014, pages 1059 - 1062 |
| NEVILLE ET AL., BIOL. CHEM., vol. 264, 1989, pages 14653 - 14661 |
| NIWA, CANCER RES., vol. 64, 2004, pages 2127 - 33 |
| OKAZAKI ET AL., J. MOL. BIOL., vol. 336, 2004, pages 1239 - 49 |
| PASCALIS ET AL., J. IMMUNOL., vol. 169, 2002, pages 3076 |
| QUEEN ET AL., IMMUNOL. REV., vol. 89, 1986, pages 49 |
| ROLLAND Y., PIGMENT CELL MELANOMA RES, vol. 22, 2009, pages 86 - 98 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 6591 - 604 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 40 |
| SHIN ET AL., EMBO J., vol. 10, 1991, pages 3641 - 3645 |
| SHINKAWA ET AL., J. BIOL. CHEM., vol. 278, 2003, pages 6591 - 604 |
| SIEMERS ET AL., BIOCONJUG. CHEM., vol. 8, 1997, pages 510 - 9 |
| SIEMERS N O ET AL: "CONSTRUCTION, EXPRESSION, AND ACTIVITIES OF L49-SFV-BETA-LACTAMASE,A SINGLE-CHAIN ANTIBODY FUSION PROTEIN FOR ANTICANCER PRODRUG ACTIVATION", BIOCONJUGATE CHEMISTRY, AMERICAN CHEMICAL SOCIETY, US, vol. 8, 1 January 1997 (1997-01-01), pages 510 - 519, XP002913808, ISSN: 1043-1802, DOI: 10.1021/BC9700751 * |
| SMITH ET AL., J. IMMUNOL., vol. 154, 1995, pages 2226 - 36 |
| TAMURA ET AL., JOURNAL OF IMMUNOLOGY, vol. 164, 2000, pages 1432 - 1441 |
| THORPE ET AL., CANCER RES., vol. 47, 1987, pages 5924 - 5931 |
| THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 58 |
| THORPE ET AL.: "Monoclonal Antibodies '84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review" |
| TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 69 |
| UMANA ET AL., NAT. BIOTECHNOL., vol. 17, 1999, pages 176 - 180 |
| VAJDOS ET AL., JOURNAL OF MOLECULAR BIOLOGY, vol. 320, 2002, pages 415 - 428 |
| WAWRZYNCZAK ET AL.: "Immunoconjugates: Antibody Conjugates in Radioimagery and Therapy of Cancer", 1987, OXFORD U. PRESS |
| WRIGHTMORRISON, TRENDS BIOTECHNOL., vol. 15, 1997, pages 26 - 32 |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021207701A1 (en) | 2020-04-10 | 2021-10-14 | Seagen Inc. | Charge variant linkers |
| WO2022098972A1 (en) | 2020-11-08 | 2022-05-12 | Seagen Inc. | Combination-therapy antibody drug conjugate with immune cell inhibitor |
| US12036286B2 (en) | 2021-03-18 | 2024-07-16 | Seagen Inc. | Selective drug release from internalized conjugates of biologically active compounds |
| WO2022251850A1 (en) | 2021-05-28 | 2022-12-01 | Seagen Inc. | Anthracycline antibody conjugates |
| WO2023178289A2 (en) | 2022-03-17 | 2023-09-21 | Seagen Inc. | Camptothecin conjugates |
| EP4534558A4 (en) * | 2022-05-31 | 2026-04-22 | Shandong Boan Biotechnology Co Ltd | ANTI-CD228 ANTIBODY AND ASSOCIATED DRUG CONJUGATE |
| WO2024064713A1 (en) * | 2022-09-21 | 2024-03-28 | Seagen Inc. | Novel fusion protein specific for cd137 and cd228 |
| WO2024064714A3 (en) * | 2022-09-21 | 2024-05-02 | Seagen Inc. | Antibodies that bind cd228 |
| WO2025090774A1 (en) | 2023-10-24 | 2025-05-01 | Seagen Inc. | Chemotherapeutic compounds and methods of use |
Also Published As
| Publication number | Publication date |
|---|---|
| CN113710271B (zh) | 2025-03-04 |
| EP3920968A1 (en) | 2021-12-15 |
| KR20210125511A (ko) | 2021-10-18 |
| CN113710271A (zh) | 2021-11-26 |
| JP2022519273A (ja) | 2022-03-22 |
| US20200246479A1 (en) | 2020-08-06 |
| JP2025072613A (ja) | 2025-05-09 |
| IL284974A (en) | 2021-09-30 |
| TWI872044B (zh) | 2025-02-11 |
| SG11202107551WA (en) | 2021-08-30 |
| CA3128097A1 (en) | 2020-08-13 |
| JP7754715B2 (ja) | 2025-10-15 |
| US20240409658A1 (en) | 2024-12-12 |
| AU2020219732A1 (en) | 2021-08-05 |
| US20240033369A1 (en) | 2024-02-01 |
| MX2021009138A (es) | 2021-09-10 |
| US11617798B2 (en) | 2023-04-04 |
| BR112021015477A2 (pt) | 2021-12-28 |
| TW202045536A (zh) | 2020-12-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240409658A1 (en) | Anti-cd228 antibodies and antibody-drug conjugates | |
| US12421312B2 (en) | Anti-PD-L1 antibodies and antibody-drug conjugates | |
| US12268751B2 (en) | Anti-αVβ6 antibodies and antibody-drug conjugates | |
| US20230295330A1 (en) | Anti-cd228 antibodies and antibody-drug conjugates | |
| CA3128097C (en) | Anti-cd228 antibodies and antibody-drug conjugates | |
| CN114828887B (zh) | 抗-αVβ6抗体和抗体-药物偶联物 | |
| HK40064761A (en) | Anti-cd228 antibodies and antibody-drug conjugates | |
| EA050557B1 (ru) | Анти-cd228 антитела и конъюгаты антитело-лекарственное средство | |
| KR20250089558A (ko) | 항-αvβ6 항체 및 항체-약물 접합체 및 암 치료에서의 이의 용도 | |
| HK40064761B (zh) | 抗cd228抗体和抗体-药物缀合物 | |
| EA052759B1 (ru) | Антитела против pd-l1 и конъюгаты антитело-лекарственное средство | |
| HK40099050A (zh) | 抗cd228抗体和抗体-药物缀合物 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20709016 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3128097 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2021545378 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020219732 Country of ref document: AU Date of ref document: 20200203 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112021015477 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20217027987 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020709016 Country of ref document: EP Effective date: 20210906 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112021015477 Country of ref document: BR Free format text: COM BASE NA PORTARIA 405 DE 21/12/2020, SOLICITA-SE QUE SEJA APRESENTADO, EM ATE 60 (SESSENTA) DIAS, NOVO CONTEUDO DE LISTAGEM DE SEQUENCIA POIS O CONTEUDO APRESENTADO NA PETICAO NO 870210071422 DE 05/08/2021 POSSUI INFORMACOES DIVERGENTES AO PEDIDO EM QUESTAO. DEVERA SER CORRIGIDO O CAMPO 110 , UMA VEZ QUE O NOME DO DEPOSITANTE ESTA DIVERGENTE DO APRESENTADO NA DITA PETICAO. |
|
| ENP | Entry into the national phase |
Ref document number: 112021015477 Country of ref document: BR Kind code of ref document: A2 Effective date: 20210805 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 202080026997.1 Country of ref document: CN |