WO2020131236A1 - O-linked glycosylation recognition motifs - Google Patents

O-linked glycosylation recognition motifs Download PDF

Info

Publication number
WO2020131236A1
WO2020131236A1 PCT/US2019/059893 US2019059893W WO2020131236A1 WO 2020131236 A1 WO2020131236 A1 WO 2020131236A1 US 2019059893 W US2019059893 W US 2019059893W WO 2020131236 A1 WO2020131236 A1 WO 2020131236A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
comp
amino acid
bioconjugate
glycosylation tag
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/059893
Other languages
English (en)
French (fr)
Inventor
Christian HARDING
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Vaxnewmo LLC
Original Assignee
Vaxnewmo LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Vaxnewmo LLC filed Critical Vaxnewmo LLC
Priority to ES19898969T priority Critical patent/ES3055827T3/es
Priority to EP19898969.1A priority patent/EP3897685B1/en
Priority to AU2019404924A priority patent/AU2019404924B2/en
Priority to US17/416,106 priority patent/US12350342B2/en
Priority to CA3124312A priority patent/CA3124312A1/en
Priority to JP2021536212A priority patent/JP7699543B2/ja
Publication of WO2020131236A1 publication Critical patent/WO2020131236A1/en
Anticipated expiration legal-status Critical
Priority to JP2024214739A priority patent/JP2025032259A/ja
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/6415Toxins or lectins, e.g. clostridial toxins or Pseudomonas exotoxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/385Haptens or antigens, bound to carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/646Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the entire peptide or protein drug conjugate elicits an immune response, e.g. conjugate vaccines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/65Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/21Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Pseudomonadaceae (F)
    • C07K14/212Moraxellaceae, e.g. Acinetobacter, Moraxella, Oligella, Psychrobacter
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6037Bacterial toxins, e.g. diphteria toxoid [DT], tetanus toxoid [TT]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/62Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
    • A61K2039/627Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/90Fusion polypeptide containing a motif for post-translational modification
    • C07K2319/91Fusion polypeptide containing a motif for post-translational modification containing a motif for glycosylation
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • glycosylation pathways were recombinantly introduced into E. coli creating the field of bacterial glycoengineering (Wacker M, et al. (2002) N-linked glycosylation in Campylobacter jejuni and its functional transfer into E. coli. Science 298(5599): 1790-1793).
  • Bacterial glycoengineering is an emerging biotechnological tool that hamesses prokaryotic glycosylation systems for the generation of recombinantly glycosylated proteins using E. coli or other Gram-negative organisms as a host.
  • glycoengineering utilizes two broad approaches to recombinantly glycosylate proteins, both of which can generate N- or 0-linkages: oligosaccharyltransferase (OTase)-dependent and OTase-independent.
  • OTase oligosaccharyltransferase
  • Protein glycosylation or the covalent attachment of carbohydrates to proteins, is a ubiquitous posttranslational modification.
  • protein glycosylation is characterized as either A-linked with glycans attached to asparagine residues, or as 0-linked with glycans attached to serine or threonine residues.
  • prokaryotic glycosylation has only recently grabbed the attention of the scientific community with the discovery of a general Ad inked protein glycosylation system in the s-proteobacterium Campylobacter jejuni (Szymanski CM, et al.
  • OTase-independent glycosylation occurs in the cytoplasm and relies on glycosyltransferases to transfer monosaccharides from nucleotide activated precursors for the sequential assembly of glycoproteins. Both OTase-dependent and -independent pathways are exploited for bioconjugating carbohydrates to proteins.
  • Bacterial surface polysaccharides are some of the first, and most abundant, microbial components encountered by the immune system during infection (Comstock LE & Kasper DL (2006) Bacterial glycans: key mediators of diverse host immune responses. Cell 126(5):847-850). These polysaccharides, usually in the form of capsule or O antigen attached to lipid A, serve a multitude of purposes, including protecting microbial organisms from external threats and immune clearance. Given their abundance on invading organisms as well as their biochemical distinctness from eukaryotic carbohydrates, some microbial surface polysaccharides have been used as antigens for vaccine development.
  • polysaccharides when used alone in vaccine formulations, they usually act as T-cell independent antigens and therefore do not stimulate immunoglobulin class switching and long-term B cell memory.
  • polysaccharide vaccines alone do not elicit protection in vulnerable groups like infants and children under two years of age. This poor immune response can be overcome by covalently attaching a polysaccharide to a protein carrier in a process known as conjugation (De Gregorio E & Rappuoli R (2014) From empiricism to rational design: a personal perspective of the evolution of vaccine development. Nat Rev Immunol 14(7):505-514).
  • gly coconjugate vaccines are synthesized using a semi-synthetic approach where the polysaccharide is extracted from the target bacterium, purified, chemically modified and covalently linked to a carrier protein. This approach has resulted in the commercial licensure of multiple gly coconjugate vaccines to prevent colonization and infection by Haemophilus influenzae type B, and multiple serotypes of Streptococcus pneumoniae and Neisseria meningiditis.
  • conjugate vaccines produced chemically have seen immense commercial success (the gly coconjugate vaccine Prevnar 13 has been Pfizer’s best-selling product from 2015-2018 with over 24 billion USD in sales), their manufacturing processes are not without drawbacks; including, batch to batch variation, heterogenous product formation, large scale production of pathogenic organisms, and high manufacturing costs (Frasch CE (2009) Preparation of bacterial polysaccharide-protein conjugates: analytical and manufacturing challenges. Vaccine 27(46):6468-6470).
  • bioconjugation represents a simplification of the production and manufacturing process of gly coconjugate vaccines (Rappuoli R, De Gregorio E, & Costantino P (2019) On the mechanisms of conjugate vaccines. Proc Natl Acad Sci USA 116(1): 14-16).
  • iV-1 inking and //-linking OTases have been employed for biologically conjugating polysaccharides to carrier proteins for gly coconjugate vaccine production.
  • biological conjugations in any Gram-negative bacterium rely on three components: a genetic locus or loci that encode(s) for the polysaccharide biosynthesis proteins, a carrier protein to be glycosylated, and an OTase to transfer the desired carbohydrate to the carrier protein. While these three components are required, they do not necessarily need to be on three separate plasmids.
  • PglS was indeed a pilin specific OTase, likely, only glycosylating ComP as no other glycoproteins were identified using a comprehensive glycoprotein screening approach (Harding CM, et al. (2015) Acinetobacter strains carry two functional oligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O-glycosylation of multiple proteins. Mol Microbiol 96(5): 1023-1041). Originally characterized as a PglL ortholog from the environmental bacterium Acinetobacter baylyi strain ADP1, PglS is in fact phylogenetically distinct from PglL proteins.
  • Strains of Acinetobacter that encode for a PglS protein also encode for a PglL protein, which has been shown to act as the general OTase glycosylating at least seven membrane-associated proteins in a manner similar to Neisseria species (Iwashkiw JA, et al. (2012) Identification of a general O-linked protein glycosylation system in Acinetobacter baumannii and its role in virulence and biofilm formation. PLoS Pathog 8(6):el002758).
  • Acinetobacter also encode for PilO OTases, making Acinetobacter the only known genera of bacteria carrying genes for all three ()- OTase families (PilO, PglL, and PglS) (Harding CM, el al. (2015) Acinetobacter strains carry two functional oligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O-glycosylation of multiple proteins.
  • PLoS Pathog 8(6):el002758 Some strains of Acinetobacter also encode for PilO OTases, making Acinetobacter the only known genera of bacteria carrying genes for all three ()- OTase families (PilO, PglL, and PglS)
  • PglS glycosylates its cognate pilin at a unique serine site that is not conserved when compared to the site of glycosylation for PilE (the pilin target of PglL) or PilA (the pilin target for PilO), and is not contained within an LCR (Harding CM, et al. (2019) A platform for gly coengineering a polyvalent pneumococcal bioconjugate vaccine using E. coli as a host. Nat Commun 10(1): 891). However, the most notable difference lies in the polysaccharide substrates PglS transfers.
  • PglS is the only known OTase, both N- or O- linking, capable of transferring polysaccharides with glucose at the reducing end.
  • Many pathogens like Streptococcus pneumoniae (Geno KA, et al. (2015) Pneumococcal Capsules and Their Types: Past, Present, and Future. Clin Microbiol Rev 28(3):871-899), Group B Streptococcus (Carboni F, et al. (2017) Structure of a protective epitope of group B Streptococcus type III capsular polysaccharide. Proc Natl Acad Sci U SA 114(19):5017-5022), and Klebsiella pneumoniae (Pan YJ, et al.
  • This disclosure provides for a bioconjugate comprising an oligo- or polysaccharide covalently linked to a fusion protein: wherein the fusion protein comprises a ComP protein (ComP) glycosylation tag; wherein the ComP glycosylation tag comprises both a cysteine residue corresponding to the conserved cysteine residue at position 71 of SEQ ID NO: 2 (ComPl 10264: ENV58402.1) and a cysteine residue corresponding to the conserved cysteine residue at position 93 of SEQ ID NO: 2 or both a cysteine residue corresponding to the conserved cysteine residue at position 75 of SEQ ID NO: 1 (ComPADPl: AAC45886.1) and a cysteine residue corresponding to the conserved cysteine residue at position 95 of SEQ ID NO: 1; and wherein the fusion protein is glycosylated with the oligo- or polysaccharide on the ComP glycosylation tag at a serine residue corresponding to the conserved se
  • the ComP glycosylation tag does not comprise a methionine residue corresponding to the conserved methionine residue at position 104 of SEQ ID NO: 2 (ComPl 10264: ENV58402.1).
  • the fusion protein of the bioconjugate does not comprise, in relationship to the ComP glycosylation tag, a methionine residue at a position that would correspond to or correspond about to the conserved methionine residue at position 104 of SEQ ID NO: 2 (ComPl 10264: ENV58402.1).
  • the bioconjugate is a conjugate vaccine.
  • the ComP glycosylation tag comprises or consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 32 [Cl]; SEQ ID NO: 33 [Dl]; SEQ ID NO: 34 [El]; SEQ ID NO: 41 [E2]; SEQ ID NO: 42 [F2]; SEQ ID NO: 43 [G2]; SEQ ID NO: 44 [H2]; SEQ ID NO: 45 [A3]; SEQ ID NO: 46 [B3]; SEQ ID NO: 47 [C3]; SEQ ID NO: 55 [D4]; SEQ ID NO: 56 [E4]; SEQ ID NO: 57 [F4]; SEQ ID NO: 58 [G4]; SEQ ID NO: 59 [A5]; SEQ ID NO: 60 [B5]; SEQ ID NO: 61 [D5]; SEQ ID NO: 62 [E5]; SEQ ID NO: 63 [F5] ; SEQ ID NO: 59 [A5]; SEQ
  • This disclosure provides for a ComP glycosylation tag comprising an isolated fragment of a ComP protein, wherein the fragment comprises a serine residue corresponding to the conserved serine residue at position 84 in SEQ ID NO: 1 (ComPADPl: AAC45886.1) and both a cysteine residue corresponding to the conserved cysteine residue at position 71 of SEQ ID NO: 2 (ComPl 10264: ENV58402.1) and a cysteine residue corresponding to the conserved cysteine residue at position 93 of SEQ ID NO: 2 or both a cysteine residue corresponding to the conserved cysteine residue at position 75 of SEQ ID NO: 1 (ComPADPl : AAC45886.1) and a cysteine residue corresponding to the conserved cysteine residue at position 95 of SEQ ID NO: 1.
  • the ComP glycosylation tag of Claim 41 wherein the ComP glycosylation tag does not comprise a methionine residue corresponding to the conserved methionine residue at position 104 of SEQ ID NO: 2 (ComP110264: ENV58402.1).
  • the ComP glycosylation tag of Claim 42 wherein the amino acid sequence of the ComP glycosylation tag does not extend in the C-terminus direction beyond the amino acid residue corresponding to position 103 of SEQ ID NO: 2 (ComPl 10264: ENV58402.1).
  • fusion protein comprising a ComP glycosylation tag of this disclosure.
  • Also provided for herein is a method of in vivo conjugation of an oligo- or polysaccharide to an acceptor polypeptide, the method comprising covalently linking the oligo- or polysaccharide to the acceptor polypeptide with a PglS oligosaccharyltransferase (OTase), wherein the acceptor polypeptide comprises the ComP glycosylation tag of this disclosure; optionally, wherein the ComP glycosylation tag is linked to a heterologous carrier protein.
  • OTase PglS oligosaccharyltransferase
  • a host cell comprising (a) a genetic cluster encoding for the proteins required to synthesize an oligo- or polysaccharide; (b) a PglS OTase; and (3) an acceptor polypeptide comprising the ComP glycosylation tag of this disclosure.
  • Also provided for herein is an isolated nucleic acid encoding the ComP glycosylation tag and/or the fusion protein of this disclosure and a host cell comprising said isolated nucleic acid.
  • composition comprising the conjugate vaccine or the fusion protein of thisi disclosure, and an adjuvant.
  • a method of inducing a host immune response against a bacterial pathogen comprising administering to a subject in need of the immune response an effective amount of the conjugate vaccine, the fusion protein, or a composition of this disclosure.
  • Also provided for herein is a method of preventing or treating a bacterial disease and/or infection in a subject comprising administering to a subject in need thereof the conjugate vaccine, the fusion protein, or a composition of this disclosure.
  • Also provided for herein is a method of producing a pneumococcal conjugate vaccine against pneumococcal infection comprising isolating the bioconjugate or glycosylated fusion protein of this disclosure and combining the isolated conjugate vaccine or isolated glycosylated fusion protein with an adjuvant.
  • Figure 1A,B Figure 1A and Figure IB show that the cysteine residues flanking immediately serine 84 in ComP from Acinetobacter baylyi ADP1 (ComP ADPi ) contribute to PglS dependent glycosylation and ComP stability.
  • (A) illustrates the amino acid sequence of ComPADPi from amino acid residues 75 to 95 with the two cysteine residues flanking serine 84, the site of PglS dependent glycosylation.
  • (B) shows that point mutational exchange of either cysteine 75, cysteine 95, or both cysteine 75 and 95 to alanine, glycine, or serine negatively affects ComP stability and blocks glycosylation of serine 84 by PglS with the Campylobacter jejuni heptasaccharide.
  • C75A/C95S, C75G/C95A, C75G/C95G, and C75G/C95S all had ComP levels that were below the level of detection indicating the inherent instability of these mutant proteins and the importance of the Cysteine 75 and Cysteine 95.
  • Figure 2 shows a schematic of the recombinant fusion protein containing a C-terminal fragment of ComP from Acinetobacter soli strain 110264 (herein referred to as ComPll0264).
  • Figure 3A,B show PglSADPi glycosylating recombinant fusion proteins composed of fragments of ComPno264 containing the cysteine residues in position 71 and 93 that flank the previously established site of glycosylation at serine 82.
  • A Western blot analysis of E. coli whole cell lysates co-expressing PglS ADPi , the pneumococcal serotype 8 capsular polysaccharide, and a fusion protein that contains a fragment of ComP 110264.
  • PglSADPi was only able to glycosylate those recombinant fusion proteins that contained fragments of ComPno264 that contained cysteine 71, serine 82, and cysteine 93. Specifically, fusion proteins Cl, Dl, and El were found to be glycosylated as indicated by the immunoreactive bands running at a higher molecular weight.
  • The“+” sample acts as a positive control as this fusion protein containing the ComPno264 fragment consisting of amino acids 29 to 145 has previously been shown to be efficiently glycosylated by PglS ADPi .
  • Figure 4A,B show PglS ADPi glycosylating recombinant fusion proteins composed of fragments of ComPno264 containing the cysteine residues in position 71 and 93 that flank the previously established site of glycosylation at serine 82.
  • A Western blot analysis of E. coli whole cell lysates co-expressing PglS ADPi , the pneumococcal serotype 8 capsular polysaccharide, and a fusion protein that contains a fragment of ComP 110264.
  • PglSADPi was only able to glycosylate those recombinant fusion proteins that contained fragments of ComPno264 that contained cysteine 71, serine 82, and cysteine 93. Specifically, fusion proteins E2, F2, G2, H2, A3, B3, and C3 were found to be glycosylated as indicated by the immunoreactive bands running at a higher molecular weight.
  • The“+” sample acts as a positive control as this fusion protein containing the ComP 110264 fragment consisting of amino acids 29 to 145 has previously been shown to be efficiently glycosylated by PglS ADPi .
  • Figure 5A,B show PglS ADPi glycosylating recombinant fusion proteins composed of fragments of ComPno264 containing the cysteine residues in position 71 and 93 that flank the previously established site of glycosylation at serine 82.
  • A Western blot analysis of E. coli whole cell lysates co-expressing PglS ADPi , the pneumococcal serotype 8 capsular polysaccharide, and a fusion protein that contains a fragment of ComP 110264.
  • PglSADPi was only able to glycosylate those recombinant fusion proteins that contained fragments of ComPno264 that contained cysteine 71, serine 82, and cysteine 93. Specifically, fusion proteins D4, E4, F4, G4, A5, B5, D5, and E5 were found to be glycosylated as indicated by the immunoreactive bands running at a higher molecular weight.
  • The“+” sample acts as a positive control as this fusion protein containing the ComPno264 fragment consisting of amino acids 29 to 145 has previously been shown to be efficiently glycosylated by PglS ADPi .
  • Figure 6A,B show PglS ADPi glycosylating recombinant fusion proteins composed of fragments of ComPno264 containing the cysteine residues in position 71 and 93 that flank the previously established site of glycosylation at serine 82.
  • A Western blot analysis of E. coli whole cell lysates co-expressing PglSADPi, the pneumococcal serotype 8 capsular polysaccharide, and a fusion protein that contains a fragment of ComPno264.
  • PglS ADPi was only able to glycosylate those recombinant fusion proteins that contained fragments of ComP 110264 that contained cysteine 71, serine 82, and cysteine 93. Specifically, fusion proteins F5 and H6 were found to be glycosylated as indicated by the immunoreactive bands running at a higher molecular weight.
  • The“+” sample acts as a positive control as this fusion protein containing the ComPno264 fragment consisting of amino acids 29 to 145 has previously been shown to be efficiently glycosylated by PglSADPi.
  • Figure 7A,B Figure 7A and Figure 7B show PglS ADPi glycosylation being blocked by the methionine at position 104 even in the presence of the cysteine 71, serine 82, and cysteine 93.
  • A Western blot analysis of E. coli whole cell lysates co-expressing PglSADPi, the pneumococcal serotype 8 capsular polysaccharide, and a fusion protein that contains a fragment of ComPno264.
  • PglSADPi was only able to glycosylate those recombinant fusion proteins that contained fragments of ComPno264 that contained cysteine 71, serine 82, cysteine 93 and lacked methionine 104.
  • fusion proteins B7, C7, D7, E7, F7, A8, and B8 were found to be glycosylated as indicated by the immunoreactive bands running at a higher molecular weight.
  • The“+” sample acts as a positive control as this fusion protein containing the ComPno264 fragment consisting of amino acids 29 to 145 has previously been shown to be efficiently glycosylated by PglS ADP1 .
  • Figure 8A and Figure 8B show that PglSADPi glycosylation of serine 82 is not blocked by the presence of multiple methionine residues 5’ of cysteine 71 and cysteine 93.
  • A Western blot analysis of E. coli whole cell lysates co-expressing PglS ADPi , the pneumococcal serotype 8 capsular polysaccharide, and a fusion protein that contains a fragment of ComPno264.
  • PglSADPi was only able to glycosylate those recombinant fusion proteins that contained fragments of ComP 110264 that contained cysteine 71, serine 82, cysteine 93 and lacked methionine 104. Specifically, fusion proteins A10 and B10 were found to be glycosylated as indicated by the immunoreactive bands running at a higher molecular weight.
  • The“+” sample acts as a positive control as this fusion protein containing the ComPi 10264 fragment consisting of amino acids 29 to 145 has previously been shown to be efficiently glycosylated by PglS ADP1 .
  • Figure 9A,B Figure 9A and Figure 9B show that PglSADPi glycosylation of serine 82 is not blocked by the presence of multiple methionine residues 5’ of cysteine 71 and cysteine 93.
  • A Western blot analysis of E. coli whole cell lysates co-expressing PglSADPi, the pneumococcal serotype 8 capsular polysaccharide, and a fusion protein that contains a fragment of ComPno264.
  • PglSADPi was only able to glycosylate those recombinant fusion proteins that contained fragments of ComP 110264 that contained cysteine 71, serine 82, cysteine 93 and lacked methionine 104.
  • fusion proteins CIO, D10, F10, G10, H10, Al l, Bl l, and Cl l were found to be glycosylated as indicated by the immunoreactive bands running at a higher molecular weight.
  • The“+” sample acts as a positive control as this fusion protein containing the ComPno264 fragment consisting of amino acids 29 to 145 has previously been shown to be efficiently glycosylated by PglS ADP I .
  • B Table format defining the fragment of ComPno264 used for recombinant fusion glycosylation experiment and summarizing western blot observations for the presence or absence of glycosylation.
  • PglS ADPi was only able to glycosylate those recombinant fusion proteins that contained fragments of ComPi 10264 that contained cysteine 71, serine 82, cysteine 93 and lacked methionine 104. Specifically, none of the fusion proteins were found to be glycosylated by PglS ADPi .
  • The“+” sample acts as a positive control as this fusion protein containing the ComPi 10264 fragment consisting of amino acids 29 to 145 has previously been shown to be efficiently glycosylated by PglS ADP1 .
  • Figure 11A,B Figure 11A and Figure 11B show fragments of ComPno264 displaying efficient glycosylation by PglSADPi with the serotype 8 pneumococcal capsular polysaccharide.
  • Western blots were run in duplicate and probed with either the anti-exotoxin A antisera (A) or anti -His antisera (B).
  • the different ComPi 10264 fragments all showed similar levels of glycosylation as indicated by the immunoreactive bands running at a higher molecular weight. All fragments contain cysteine 71, serine 82, and cysteine 93.
  • Figure 11C shows in table format the fragments of ComPno264 used for recombinant fusion glycosylation experiment and summarizing western blot observations for the presence of glycosylation.
  • serine 82 the site of known PglS dependent glycosylation, is in bold underlined font.
  • Figure 12A,B,C Figure 12A, Figure 12B, and Figure 12C show that N-terminal or C-terminal O-linked glycosylation motifs translationally fused to the EPA carrier protein are glycosylated in the presence of PglS ADPi .
  • A Figure legend defining the features of each EPA carrier fusion protein used for this experiment. Six different fusion proteins were employed as denoted by the presence of a single O-linked glycosylation tag or a double glycosylation tag.
  • B The D5 and D5’ ComPno264 amino acid fragment sequences.
  • C Western blot analysis of E.
  • Figure 13A,B,C show that two ComP 110264 fragments translationally fused in tandem at the C-terminus of a carrier protein are glycosylated with high molecular weight polysaccharides. Fusion proteins were purified from E. coli cells co-expressing the pneumococcal serotype 8 capsular polysaccharide in the presence or absence of PglS ADPi .
  • Figure 14A,B,C show that PglS (C), but not PglB (B) or PglL (A), can conjugate pneumococcal CPS14 to its cognate acceptor/carrier protein.
  • Figure 15 shows that PglS from A. baylyi ADP1 (PglS ADPi ) can transfer multiple pneumococcal capsular polysaccharides to ComP from A. baylyi ADP1 (COIIIPADPI).
  • Colocalization of the anti-Elis signals with the anti-glycan signals indicates that ComP ADPi was glycosylated with the correct pneumococcal polysaccharide.
  • the asterisk indicates samples that were treated with proteinase K for 2 hours.
  • Figure 16A,B Figure 16A and Figure 16B show that PglS ADPi can transfer the K1 and K2 capsular polysaccharides of K. pneumoniae to COIUPADPI.
  • Western blot analysis on E. coli whole cell lysates probing for hexa-histidine tagged ComP ADPi variants and RNA polymerase. RNA polymerase was used as a loading control.
  • Figure 17A Figure 17A shows mass spectrometry of CPS 14-ComP ADPI identified a single glycosylated peptide. ISASNATTNVATAT (SEQ ID NO: 22).
  • Figure 17B shows mass spectrometry of CPS14-ComP ADPi identified a single glycosylated peptide.
  • Figure 18 shows Serine 84 of ComPADPi is the site of PglS dependent glycosylation.
  • Western blot analysis on E. coli whole cell lysates probing for hexa-histidine tagged ComPADPi variants and the Campylobacter jejuni heptasaccharide.
  • the COITIP[S84A]ADPI variant was expressed; however, was not glycosylated as indicated by the absence of any reactive bands probing with the anti-hR6 heptasaccharide antisera.
  • Figure 19 lists ComP ortholog amino acid sequences. The site of predicted glycosylation is bolded, flanked by a predicted disulfide bond (underlined) linking the predicted alpha beta loop to the beta strand region.
  • Figure 20 shows that PglSADPi, but not PglSno264, efficiently glycosylates both its cognate ComP ADPI as well as ComPno264 from A. soli CIP 110264.
  • Western blot analysis on E. coli whole cell lysates probing for hexa-histidine tagged ComP variants and RNA polymerase. RNA polymerase was used as a loading control.
  • Figure 22 shows that PglS ADPi efficiently glycosylates MBP-
  • Figure 23 PglSADPi, but not PglSno264, efficiently EPA-GGGS-
  • ComP ⁇ 281 1 0264 fusions Western blot analysis on E. coli whole cell lysates or periplasmic extracts probing for hexa-histidine tagged ComP variants.
  • Figure 24 shows amino acid sequences of representative
  • Figure 25A,B,C show that a monovalent CPS 14-ComP ADPI bioconjugate vaccine induces serotype specific IgG antibodies.
  • Figure 26 shows that a trivalent bioconjugate vaccine against serotypes 8, 9V, and 14 induces serotype specific IgG titers at comparable levels to Prevnar 13.
  • Figure 27 lists ComP D28 ortholog amino acid sequences in which the amino acids corresponding to the 28 N-terminal amino acids of SEQ ID NO: 1 (ComP ADPI : AAC45886.1) have been removed. The site of predicted glycosylation is bolded, flanked by a predicted disulfide bond (underlined) linking the predicted alpha beta loop to the beta strand region.
  • Figure 28 shows an alignment of a region ComP sequences including the serine (S) residue (boxed) corresponding to the serine residue at position 84 of SEQ ID NO: 1 (ComP ADPI : AAC45886.1).
  • Figure 29 shows higher energy collisional dissociation (HCD) fragmentation spectra of GluC digested CPS 14-ComP bioconjugates.
  • HCD collisional dissociation
  • Figure 30 shows higher energy collisional dissociation (HCD) fragmentation spectra of GluC digested ComP glycosylated with the C. jejuni heptasaccharide (ComP-Glycanq).
  • HCD collisional dissociation
  • GluC digested ComP-Glycanq was subjected to HCD fragmentation enabling the confirmation of a single peptide attached to a glycan with the CPS 14 repeating subunit.
  • Low collision energies regimes were undertaken to confirm the glycosylation of the peptide ISASNATTNVATAT (SEQ ID NO: 22) with a 1380.53 Da glycan corresponding to 6*HexNAc, 1 *Hexose.
  • Figure 31 shows higher energy collisional dissociation (HCD) fragmentation spectra of GluC digested ComP glycosylated with the C. jejuni heptasaccharide (ComP-Glycanq).
  • GluC digested ComP-Glycanq was subjected to HCD fragmentation enabling the confirmation of a single peptide attached to a glycan with the CPS 14 repeating subunit.
  • High collision energies regimes were undertaken to confirm the glycosylation of the peptide ISASNATTNVATAT (SEQ ID NO: 22) with a 1380.53 Da glycan corresponding to 6*HexNAc, 1 *Hexose.
  • Figure 32A-I shows that the oligosaccharyltransferase PglS can glycosylate the acceptor protein ComP with the pneumococcal CPS 14 polysaccharide.
  • E. coli SDB1 cells co-expressing an acceptor protein (DsbA, AcrA, or ComP), an OTase (PglL, PglB, or PglS), and the CPS 14 polysaccharide were analyzed for protein glycosylation via western blot analysis of the affinity purified acceptor proteins.
  • A-C DsbA purified from SDB1 cells in the presence or absence of PglL.
  • Figure 33A,B Figure 33A and Figure 33B show higher energy collisional dissociation (HCD) fragmentation spectra of GluC digested CPS14-ComP bioconjugates.
  • GluC digested CPS14-ComP was subjected to HCD fragmentation enabling the confirmation of a single peptide attached to a glycan with the CPS 14 repeating subunit.
  • High collision energies (A) and low collision energies (B) regimes were undertaken to confirm the glycosylation of the peptide ISASNATTNVATAT (SEQ ID NO: 22) with a 1378.47 Da glycan corresponding to HexNAc2Hexose6.
  • Figure 34A-F shows Western blot analysis of CPS8-ComP and CPS9V-ComP glycoproteins.
  • E. coli SDB1 cells were prepared co-expressing ComP, PglS, and either the pneumococcal CPS8 or CPS9V. Affinity purified glycosylated ComP from each strain was analyzed for protein glycosylation via western blot analysis.
  • A-C Western blot analysis of CPS8-ComP bioconjugates compared against ComP alone
  • A Anti-His channel probing for hexa-histidine tagged ComP purified from SDB1 expressing CPS8 in the presence or absence of PglS.
  • Figure 35A-F shows IgG responses of mice vaccinated with ComP, PREVNAR 13®, a monovalent CPS 14-ComP bioconjugate and a trivalent CPS8- /CPS9V-/CPS14-ComP bioconjugate. Groups of mice were vaccinated with ComP alone, PREVNAR 13®, a monovalent CPS14-ComP bioconjugate vaccine, or a CPS8-/CPS9V-/CPS14- ComP bioconjugate vaccine. Sera was collected on day 49 and analyzed for serotype specific IgG responses via ELISA compared against sera collected on day 0.
  • Figure 35G-L shows IgG responses of mice vaccinated with ComP, PREVNAR 13®, a monovalent CPS 14-ComP bioconjugate and a trivalent CPS8- /CPS9V-/CPS14-ComP bioconjugate. Groups of mice were vaccinated with ComP alone, PREVNAR 13®, a monovalent CPS14-ComP bioconjugate vaccine, or a CPS8-/CPS9V-/CPS14- ComP bioconjugate vaccine. Sera was collected on day 49 and analyzed for serotype specific IgG responses via ELISA compared against sera collected on day 0.
  • G-I Mice vaccinated with a CPS 14-ComP bioconjugate vaccine did not have IgG responses detectable increases in IgG titers specific to serotypes 8 (G) or 9V (H), but did have IgG responses statistically significant IgG titer increases to serotype 14 (I).
  • J-L Trivalent CPS8-/CPS9V -/CPS 14-ComP bioconjugate vaccinated mice all had statistically significant IgG responses increases in IgG titers to serotypes 8 (J), 9V (K), and 14 (L).
  • Figure 36A,B Figure 36A and Figure 36B shows bactericidal activity of sera from vaccinated mice against S. pneumoniae serotypes 8 and 14.
  • Serotype-specific commercial rabbit anti-A. pneumoniae sera were used as positive controls.
  • a 5% (v/v) sample serum and a bacterial MOI of 0.01 were added to fresh whole blood from naive mice to perform the assay. Viable bacterial counts were performed after 4 h of incubation. To determine bacterial killing, viable bacterial counts from tubes incubated with sample sera were compared to those incubated with control naive mouse sera. Results are expressed as percent bacterial killing for individual mice, with horizontal bars representing the standard deviation of the mean.
  • Figure 37A,B Figure 37A and Figure 37B shows analysis of EPA glycosylation with the CPS8 capsular polysaccharide.
  • a - Left panel Anti-His channel probing for hexa-histidine tagged EPA purified from SDB1 expressing CPS8 in the presence or absence of PglS.
  • a - Middle panel Anti-glycan channel probing for CPS 8.
  • a - Right panel Merged images for left and middle panels.
  • B EPA-CPS8 separated on a SDS polyacrylamide gel stained with Coomassie.
  • Figure 37C shows intact protein mass spectrometry analysis showing the MSI mass spectra for purified EPA-CPS8.
  • the EPA fusion protein has a theoretical mass of 79,526.15 Daltons and can be observed as the peak at 79,514.76.
  • the EPA fusion protein was also observed in multiple states of increasing mass corresponding to the CPS8 repeating subunit, which has a theoretical mass of 662 Daltons. Varying glycoforms of the EPA-CPS8 were observed and are denoted by“g numenc ” where“g” stands for glycoform and the“numeric” corresponds to the number of repeating CPS 8 subunits.
  • the EPA fusion protein was modified with up to 11 repeating subunits of the CPS8 glycan.
  • Panel D provides a zoomed in view of the varying EPA-CPS8 glycoforms.
  • Figure 37D provides a zoomed in view of the varying EPA-CPS8 glycoforms from Figure 37C.
  • Figure 38A,B Figure 38A and Figure 38B shows analysis of immune responses to ComP-CPS8 and EPA-CPS8 bioconjugates in mice.
  • mice All mice were immunized with 100 pL of a vaccine diluted 1 : 1 with Imject Alum Adjuvant on days 1, 14, and 28. Sera were collected on day 4.
  • ELISA plates were coated with whole cell serotype 8 pneumococci and incubated with 2-fold serial dilutions of sera. Titers for individual mice are shown, with horizontal bars representing the standard error of the mean.
  • negative titer values ( ⁇ 100) were given an arbitrary value of 10.
  • Figure 39A,B,C Figure 39A, Figure 39B, and Figure 39C shows that a conserved and homologous serine is believed to be the site of glycosylation in ComP proteins from A. baylyi ADP1 and A. soli 110264.
  • Serines 82 and 84 of COITIPADPI and the homologous serines 79 and 82 of ComPno264 were mutated to an alanine and probed for glycosylation in the presence of PglS and the serotype 8 capsular polysaccharide.
  • A-C SDB1 cells expressing ComP variants in the presence of PglS and CPS8 were probed via western blotting for protein glycosylation.
  • A Anti-Elis channel probing for ComP expression and glycosylation.
  • B Anti- glycan channel probing for CPS8.
  • C Merged image for panels A and B.
  • Figure 40A,B,C shows an analysis of EPA glycosylation with the Klebsiella pneumoniae K1 and K2 capsular polysaccharides.
  • The“g°” denotes the non-glycosylated EPA fusion and“g n ” denotes the EPA fusion glycosylated with different sized K1 or K2 repeating subunits as depicted in panel B or C, respectively.
  • Figure 41A,B Figure 41A and Figure 41B shows intact protein mass spectrometry analysis showing the MSI mass spectra for purified EPA-K2.
  • the EPA fusion protein has a theoretical mass of 79,526.15 Daltons and can be observed as the peak at 79,518.73.
  • the EPA fusion protein was also observed in multiple states of increasing mass corresponding to the K. pneumoniae K2 capsular polysaccharide repeating subunit, which has a theoretical mass of 662 Daltons.
  • Varying gly coforms of the EPA-K2 were observed and are denoted by“g numenc ” where”g” stands for glycoform and“numeric” corresponds to the number of repeating K2 subunits.
  • the EPA fusion protein was modified with up to 11 repeating subunits of the K2 capsule.
  • a zoomed in view of A is also provided.
  • a or “an” entity refers to one or more of that entity; for example, “a polysaccharide,” is understood to represent one or more polysaccharides.
  • the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
  • non-naturally occurring substance, composition, entity, and/or any combination of substances, compositions, or entities, or any grammatical variants thereof is a conditional term that explicitly excludes, but only excludes, those forms of the substance, composition, entity, and/or any combination of substances, compositions, or entities that are well-understood by persons of ordinary skill in the art as being“naturally-occurring,” or that are, or might be at any time, determined or interpreted by a judge or an administrative or judicial body to be,“naturally-occurring.”
  • polypeptide is intended to encompass a singular
  • polypeptide as well as plural“polypeptides,” and refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds).
  • polypeptide refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product.
  • peptides, dipeptides, tripeptides, oligopeptides,“protein,” “amino acid chain,” or any other term used to refer to a chain or chains of two or more amino acids are included within the definition of "polypeptide,” and the term“polypeptide” can be used instead of, or interchangeably with any of these terms.
  • polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-standard amino acids.
  • a polypeptide can be derived from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It can be generated in any manner, including by chemical synthesis.
  • A“protein” as used herein can refer to a single polypeptide, i.e., a single amino acid chain as defined above, but can also refer to two or more polypeptides that are associated, e.g., by disulfide bonds, hydrogen bonds, or hydrophobic interactions, to produce a multimeric protein.
  • an "isolated" polypeptide or a fragment, variant, or derivative thereof is intended a polypeptide that is not in its natural milieu. No particular level of purification is required.
  • an isolated polypeptide can be removed from its native or natural environment.
  • Recombinantly produced polypeptides and proteins expressed in host cells are considered isolated as disclosed herein, as are recombinant polypeptides that have been separated, fractionated, or partially or substantially purified by any suitable technique.
  • non-naturally occurring polypeptide is a conditional term that explicitly excludes, but only excludes, those forms of the polypeptide that are well-understood by persons of ordinary skill in the art as being “naturally-occurring,” or that are, or might be at any time, determined or interpreted by a judge or an administrative or judicial body to be,“naturally-occurring.”
  • binding molecules or antigen-binding fragments, variants, or derivatives thereof.
  • binding molecule encompasses full-sized antibodies as well as antigen-binding fragments, variants, analogs, or derivatives of such antibodies, e.g., naturally-occurring antibody or immunoglobulin molecules or engineered antibody molecules or fragments that bind antigen in a manner similar to antibody molecules.
  • binding molecule refers in its broadest sense to a molecule that specifically binds an antigenic determinant.
  • a binding molecule can comprise one of more“binding domains.”
  • a "binding domain” is a two- or three-dimensional polypeptide structure that cans specifically bind a given antigenic determinant, or epitope.
  • a non-limiting example of a binding molecule is an antibody or fragment thereof that comprises a binding domain that specifically binds an antigenic determinant or epitope.
  • Another example of a binding molecule is a bispecific antibody comprising a first binding domain binding to a first epitope, and a second binding domain binding to a second epitope.
  • antibody and "immunoglobulin” can be used interchangeably herein.
  • An antibody or a fragment, variant, or derivative thereof as disclosed herein comprises at least the variable domain of a heavy chain and at least the variable domains of a heavy chain and a light chain.
  • Basic immunoglobulin structures in vertebrate systems are relatively well understood. See, e.g., Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988).
  • Binding molecules e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof include, but are not limited to, polyclonal, monoclonal, human, humanized, or chimeric antibodies, single chain antibodies, epitope-binding fragments, e.g., Fab, Fab' and F(ab')2, Fd, Fvs, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv), fragments comprising either a VL or VH domain, fragments produced by a Fab expression library.
  • ScFv molecules are known in the art and are described, e.g., in US patent 5,892,019.
  • Immunoglobulin or antibody molecules encompassed by this disclosure can be of any type (e.g., IgG, IgE, IgM, IgD, IgA, and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule.
  • binding molecule e.g., an antibody or fragment, variant, or derivative thereof binds to an epitope via its antigen binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope.
  • a binding molecule is said to "specifically bind” to an epitope when it binds to that epitope, via its antigen-binding domain more readily than it would bind to a random, unrelated epitope.
  • specificity is used herein to qualify the relative affinity by which a certain binding molecule binds to a certain epitope.
  • binding molecule "A” can be deemed to have a higher specificity for a given epitope than binding molecule "B,” or binding molecule “A” can be said to bind to epitope “C” with a higher specificity than it has for related epitope "D.”
  • bispecific antibody refers to an antibody that has binding sites for two different antigens within a single antibody molecule. It will be appreciated that other molecules in addition to the canonical antibody structure can be constructed with two binding specificities. It will further be appreciated that antigen binding by bispecific antibodies can be simultaneous or sequential. Triomas and hybrid hybridomas are two examples of cell lines that can secrete bispecific antibodies. Bispecific antibodies can also be constructed by recombinant means. (Strohlein and Heiss, Future Oncol. 6: 1387-94 (2010); Mabry and Snavely, IDrugs. 13:543-9 (2010)). A bispecific antibody can also be a diabody.
  • polynucleotide is intended to encompass a singular nucleic acid as well as plural nucleic acids, and refers to an isolated nucleic acid molecule or construct, e.g., messenger RNA (mRNA) or plasmid DNA (pDNA).
  • mRNA messenger RNA
  • pDNA plasmid DNA
  • a polynucleotide can comprise a conventional phosphodiester bond or a non-conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA)).
  • PNA peptide nucleic acids
  • nucleic acid refers to any one or more nucleic acid segments, e.g., DNA or RNA fragments, present in a polynucleotide.
  • isolated nucleic acid or polynucleotide is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment.
  • a recombinant polynucleotide encoding a polypeptide subunit contained in a vector is considered isolated as disclosed herein.
  • Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in solution.
  • Isolated RNA molecules include in vivo or in vitro RNA transcripts of polynucleotides. Isolated polynucleotides or nucleic acids further include such molecules produced synthetically.
  • polynucleotide or a nucleic acid can be or can include a regulatory element such as a promoter, ribosome binding site, or a transcription terminator.
  • a“non-naturally occurring” polynucleotide is a conditional definition that explicitly excludes, but only excludes, those forms of the polynucleotide that are well-understood by persons of ordinary skill in the art as being“naturally-occurring,” or that are, or that might be at any time, determined or interpreted by ajudge or an administrative or judicial body to be,“naturally-occurring.”
  • the polynucleotide or nucleic acid is DNA.
  • a polynucleotide can be RNA.
  • a "vector” is nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell.
  • a vector can include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication.
  • a vector can also include one or more selectable marker gene and other genetic elements known in the art.
  • a "transformed” cell, or a "host” cell is a cell into which a nucleic acid molecule has been introduced by molecular biology techniques.
  • transformation encompasses those techniques by which a nucleic acid molecule can be introduced into such a cell, including transfection with viral vectors, transformation with plasmid vectors, and introduction of naked DNA by electroporation, lipofection, and particle gun acceleration.
  • a transformed cell or a host cell can be a bacterial cell or a eukaryotic cell.
  • the term“expression” as used herein refers to a process by which a gene produces a biochemical, for example, a polypeptide.
  • the process includes any manifestation of the functional presence of the gene within the cell including, without limitation, gene knockdown as well as both transient expression and stable expression. It includes without limitation transcription of the gene into messenger RNA (mRNA), and the translation of such mRNA into polypeptide(s). If the final desired product is a biochemical, expression includes the creation of that biochemical and any precursors.
  • mRNA messenger RNA
  • expression includes the creation of that biochemical and any precursors.
  • a gene product can be either a nucleic acid, e.g., a messenger RNA produced by transcription of a gene, or a polypeptide that is translated from a transcript.
  • Gene products described herein further include nucleic acids with post transcriptional modifications, e.g., polyadenylation, or polypeptides with post translational modifications, e.g., methylation, glycosylation, the addition of lipids, association with other protein subunits, proteolytic cleavage, and the like.
  • treat refers to reducing the potential for disease pathology, reducing the occurrence of disease symptoms, e.g., to an extent that the subject has a longer survival rate or reduced discomfort.
  • treating can refer to the ability of a therapy when administered to a subject, to reduce disease symptoms, signs, or causes. Treating also refers to mitigating or decreasing at least one clinical symptom and/or inhibition or delay in the progression of the condition and/or prevention or delay of the onset of a disease or illness.
  • subject or “individual” or “animal” or “patient” or“mammal,” is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired.
  • Mammalian subjects include humans, domestic animals, farm animals, sports animals, and zoo animals, including, e.g., humans, non-human primates, dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, bears, and so on.
  • composition refers to a preparation that is in such form as to permit the biological activity of the active ingredient to be effective, and that contains no additional components that are unacceptably toxic to a subject to which the composition would be administered.
  • Such composition can be sterile.
  • an “effective amount” of an antibody as disclosed herein is an amount sufficient to carry out a specifically stated purpose.
  • An “effective amount” can be determined empirically and in a routine manner, in relation to the stated purpose.
  • Conjugate vaccines consisting of a polysaccharide linked to a protein, are lifesaving prophylactics.
  • conjugate vaccines are manufactured using chemical methodologies.
  • in vivo bacterial conjugations have emerged as manufacturing alternatives.
  • In vivo conjugation (bioconjugation) is reliant upon an oligosaccharyltransferase to attach polysaccharides to proteins.
  • the oligosaccharyltransferases employed for bioconjugations are not suitable for the generation of conjugate vaccines when the polysaccharides contain glucose at the reducing end. This limitation has enormous implications as -75% of Streptococcus pneumoniae capsules contain glucose as the reducing end sugar.
  • oligosaccharyltransferase to generate the first ever polyvalent pneumococcal bioconjugate vaccine with polysaccharides containing glucose at their reducing end.
  • Pneumococcal bioconjugates were immunogenic, protective, and rapidly produced with recombinant techniques.
  • Certain aspects disclosed herein provide for the engineering, characterization, and immunological responses of a polyvalent pneumococcal bioconjugate vaccine using the natural acceptor protein ComP as a vaccine carrier as well as a monovalent pneumococcal bioconjugate vaccine using a conventional vaccine carrier; e.g., in certain aspects, containing the Pseudomonas aeruginosa exotoxin A protein.
  • a conventional vaccine carrier e.g., in certain aspects, containing the Pseudomonas aeruginosa exotoxin A protein.
  • baylyi ADP1 encodes for two OTase, a PglL-like ortholog (UniProtKB/Swiss-Prot: Q6FFS6.1), which acts as the general OTase and PglS (UniProtKB/Swiss-Prot: Q6F7F9.1), which glycosylates a single protein, ComP (Harding, C.M. et al. Mol Microbiol 96, 1023-1041 (2015)).
  • ComP is orthologous to type IV pilin proteins, like PilA from Pseudomonas aeruginosa and PilE from Neisseria meningiditis, both of which are glycosylated by the OTases TfpO (Castric, P. Microbiology 141 ( Pt 5), 1247-1254 (1995)) and PglL (Power, P.M. et al. Mol Microbiol 49, 833-847 (2003)), respectively. Although TfpO and PglL also glycosylate their cognate pilins at serine residues, the sites of glycosylation differ between each system.
  • TfpO glycosylate has cognate pilin at a C-terminal serine residue (Comer, J.E., Marshall, M.A., Blanch, V.J., Deal, C.D. & Castric, P. Infect Immun 70, 2837-2845 (2002)), which is not present in ComP.
  • ComP also contains serine residues near position 63 and the surrounding residues show moderate conservation to PilE from N. meningiditis. Comprehensive glycopeptide analysis, however, revealed this serine and the surrounding residues were not the site of glycosylation in ComP.
  • the ability of PglS to transfer polysaccharides containing glucose as the reducing end sugar coupled with the identification of a novel site of glycosylation within the pilin superfamilies demonstrates that PglS is a functionally distinct OTase from PglL and TfpO.
  • PglS but not PglB or PglL, transferred polysaccharides containing glucose at their reducing end to the acceptor protein ComP.
  • PglB the first OTase described, preferentially transfers glycans containing an acetamido-group at the C-2 position of the reducing end (i.e. A-acetylglucosamine), as it is believed to play a role in substrate recognition (Wacker, M. et al. Proc Natl Acad Sci USA 103, 7088-7093 (2006)).
  • polysaccharides with galactose (Gal) at the reducing end such as the S. enterica Typhimurium O antigen, can be transferred by an engineered PglB variant (Ihssen, J. et al. Open Biol 5, 140227 (2015)).
  • meningiditis has more relaxed substrate specificity than PglB, naturally transferring polysaccharides with an acetamido-group at the C-2 position as well as polysaccharides containing galactose (Gal) at the reducing end (Faridmoayer, A., Fentabil, M.A., Mills, D C., Klassen, J.S. & Feldman, M.F. J Bacteriol 189, 8088-8098 (2007); Pan, C. et al. MBio 7 (2016)).
  • Acinetobacter species have been describes as containing three O-linked OTases; a general PglL OTase responsible for glycosylating multiple proteins, and two pilin-specific OTases (Harding, C.M. Mol Microbiol 96, 1023-1041 (2015)).
  • the first pilin-specific OTase is an ortholog of TfpO (also known as PilO) and is not employed for in vivo conjugation systems due to its inability to transfer polysaccharides with more than one repeating unit (Faridmoayer, A., Fentabil, M.A., Mills, D.C., Klassen J.S. & Feldman, M.F.
  • PglS glycosylates a single protein, the type IV pilin ComP 28 .
  • PglS can transfer S. pneumoniae polysaccharides to ComP, wherein PglB and PglL could not.
  • PglS is the only OTase in the known universe capable of transferring polysaccharides with glucose at the reducing end.
  • PglS can be used to transfer any lipid-linked oligosaccharide or polysaccharide (collectively referred to herein as“oligo- or polysaccharide”) containing glucose at the reducing end to ComP or a fusion protein containing a fragment of ComP.
  • PglS can transfer capsular polysaccharides of Klebsiella to ComP.
  • Klebsiella pneumonia K. pneumoniae
  • K. pneumoniae a Gram negative opportunistic human pathogen
  • at least 79 antigenically distinct capsular polysaccharides have been described for Klebsiella species (Pan, Y.J. et al. Sci Rep 5, 15573 (2015)).
  • K. pneumoniae is known to produce at least 59 of the 77 capsular polysaccharides, more than half of which contain glucose as the reducing end sugar (Pan, Y.J. et al. Sci Rep 5, 15573 (2015)).
  • PglS can transfer K. pneumoniae polysaccharides to ComP. Given that most K. pneumoniae capsular polysaccharides contain glucose as the reducing end sugar, the only other commercially licensed OTases (PglB and PglL) should be unable to generate conjugate vaccines using these polysaccharides. Moreover, co-expression of the transcriptional activator, RmpA, with the capsule gene cluster enhanced capsule expression to detectably levels.
  • the method for producing Klebsiella conjugates can be used to generate a pan Klebsiella conjugate vaccine encompassing all serotypes - including other species such as K. varricola, K. michiganensis, and if. oxytoca.
  • ComP does not appear to have an obvious LCR or a C-terminal serine residue homologous to those found in other pilin like proteins and therefore mass spectrometry was employed to determine the site(s) of glycosylation.
  • Purified CPS 14-ComP bioconjugates were subjected to proteolytic digestion, ZIC-HILIC gly copeptide enrichment, and multiple MS analyses. As seen in Figure 17A and Figure 17B, a single glycopeptide consisting of the peptide ISASNATTNVATAT (SEQ ID NO: 22) was identified attached to a glycan that matched the published CPS14 composition (Geno, K.A. et al. Clin Microbiol Rev 28, 871-899 (2015)).
  • jejuni heptasaccharide was employed as the donor glycan, as glycosylation is readily detectable with the hR6 anti-glycan antisera as well as by an increase in electrophoretic mobility (Schwarz, F. et al. Nat Chem Biol 6, 264-266 (2010)). As shown in Figure 18, wild type hexa-his tagged ComP was glycosylated with the C. jejuni heptasaccharide as indicated by its increased electrophoretic mobility and co-localization with hR6 antisera signal when co-expressed with PglS. MS analysis also confirmed the presence of the C.
  • a catalytically inactive PglS mutant H324A was generated, that when co expressed with the C. jejuni heptasacchride glycan was unable to glycosylate wild type ComP.
  • Site directed mutagenesis was performed and it was observed that glycosylation of ComP with the C. jejuni heptasaccharide was abolished in the ComP[S84A] mutant, whereas ComP[S82A] was glycosylated at wild-type levels.
  • ComP was first described as a factor required for natural transformation in Acinetobacter baylyi ADP1 (Porstendorfer, D., Drotschmann, U. & Averhoff, B. Appl Environ Microbiol 63, 4150-4157 (1997)).
  • ComPADPi ComP from A. baylyi ADP1 (herein referred to as ComPADPi) was glycosylated by a novel OTase, PglS, located immediately downstream of ComP, and not the general OTase PglL located elsewhere on the chromosome (Harding, C.M. et al.
  • the ComP ADPi protein belongs to a family of proteins called type IV pilins. Specifically, ComP shares homology to type IVa major pilins (Giltner, C.L., Nguyen, Y. & Burrows, L.L. Microbiol Mol Biol Rev 76, 740- 772 (2012)). Type IVa pilins share high sequence homology at their N-terminus, which encode for the highly conserved leader sequence and N-terminal alpha helix; however, the C-terminus display remarkable divergences across genera and even within species (Giltner, C.L., Nguyen, Y.
  • All six ComP orthologs carry both a pglS homolog immediately downstream of the comP gene as well as a pglL homolog located elsewhere in the chromosome. Together, at least the presence of the conserved serine at position 84, the disulfide loop flanking the site of glycosylation, the presence of a pglS gene immediately downstream of comP, and the presence of a pglL homolog located elsewhere on the chromosome differentiate ComP pilin variants from other type IVa pilin variants.
  • ComP proteins can be differentiated from other pilins by the presence of the conserved glycosylated serine located at position 84 relative to the ADP1 ComP protein and the presence of a disulfide loop flanking the site of glycosylation. In addition, the presence of a pglS homolog immediately downstream of ComP is an indicator of ComP.
  • a ComP protein comprises and is capable of being glycosylated on a serine residue corresponding to the conserved serine residue at position 84 of SEQ ID NO: 1 (COITIPADPI: AAC45886.1).
  • ComP from A. soli CIP 110264 is glycosylated by PglS from A. baylyi ADP1. Given the presence of multiple ComP orthologs, whether PglS from A. baylyi ADP1 was able to glycosylate a divergent ComP protein was investigated.
  • the ComP protein from A. soli CIP 110264 (ComPno264) is 71% identical at the amino acid level when compared to ComPADPi. However, consistent with the features above, ComPno264 contains the predicted disulfide bridge between the predicted alpha-beta loop and the second beta strand as well as the conserved serine located at position 84 relative to ComP ADPi .
  • PglS ortholog can be found immediately downstream of ComPno264.
  • PglS ADPi PglS ADPi
  • PglSADPi was cloned into pACT3 and ComPno264 into pEXT20 (Dykxhoom, D.M., St Pierre, R. & Linn, T. Gene 177, 133-136 (1996)) and these plasmids were introduced into E. coli expressing the serotype 8 capsular polysaccharide (CPS8) from S. pneumoniae. Further, the converse experiment was performed by cloning and expressing PglS from A.
  • PglSno264 soli CIP 110264 (PglSno264) with ComPADPi.
  • PglSno264 minimally glycosylated its cognate acceptor pilin ComPno264 as indicated by higher molecular weight ComP pilin variants when compared to whole cell lysates lacking PglS 110264.
  • PglS 110264 appeared to not glycosylate ComPADPi.
  • PglSADPi efficiently glycosylated both ComPADPi and ComPi 10264 as indicated by the robust increase of His-reactive signals of increasing electrophoretic mobility.
  • PglS ADPi appears to be an optimal OTase from heterologous glycosylation in E. coli with a unique ability to cross glycosylate multiple ComP substrates.
  • coli were selected as suitable carriers as both have been previously shown to facilitate periplasmic localization and solubility of acceptor proteins fused at their C-termini (Malik, A. Biotech 6, 44 (2016)). Exotoxin A from Pseudomonas aeruginosa (EPA) was also selected as it has been previously shown to act as an immunogenic carrier protein in other conjugate vaccine formulations (Ravenscroft, N. et al. Glycobiology 26, 51-62 (2016)). Fusion proteins consisted of a leader sequence, carrier protein, a short linker peptide, a ComP variant without the first 28 amino acids, and a hexa-histidine tag.
  • EPA Pseudomonas aeruginosa
  • the first 28 amino acids of ComPADPi and ComPno264 were removed as these amino acids contain the leader sequence as well as the hydrophobic region of the N-terminal alpha helix predicted to be embedded into the inner membrane. Fusion constructs were then introduced into E. coli expressing the pneumococcal serotype 8 capsular polysaccharide (CPS8) and either pACT3 alone or pACT3 carrying pglSno 264 or pglS ADPi . As seen in Figure 21, E.
  • CPS8 pneumococcal serotype 8 capsular polysaccharide
  • E. coli cells expressing either DsbA-AAA-ComPA28110264 or DsbA-GGGS- ComP ⁇ 28 i 10264 in combination with PglS ADPi demonstrated detectable levels of glycosylation as indicated by the modal distribution of his reactive signals of increasing electrophoretic mobility.
  • E. coli cells expressing fusions containing ComP ⁇ 28, ⁇ DPI did not demonstrate any detectable glycosylation. The same glycosylation pattern was observed for E. coli cells expressing maltose binding protein (MBP) fusions. Specifically, as seen in Figure 22, E.
  • MBP maltose binding protein
  • coli cells expressing either MBP-AAA-ComPA28iio264 or MBP-GGGS-ComPA28no264 in combination with PglSADPi demonstrated detectable levels of glycosylation as indicated by the modal distribution of anti-His reactive signals; whereas, fusions with ComP ⁇ 28 ⁇ DP I were only minimally glycosylated.
  • a fusion protein was engineered containing the DsbA signal peptide sequence fused to EPA.
  • the ComP ⁇ 28 i 10214 peptide was then fused with glycine-glycine-glycine-serine (GGGS; SEQ ID NO: 23) linker to the C-terminus of EPA and tested for glycosylation in the presence and absence of PglS ADPi in both whole cell extracts and in periplasmic extracts.
  • GGGS glycine-glycine-glycine-serine
  • PglS ADPi is an optimal OTase for transferring polysaccharides containing glucose at the reducing end to truncated ComP fusion proteins. Specific amino acid sequences for each fusion construct are shown in Figure 24.
  • bioconjugates comprising an oligo- or polysaccharide linked to a fusion protein.
  • the oligo- or polysaccharide is covalently linked to the fusion protein.
  • the fusion protein comprises a ComP protein (ComP).
  • the fusion protein comprises a glycosylation tag of a ComP protein (as described in detail elsewhere herein).
  • ComP is glycosylated on a serine (S) residue.
  • S serine residue
  • This serine residue is conserved in ComP proteins and corresponds to position 84 of SEQ ID NO: 1 (COITLPADPI : AAC45886.1).
  • This serine residue also corresponds to position 82 of SEQ ID NO: 2 (ComPl 10264: ENV58402.1) ( Figure 39A, B, and C).
  • a fusion protein (and thus the bioconjugate) is glycosylated with an oligo- or polysaccharide on a ComP glycosylation tag thereof at a serine residue corresponding to the serine residue at position 84 of SEQ ID NO: 1 (COITLPADPI : AAC45886.1) or corresponding to the serine redisue at position 82 of SEQ ID NO: 2.
  • Figure 28 shows an alignment of a region of ComP sequences including the serine (S) residue (boxed) corresponding to the serine residue at position 84 of SEQ ID NO: 1 (COITLPADPI : AAC45886.1), which is conserved across the ComP sequences.
  • the ComP glycosylation tag comprises both a cysteine residue corresponding to the conserved cysteine residue at position 75 of SEQ ID NO: 1 (COLTLPADPL : AAC45886.1) and a cysteine residue corresponding to the conserved cysteine residue at position 95 of SEQ ID NO: 1.
  • the ComP glycosylation tag comprises both a cysteine residue corresponding to the conserved cysteine residue at position 71 of SEQ ID NO: 2 (COLTLPADPL : AAC45886.1) and a cysteine residue corresponding to the conserved cysteine residue at position 93 of SEQ ID NO: 2.
  • the oligo- or polysaccharide comprises a glucose at its reducing end.
  • a ComP protein is a protein that has been identified as ComP protein consistent with the description provided herein.
  • representative examples of ComP proteins include, but are not limited to: AAC45886.1 ComP [Acinetobacter sp. ADP1]; ENV58402.1 hypothetical protein F951_00736 [Acinetobacter soli CIP 110264]; APV36638.1 competence protein [Acinetobacter soli GFJ-2]; PKD82822.1 competence protein [Acinetobacter radioresistens 50vl]; SNX44537.1 type IV pilus assembly protein PilA [Acinetobacter puyangensis ANC 4466]; and OAL75955.1 competence protein [Acinetobacter sp.
  • a ComP protein comprises an amino acid sequence that is at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 1 (ComP ADpi : AAC45886.1) and contains a serine residue corresponding to the conserved serine residue at position 84 of SEQ ID NO: 1 (ComPADPi: AAC45886.1).
  • SEQ ID NO: 1 comprises a leader sequence of 28 amino acids.
  • a ComP protein comprises an amino acid sequence that is at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 7 (ComPA28ADPi), SEQ ID NO: 8 (ComPA28no264), SEQ ID NO: 9 (ComPA28 GFj-2 ), SEQ ID NO: 10 (ComPA28p50vi), SEQ ID NO: 11 (ComPA28 4466 ), or SEQ ID NO: 12 (ComPA28 SF c) that do not include the 28 amino acid leader sequence but do contain a serine residue corresponding to the conserved serine residue at position 84 of SEQ ID NO: 1 (COITIPADPI: AAC45886.1).
  • a ComP protein comprises an amino acid sequence that is at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 7 (ComPA28 ADPi ) that does not include the 28 amino acid leader sequence but does contain a serine residue corresponding to the conserved serine residue at position 84 of SEQ ID NO: 1 (ComP ADpi : AAC45886.1).
  • the ComP protein comprises SEQ ID NO: 7 (ComPA28ADPi), SEQ ID NO: 8 (ComPA28no264), SEQ ID NO: 9 (ComPA28 GFj-2 ), SEQ ID NO: 10 (ComPA28p50vi), SEQ ID NO: 11 (ComPA28 4466 ), or SEQ ID NO: 12 (ComPA28 SF c).
  • the ComP protein is SEQ ID NO: 1 (COITLPADPI: AAC45886.1), SEQ ID NO: 2 (ComPno 264 : ENV58402.1), SEQ ID NO: 3 (ComP GFj-2 : APV36638.1), SEQ ID NO: 4 (ComPso vi : PKD82822.1), SEQ ID NO: 5 (ComP 466 : SNX44537.1), or SEQ ID NO: 6 (ComPsFc: OAL75955.1).
  • the bioconjugate is produced in vivo in a host cell such as by any of the methods of production disclosed herein.
  • the bioconjugate is produced in a bacterial cell, a fungal cell, a yeast cell, an avian cell, an algal cell, an insect cell, or a mammalian cell.
  • the bioconjugate is produced in a cell free system. Examples of the use of a cell free system utilizing OTases other than PglS can be found in WO2013/067523A1, which in incorporated herein by reference.
  • the ComP glycosylation tag of this disclosure does not comprise a methionine residue corresponding to the conserved methionine residue at position 104 of SEQ ID NO: 2 (ComPno264: ENV58402.1).
  • such methionine residue in a ComP amino acid sequence is substituted with another amino acid that does not exhibit an inhibitory effect or is deleted from the ComP glycosylation tag amino acid sequence.
  • the amino acid sequence of the ComP glycosylation tag does not extend in the C- terminus direction beyond the amino acid residue corresponding to position 103 of SEQ ID NO: 2 (ComPiio264: ENV58402.1).
  • the amino acid sequence of the ComP glycosylation tag ends with the residue corresponding to position 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, or 103 of SEQ ID NO: 2 (ComPno264: ENV58402.1).
  • a fusion protein comprising a ComP glycosylation tag likewise would not comprise a methionine residue at a position corresponding to or corresponding about to the conserved methionine residue at position 104 of SEQ ID NO: 2 (ComPno264: ENV58402.1) in relation to the ComP glycosylation tag, even if the methionine residue is attributed to a sequence of the fusion protein not as belonging to the ComP glycosylation tag sequence.
  • the fusion protein of the bioconjugate does not comprise, in relationship to the ComP glycosylation tag, a methionine residue at a position that would correspond to or correspond about to the conserved methionine residue at position 104 of SEQ ID NO: 2 (ComPno264: ENV58402.1).
  • the fusion protein of the bioconjugate does not comprise, in relationship to the ComP glycosylation tag, a methionine residue at a position that would correspond to the conserved methionine residue at position 104 of SEQ ID NO: 2 (ComPno264: ENV58402.1).
  • a ComP glycosylation tag of the current disclosure is generally not a full length ComP protein.
  • the ComP glycosylation tag has a length of between 18 and 50 amino acids in length, for example, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43,
  • the glycosylation tag has length of between 21 and 45 amino acids in length. In certain embodiments, the glycosylation tag has a length of between 23 and 45 amino acids in length.
  • the ComP glycosylation tag of the current disclosure can be a fragment, a variant, or a variant fragment of a ComP protein as described anywhere herein.
  • the ComP protein comprises an amino acid sequence that is at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 7 (ComPA28 ADpi ), SEQ ID NO: 8 (ComPA28no264), SEQ ID NO: 9 (ComPA28 GFj-2 ), SEQ ID NO: 10 (ComPA28p50vi), SEQ ID NO: 11 (ComPA28 4466 ), or SEQ ID NO: 12 (ComPA28 SF c).
  • the ComP protein comprises an amino acid sequence that is at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 7 (ComPA28 ADPi ) or SEQ ID NO: 8 (ComPA28110264).
  • the ComP protein comprises SEQ ID NO: 7 (ComPA28ADPi), SEQ ID NO: 8 (ComPA28110264), SEQ ID NO: 9 (ComPA28 GFj-2 ), SEQ ID NO: 10 (ComPA28 P5 ovi), SEQ ID NO: 11 (ComPA28 4466 ), or SEQ ID NO: 12 (ComPA28s F c).
  • the ComP protein comprises an amino acid sequence that is at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 1 (COIDPADPI: AAC45886.1), SEQ ID NO: 2 (ComP 110264: ENV58402.1), SEQ ID NO: 3 (ComP GFj-2 : APV36638.1), SEQ ID NO: 4 (Compso vi : PKD82822.1), SEQ ID NO: 5 (ComP 4 46 6 : SNX44537.1), or SEQ ID NO: 6 (ComPsFc: OAL75955.1).
  • SEQ ID NO: 1 COIDPADPI: AAC45886.1
  • SEQ ID NO: 2 ComP 110264: ENV58402.1
  • SEQ ID NO: 3 ComP GFj-2 : APV36638.1
  • SEQ ID NO: 4 Compso vi : PKD82822.1
  • the ComP protein comprises an amino acid sequence that is at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 1 (COIIIPADPI : AAC45886.1) or SEQ ID NO: 2 (ComPno264: ENV58402.1).
  • the ComP protein comprises SEQ ID NO: 1 (ComPADPi: AAC45886.1), SEQ ID NO: 2 (ComPno264: ENV58402.1), SEQ ID NO: 3 (ComPcFj-2: APV36638.1), SEQ ID NO: 4 (Com P5 o vi : PKD82822.1), SEQ ID NO: 5 (ComP 4 46 6 : SNX44537.1), or SEQ ID NO: 6 (ComPs F c: OAL75955.1).
  • a ComP glycosylation tag of the current disclosure can be defined as comprising or consisting of the amino acid consensus sequence of SEQ ID NO: 27:
  • Xi is V, A, or no amino acid
  • X 2 is A, G, T, or no amino acid
  • X 5 is P, S, or Q
  • X 7 is T, P, or V
  • X 8 is A, S, or T
  • X 9 is G, N, S, or T;
  • X10 is N or no amino acid
  • X 11 is S, G, or A
  • X12 is S or N
  • Xi 4 is V, T, or A
  • X 17 is Q, T, or E
  • Xi 8 is E, Q, or T
  • X 20 is S, N, A, or G
  • X21 is S or no amino acid
  • X 22 is G or no amino acid
  • X 25 is N, S, or A
  • X 26 is A, S, or K
  • X 28 is T, S, or K
  • X 31 is A or E
  • X32 is T or S
  • X34 is T, Q, or A
  • X 36 is G, S, or T;
  • X 37 is A, G, or D
  • X 38 is S, L, or A
  • X 39 is S, G, D, or T;
  • X 40 is A, V, or G
  • X41 is G, I, orV
  • X42 is Q, T, or I
  • X 43 is I, V, T, or L
  • X 44 is I, T, or V.
  • a ComP glycosylation tag comprises or consists of a fragment of the amino acid consensus sequence of SEQ ID NO: 27, wherein the fragment retains the cysteine residue at position 13 of SEQ ID NO: 27, the cysteine residue at position 35 of SEQ ID NO: 27, and the serine residue at position 24 of SEQ ID NO: 27.
  • a ComP glycosylation tag comprises or consists of a variant of the amino acid consensus sequence of SEQ ID NO: 27 or a fragment thereof, having one, two, three, four, five, six, or seven amino acid substitutions, additions, and/or deletions, however, wherein the variant maintains the cysteine residue at position 13 of SEQ ID NO: 27, the cysteine residue at position 35 of SEQ ID NO: 27, and the serine residue at position 24 of SEQ ID NO: 27.
  • the amino acid substitution is a conservative amino acid substitution.
  • a ComP glycosylation tag comprising SEQ ID NO: 27 does not comprise a methionine residue in a position corresponding to the conserved methionine residue at position 104 of SEQ ID NO: 2 (ComPno264: ENV58402.1). Further, in certain embodiments, the amino acid sequence of a ComP glycosylation tag comprising SEQ ID NO: 27 does not extend in the C- terminus direction beyond the amino acid residue corresponding to position 44 of SEQ ID NO: 27. In certain embodiments, a ComP glycosylation tag comprising or consisting of the amino acid consensus sequence of SEQ ID NO: 27 or fragment and/or variant thereof is not more than 25, 30, 40, 45, or 50 amino acids in length.
  • a ComP glycosylation tag of the current disclosure can be defined as comprising or consisting of the amino acid consensus sequence of SEQ ID NO: 28:
  • X2 is V, T, or A, optionally V;
  • X 5 is Q, T, or E, optionally Q;
  • C d is E, Q, or T
  • X 8 is S, N, A, or G
  • X 9 is S or no amino acid
  • X10 is G or no amino acid
  • Xi3 is N, S, or A, optionally N;
  • Xi 4 is A, S, or K, optionally A;
  • Xi 6 is T, S, or K
  • Xi 9 is A or E, optionally A;
  • X20 is T or S, optionally T; or
  • X22 is T, Q, or A, optionally T.
  • a ComP glycosylation tag comprises or consists of a variant of the amino acid consensus sequence of SEQ ID NO: 28 having one, two, three, four, five, six, or seven amino acid substitutions, additions, and/or deletions, however, wherein the variant maintains the cysteine residue at position 1 of SEQ ID NO: 28, the cysteine residue at position 23 of SEQ ID NO: 28, and the serine residue at position 12 of SEQ ID NO: 28.
  • the amino acid substitution is a conservative amino acid substitution.
  • a ComP glycosylation tag comprising SEQ ID NO: 28 does not comprise a methionine residue in a position corresponding to the conserved methionine residue at position 104 of SEQ ID NO: 2 (ComPi 10264: ENV58402.1). Further, in certain embodiments, the amino acid sequence of a ComP glycosylation tag comprising SEQ ID NO: 28 does not extend in the C-terminus direction beyond the amino acid residue corresponding to position 103 of SEQ ID NO: 2 (ComPno264: ENV58402.1). In certain embodiments, a ComP glycosylation tag comprising the amino acid consensus sequence of SEQ ID NO: 28 or variant thereof is not more than 25, 30, 40, 45, or 50 amino acids in length.
  • the ComP glycosylation tag comprises or consists of a variant thereof having one, two, three, four, five, six, or seven amino acid substitutions, additions, and/or deletions of an amino acid sequence selected from the group consisting of: SEQ ID NO: 32 [Cl]; SEQ ID NO: 33 [Dl]; SEQ ID NO: 34 [El]; SEQ ID NO: 41 [E2]; SEQ ID NO: 42 [F2]; SEQ ID NO: 43 [G2]; SEQ ID NO: 44 [H2]; SEQ ID NO: 45 [A3]; SEQ ID NO: 46 [B3]; SEQ ID NO: 47 [C3]; SEQ ID NO: 55 [D4]; SEQ ID NO: 56 [E4]; SEQ ID NO: 57 [F4]; SEQ ID NO: 58 [G4]; SEQ ID NO: 59 [A5]; SEQ ID NO: 60 [B5]; SEQ ID NO: 61 [D5
  • the amino acid substitution is a conservative amino acid substitution.
  • the ComP glycosylation tag comprises or consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 32 [Cl]; SEQ ID NO: 33 [Dl]; SEQ ID NO: 34 [El]; SEQ ID NO: 41 [E2]; SEQ ID NO: 42 [F2]; SEQ ID NO: 43 [G2]; SEQ ID NO: 44 [H2]; SEQ ID NO: 45 [A3]; SEQ ID NO: 46 [B3]; SEQ ID NO: 47 [C3]; SEQ ID NO: 55 [D4]; SEQ ID NO: 56 [E4]; SEQ ID NO: 57 [F4]; SEQ ID NO: 58 [G4]; SEQ ID NO: 59 [A5]; SEQ ID NO: 60 [B5]; SEQ ID NO: 61 [D5]; SEQ ID NO: 62 [E5]; SEQ ID NO: 59 [A5]; S
  • such a ComP glycosylation tag comprising one of the above sequences or variants thereof does not comprise a methionine residue in a position corresponding to the conserved methionine residue at position 104 of SEQ ID NO: 2 (ComPno264: ENV58402.1).
  • the amino acid sequence of such a ComP glycosylation tag comprising one of the above sequences or variants thereof does not extend in the C-terminus direction beyond the amino acid residue corresponding to position 103 of SEQ ID NO: 2 (ComPno264: ENV58402.1).
  • a ComP glycosylation tag comprising an amino acid sequence and/or variant thereof listed above is not more than 25, 30, 40, 45, or 50 amino acids in length.
  • a ComP glycosylation tag consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 32 [Cl]; SEQ ID NO: 33 [Dl]; SEQ ID NO: 34 [El]; SEQ ID NO: 41 [E2]; SEQ ID NO: 42 [F2]; SEQ ID NO: 43 [G2]; SEQ ID NO: 44 [H2]; SEQ ID NO: 45 [A3]; SEQ ID NO: 46
  • the oligo- or polysaccharide for conjugation to the glycosylation tag, fusion protein, and/or bioconjugate is produced by a bacteria from the genus Streptococcus.
  • the polysaccharide is a S. pneumoniae, S. agalactiae, or S. suis capsular polysaccharide.
  • the capsular polysaccharide is CPS14, CPS8, CPS9V, or CPS15b.
  • the oligo- or polysaccharide is produced by a bacteria from the genus Klebsiella.
  • the polysaccharide is a Klebsiella pneumoniae, Klebsiella varricola, Klebsiella michinganenis , or Klebsiella oxytoca capsular polysaccharide.
  • the polysaccharide is a Klebsiella pneumoniae capsular polysaccharide.
  • the polysaccharide is a serotype K1 or serotype K2 capsular polysaccharide of Klebsiella pneumoniae.
  • the bioconjugate is produced in vivo.
  • the bioconjugate is produced in a bacterial cell.
  • the bioconjugate comprises an oligo- or polysaccharide covalently linked to a fusion protein
  • the carrier protein is one recognized in the art as useful in producing conjugate vaccines.
  • the glycosylation tag fragment and thus the fusion protein can be glycosylated at the conserved serine residue described elsewhere herein.
  • the fusion protein comprises a carrier protein selected from the group consisting of diphtheria toxoid CRM 197, tetanus toxoid, Pseudomonas aeruginosa Exotoxin A (EPA), tetanus toxin C fragment, cholera toxin B subunit, Haemophilus influenza protein D, or a fragment thereof.
  • the carrier protein or fragment thereof is linked to the ComP glycosylation tag via an amino acid linker, for example (GGGS) n (SEQ ID NO: 23), wherein n is at least one or AAA (SEQ ID NO: 24).
  • the fusion protein comprise two or more, three or more, four or more, five or more, six or more, eight or more, ten or more, fifteen or more, or twenty or more ComP glycosylation tags.
  • the fusion protein comprises any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 20 to any of 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, or 25 ComP glycosylation tags.
  • multiple glycosylation tags are arranged in tandem to one another in the fusion protein.
  • multiple glycosylation tags are arranged apart from one another in the fusion protein, for example separated by sequences of carrier protein.
  • the glycosylation tag(s) can be, for example, located at the N-terminal end of the carrier protein and/or fusion protein.
  • the glycosylation tag(s) can be, for example, located at the C-terminal end of the carrier protein and/or fusion protein.
  • the glycosylation tag(s) can be located internally within the carrier protein and/or fusions protein, for example, wherein a glycosylation tag is located between multiple carrier proteins in a fusion protein.
  • the multiple carrier proteins can be identical in type or different in type.
  • the glycosylation tags can be identical in type or different in type. In certain embodiments, these ComP glycosylation tags are identical. In certain embodiments, at least two of the ComP glycosylation tags differ from each other. In certain embodiments, at least three, at least four, or at least five of the ComP glycosylation tags all differ from each other. Further, in certain embodiments, none of the ComP glycosylation tags are the same.
  • a bioconjugate of this invention may have one of numerous uses including, but not limited to, use as a conjugate vaccine.
  • the conjugate vaccine is a vaccine against Streptococcus pneumoniae serotype 8, Streptococcus pneumoniae serotype 1, Streptococcus pneumoniae serotype 2, Streptococcus pneumoniae serotype 4, Streptococcus pneumoniae serotype 5, Streptococcus pneumoniae serotype 6A, Streptococcus pneumoniae serotype 6B, Streptococcus pneumoniae serotype 7F, Streptococcus pneumoniae serotype 9N, Streptococcus pneumoniae serotype 9V, Streptococcus pneumoniae serotype 10A, Streptococcus pneumoniae serotype 11A, Streptococcus pneumoniae serotype 12F, Streptococcus pneumoniae serotype 14, Streptococcus pneumoniae serotype 15B, Streptococcus pneumonia
  • the conjugate vaccine is useful because it induces an immune response when administered to a subject.
  • the immune response elicits long term memory (memory B and T cells), is an antibody response, and is optionally a serotype-specific antibody response.
  • the antibody response is an IgG or IgM response.
  • the antibody response can be an IgG response, and in certain embodiments, an IgGl response.
  • the conjugate vaccine generates immunological memory in a subject administered the vaccine.
  • a fusion protein as disclosed in further detail elsewhere herein and comprising a ComP glycosylation tag as disclosed in detail elsewhere herein.
  • the fusion protein is glycosylated at a serine residue on the glycosylation tag corresponding to the serine residue at position 84 of SEQ ID NO: 1 (COITLPADPI: AAC45886.1).
  • the fusion protein is glycosylated with an oligo- or polysaccharide.
  • the oligo- or polysaccharide is produced by a bacteria from the genus Streptococcus such as, for example, a S. pneumoniae, S. agalactiae, or S.
  • the capsular polysaccharide is CPS14, CPS8, CPS9V, or CPS 15b.
  • the oligo- or polysaccharide is produced by a bacteria from the genus Klebsiella, for example, a Klebsiella pneumoniae, Klebsiella varricola, Klebsiella michinganenis , or Klebsiella oxytoca capsular polysaccharide.
  • the polysaccharide is a Klebsiella pneumoniae capsular polysaccharide.
  • the polysaccharide is a serotype K1 or serotype K2 capsular polysaccharide of Klebsiella pneumoniae.
  • the oligo- or polysaccharide comprises a glucose at its reducing end.
  • Certain embodiments are drawn a fusion protein wherein the fusion protein is produced in vivo.
  • the fusion protein is produced in a mammalian cell, fungal cell, yeast cell, insect cell, avian cell, algal cell, or bacterial cell.
  • the fusion protein is produced in a bacterial cell, for example, E. coli.
  • the method comprises covalently linking the oligo- or polysaccharide to the polypeptide with a PglS oligosaccharyltransferase (OTase) (described elsewhere herein).
  • the polypeptide comprises a ComP protein or a glycosylation tag thereof.
  • the polypeptide comprises a ComP protein or a glycosylation tag thereof linked to a heterologous polypeptide such as a carrier protein.
  • PglS OTases include, but are not limited to PglSno264, PglSADPi, PglSGFj-2, PglSsovi, PglS4466, and PglSsFC- ComP proteins are described in detail elsewhere and representative examples include, but are not limited to ComPno264, ComPADPi, ComPGFj-2, ComP50vi, ComP4466, and ComPsFC- It will be recognized that while a PglS OTase from an organism would naturally glycosylate the ComP protein from that organism (e.g., PglSno264 glycosylates ComPno264) in certain embodiments, a PglS from one organism glycosylates a ComP from a different organism (e.g., PglSADPi glycosylates ComPii0264).
  • the PglS OTase is PglSADPi.
  • the ComP protein glycosylated is not ComPADPi.
  • the ComP protein is ComPno264.
  • a PglS OTase does not naturally glycosylate a ComP protein or a glycosylation tag fragment thereof, even from the same organism as the PglS Otase, when the ComP protein or glycosylation tag fragment thereof is linked to a heterologous carrier protein.
  • the ComP protein or glycosylation tag fragment thereof is glycosylated at a serine residue corresponding to the serine residue at position 84 of SEQ ID NO: 1 (ComP ADPi : AAC45886.1).
  • the in vivo glycosylation occurs in a host cell.
  • the host cell can be a mammalian cell, fungal cell, yeast cell, insect cell, avian cell, algal cell, or bacterial cell.
  • the host cell is a bacterial cell, for example, E. coli.
  • the method comprises culturing a host cell comprising the components necessary for the conjugation of the oligo- or polysaccharide to the polypeptide.
  • these components are the oligosaccharyltransferase, the acceptor polypeptide to be glycosylated, and the oligo- or polysaccharide.
  • the method comprises culturing a host cell that comprises: (a) a genetic cluster encoding for the proteins required to synthesize the oligo- or polysaccharide; (b) a PglS OTase; and (3) the acceptor polypeptide.
  • the production of the oligo- or polysaccharide can be enhanced by a transcriptional activator.
  • the production of the oligo- or polysaccharide is enhanced by the K. pneumoniae transcriptional activator rmpA ( K . pneumoniae NTUH K-2044) or a homolog of the K. pneumoniae transcriptional activator rmpA ( K . pneumoniae NTUH K-2044).
  • the method further comprises expressing and/or providing such a transcriptional activator in the host cell along with the other components.
  • the carrier protein linked to the ComP glycosylation tag is, for example, diphtheria toxoid CRM197, tetanus toxoid, Pseudomonas aeruginosa Exotoxin A (EPA), tetanus toxin C fragment, cholera toxin B subunit, Haemophilus influenza protein D, or a fragment thereof.
  • Certain embodiments are directed to a method a conjugate vaccine comprising a bioconjugate of this disclosure or a method of producing such conjugate vaccine.
  • a host cell comprising the components for in vivo glycosylation of an acceptor ComP protein or glycosylation tag fragment thereof.
  • a host cell comprises: (a) a genetic cluster encoding for the proteins required to synthesize an oligo- or polysaccharide; (b) a PglS OTase; and (3) an acceptor polypeptide comprising a ComP protein or a glycosylation tag fragment thereof.
  • the acceptor polypeptide is a fusion protein.
  • the host cell further comprises a transcriptional activator such as described above along with the other components.
  • a host cell comprises an isolated nucleic acid encoding a PglS OTase. In certain embodiments a host cell comprises an isolated nucleic acid encoding the ComP acceptor polypeptide. In certain embodiments, a host cell comprises a genetic cluster encoding for the proteins required to synthesize an oligo- or polysaccharide. In certain embodiments, a host cell comprises at least two of an isolated nucleic acid encoding a PglS OTase, an isolated nucleic acid encoding the ComP acceptor polypeptide, and genetic cluster encoding for the proteins required to synthesize an oligo- or polysaccharide. In embodiments aspects, a host cell comprises a nucleic acid encoding a PglS OTase of one organism and a nucleic acid encoding the ComP acceptor polypeptide from a different organism.
  • an isolated nucleic acid encoding the ComP protein, ComP glycosylation tag fragment, and/or ComP fusion protein described anywhere herein.
  • an isolated nucleic acid referred to herein is a vector or is contained within a vector.
  • an isolated nucleic acid referred to herein is inserted and/or has been incorporated into a heterologous genome or a heterologous region of a genome.
  • a pneumococcal bioconjugate vaccine containing a conventional vaccine carrier.
  • Certain embodiments comprise the use of a ComP fragment as a glycosylation tag (aka“glycotag”).
  • the glycosylation tag can be added to the C- terminus and/or N-terminus of a carrier protein.
  • the glycosylation tag is added to the C-terminus of the conventional carrier protein Pseudomonas aeruginosa Exotoxin A (EPA).
  • the glycosylation tag/carrier fusion protein can be paired with the CPS8 polysaccharide and use of PglS, generating a carrier protein-CPS8 bioconjugate, a first of its kind pneumococcal bioconjugate vaccine.
  • an EPA fusion can be paired with the CPS8 polysaccharide and use of PglS, generating an EPA-CPS8 bioconjugate.
  • the EPA-CPS8 bioconjugate vaccine elicited high IgG titers specific to serotype 8 specific that were protective as determined via bactericidal killing.
  • vaccination with as little as 100 ng of polysaccharide in the EPA-CPS8 bioconjugate was able to provide protection.
  • certain embodiments provide for a CPS8 pneumococcal bioconjugate vaccine.
  • a conjugate vaccine (such as the EPA vaccine construct) can comprise additional/multiple sites of glycosylation to increase the glycan to protein ratio as well as expand upon the number of serotypes in order to develop a comprehensive pneumococcal bioconjugate vaccine.
  • a bioconjugate or glycosylated fusion protein disclosed herein is a conjugate vaccine that can be administered to a subject for the prevention and/or treatment of an infection and/or disease.
  • the conjugate vaccine is a prophylaxis that can be used, e.g., to immunize a subject against an infection and/or disease.
  • the bioconjugate is associated with (such as in a therapeutic composition) and/or administered with an adjuvant.
  • Certain embodiments provide for a composition (such as a therapeutic composition) comprising a conjugate vaccine described herein and an adjuvant. In certain embodiments, when the conjugate vaccine is administered to a subject, it induces an immune response.
  • the immune response elicits long term memory (memory B and T cells).
  • the immune is an antibody response.
  • the antibody response is a serotype-specific antibody response.
  • the antibody response is an IgG or IgM response.
  • the conjugate vaccine generates immunological memory in a subject administered the vaccine.
  • a method comprises isolating a bioconjugate or fusion protein disclosed herein (conjugate vaccine) and combining the conjugate vaccine with an adjuvant.
  • the infection is a localized or systemic infection of skin, soft tissue, blood, or an organ, or is auto-immune in nature.
  • the vaccine is a conjugate vaccine against pneumococcal infection.
  • the disease is pneumonia.
  • the infection is a systemic infection and/or an infection of the blood.
  • the subject is a mammal. For example, in certain embodiments, a pig or a human.
  • the aspects disclosed herein are not limited to pneumococcal polysaccharides, but in fact, have vast applicability for generating bioconjugate vaccines for many important human and animal pathogens that are incompatible with PglB and PglL. Notable examples include the human pathogens Klebsiella pneumoniae and Group B Streptococcus as well as the swine pathogen S. suis, all exceptionally relevant pathogens with no licensed vaccines available.
  • the pathogen is a bacterial pathogen.
  • the host is immunized against the pathogen.
  • the method comprises administering to a subject in need of the immune response an effective amount of a ComP conjugate vaccine, glycosylated fusion protein, or any other therapeutic/immunogenic composition disclosed herein.
  • Certain embodiments provide a conjugate vaccine, glycosylated fusion protein, or other therapeutic/immunogenic composition disclosed herein for use in inducing a host immune response against a bacterial pathogen and immunization against the bacterial pathogen.
  • immune responses include but are not limited to an innate response, an adaptive response, a humoral response, an antibody response, cell mediated response, a B cell response, a T cell response, cytokine upregulation or downregulation, immune system cross-talk, and a combination of two or more of said immune responses.
  • the immune response is an antibody response.
  • the immune response is an innate response, a humoral response, an antibody response, a T cell response, or a combination of two or more of said immune responses.
  • Also provided herein are methods of preventing or treating a bacterial disease and/or infection in a subject comprising administering to a subject in need thereof a conjugate vaccine, a fusion protein, or a composition disclosed herein.
  • the infection is a localized or systemic infection of skin, soft tissue, blood, or an organ, or is auto-immune in nature.
  • the disease is pneumonia.
  • the infection is a systemic infection and/or an infection of the blood.
  • the subject is a vertebrate.
  • the subject is a mammal such as a dog, cat, cow, horse, pig, mouse, rat, rabbit, sheep, goat, guinea pig, monkey, ape, etc. And, for example, in certain embodiments the mammal is a human.
  • the composition is administered via intramuscular injection, intradermal injection, intraperitoneal injection, subcutaneous injection, intravenous injection, oral administration, mucosal administration, intranasal administration, or pulmonary administration.
  • Example 1 Determination that cysteine residues flanking the site of glycosylation in ComP contribute to ComP stability and glycosylation.
  • ComP protein from Acinetobacter baylyi ADP1 (ComPADPi) and A. soli strain 110264 (ComPno264) are glycosylated at a homologous serine residue located at position 84 or 82, respectively, by the //-linking OTase PglS (Harding CM, et al. (2019) A platform for gly coengineering a polyvalent pneumococcal bioconjugate vaccine using E. coli as a host. Nat Commun 10(1):891).
  • a series of point mutants was first generated replacing cysteine 75 with either alanine or glycine as these mutants would block the formation of a disulfide bond that may be formed between cysteines 75 and 95.
  • the point mutants were then introduced into E. coli SDB1 co expressing the C. jejuni heptasaccharide biosynthetic gene cluster and PglS ADPi .
  • mutation of cysteine 75 significantly reduced the expression of the ComP protein mutants compared to wildtype (WT) ComP.
  • WT wildtype
  • the C75A and C75G mutants displayed very low levels of protein expression and it appeared to exist only as a low molecular weight unglycosylated form.
  • Example 2 A short PglS-dependent O-linking recognition motif is determined via a reductive cloning strategy.
  • ComPA28no 264 a translational fusion containing ComPno264 lacking the first 28 amino acids (herein referred to as ComPA28no 264 ) fused at the C-terminus of a genetically inactivated variant of the exotoxin A protein from Pseudomonas aeruginosa (EPA) was efficiently glycosylated by PglS with multiple pneumococcal and K. pneumoniae capsular polysaccharides (Harding CM, et al. (2019) A platform for gly coengineering a polyvalent pneumococcal bioconjugate vaccine using E. coli as a host. Nat Commun 10(1): 891 ; Feldman MF, et al.
  • each fragment irrespective of size, was shifted by one amino acid towards the stop codon of ComPno264.
  • the first construct contained a 25 amino acid fragment of ComPno264 spanning residues 67 to 91
  • the second construct contained a 25 amino acid fragment of ComPno264 spanning residues 68 to 92
  • the third construct contained a 25 amino acid fragment of ComPno264 spanning residues 69 to 93 and so on. All fragments contained serine 82, the site of PglS glycosylation.
  • EPA fusion constructs were then introduced into E. coli SDB1 co-expressing PglS ADPi and the pneumococcal CPS8.
  • G5 SEQ ID NO: 64
  • C8 SEQ ID NO: 80
  • Dl l SEQ ID NO: 102
  • BIO 93 50KATVSENIMNAGGTSMPSSGNCTGVTQIASGASAATTNVASAQCS94 + CIO 94 siATVSENIMNAGGTSMPSSGNCTGVTQIASGASAATTNVASAQCSDgs + DIO 95 52TVSENIMNAGGTSMPSSGNCTGVTQIASGASAATTNVASAQCSDS 96 + FI 0 96 54SENIMNAGGTSMPSSGNCTGVTQIASGASAATTNVASAQCSDSDG98 +
  • 0-1 inking glycosylation recognition motifs can be glycosylated by PglS ADPi when translationally fused N-terminally, in tandem at the N- or C-terminus, or simultaneously at the bl and C-terminus.
  • D5 (SEQ ID NO: 61) fragment of ComPno 264 was selected for follow up experiments whereby the D5 (SEQ ID NO: 61) fragment or a derivative thereof (D5’) was translationally fused to N-terminus and C-terminus in different combinations as outlined in Figure 12A and Figure 12B.
  • the EPA fusion containing the ComP ⁇ 28i 10 04 fragment was included as this protein has previously been established to be glycosylated by PglS Ap with the CPS8.
  • EPA fusion constructs were then introduced into E. coli SDB1 co-expressing the pneumococcal CPS8 in the presence of absence of PglS ADPi .
  • all EPA-ComP110264 fusion constructs were glycosylated with the pneumococcal CPS8 indicating that ComPl 10264 0-1 inking glycosylation recognition motifs can be translationally fused in multiple combinations at the N-terminus or C-terminus and still be glycosylated by PglSADPi.
  • Example 3 A tandem, C-terminally fused double ComPA28uo 264 glycosylation tag is glycosylated by PglS ⁇ DP i .
  • EPA fusion constructs were built containing a tandem, C-terminally fused double ComP ⁇ 28 1 10 04 glycosylation tag.
  • the ComP ⁇ 28 1 10 04 glycosylation tags were separated by either a glycine-glycine-glycine-glycine-serine (GGGS) linker (SEQ ID NO: 23) or by a proline-alanine-proline-alanine-proline (PAPAP) linker (SEQ ID NO: 25). Both constructs contained a hexahistidine tag to aid downstream purification.
  • GGGS glycine-glycine-glycine-glycine-serine
  • PAPAP proline-alanine-proline-alanine-proline
  • the EPA fusion containing the ComP ⁇ 28i 1021,4 fragment was included as this protein has previously been established to be glycosylated by PglS Ap with the CPS8.
  • the double tag EPA fusion constructs were then introduced into E. coli SDB1 co-expressing the pneumococcal CPS8 in the presence of absence of PglSADPi.
  • EPA variant 7 and EPA variant 8 were both glycosylated the pneumococcal CPS8 when PglSADPi was present.
  • the glycosylation appeared as very high molecular weight with immunoreactivity approaching the 250 kDa marker.
  • Vella, M. & Pace, D. Gly coconjugate vaccines an update. Expert Opin Biol Ther 15, 529-546, doi: 10.1517/14712598.2015.993375 (2015).
  • Ciocchini, A. E. et al. A bacterial engineered glycoprotein as a novel antigen for diagnosis of bovine brucellosis. Vet Microbiol 172, 455-465, doi: 10.1016/j.vetmic.2014.04.014 (2014).
  • Neisseria gonorrhoeae Proc Natl Acad Sci U S A 106, 4447-4452, doi: 10.1073/pnas.0809504106 (2009).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Molecular Biology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Microbiology (AREA)
  • Virology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
PCT/US2019/059893 2018-12-21 2019-11-05 O-linked glycosylation recognition motifs Ceased WO2020131236A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
ES19898969T ES3055827T3 (en) 2018-12-21 2019-11-05 O-linked glycosylation recognition motifs
EP19898969.1A EP3897685B1 (en) 2018-12-21 2019-11-05 O-linked glycosylation recognition motifs
AU2019404924A AU2019404924B2 (en) 2018-12-21 2019-11-05 O-linked glycosylation recognition motifs
US17/416,106 US12350342B2 (en) 2018-12-21 2019-11-05 O-linked glycosylation recognition motifs
CA3124312A CA3124312A1 (en) 2018-12-21 2019-11-05 O-linked glycosylation recognition motifs
JP2021536212A JP7699543B2 (ja) 2018-12-21 2019-11-05 O結合型グリコシル化認識モチーフ
JP2024214739A JP2025032259A (ja) 2018-12-21 2024-12-09 O結合型グリコシル化認識モチーフ

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862783971P 2018-12-21 2018-12-21
US62/783,971 2018-12-21

Publications (1)

Publication Number Publication Date
WO2020131236A1 true WO2020131236A1 (en) 2020-06-25

Family

ID=71101542

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/059893 Ceased WO2020131236A1 (en) 2018-12-21 2019-11-05 O-linked glycosylation recognition motifs

Country Status (7)

Country Link
US (1) US12350342B2 (cg-RX-API-DMAC7.html)
EP (1) EP3897685B1 (cg-RX-API-DMAC7.html)
JP (2) JP7699543B2 (cg-RX-API-DMAC7.html)
AU (1) AU2019404924B2 (cg-RX-API-DMAC7.html)
CA (1) CA3124312A1 (cg-RX-API-DMAC7.html)
ES (1) ES3055827T3 (cg-RX-API-DMAC7.html)
WO (1) WO2020131236A1 (cg-RX-API-DMAC7.html)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022147142A1 (en) * 2020-12-31 2022-07-07 Vaxnewmo Llc Klebsiella pneumoniae o-antigen glycosylated proteins and methods of making and uses thereof
WO2022232256A1 (en) * 2021-04-28 2022-11-03 Vaxnewmo Llc Minimal sequons sufficient for o-linking glycosylation
US11497804B2 (en) 2015-02-26 2022-11-15 Vaxnewmo Llc Acinetobacter O-oligosaccharyltransferases and uses thereof
US11932670B2 (en) 2018-06-16 2024-03-19 Vaxnewmo Llc Glycosylated ComP pilin variants, methods of making and uses thereof
US12350342B2 (en) 2018-12-21 2025-07-08 Vaxnewmo Llc O-linked glycosylation recognition motifs

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115120712B (zh) * 2022-06-30 2025-11-18 中国人民解放军军事科学院军事医学研究院 肺炎链球菌糖蛋白生物结合疫苗及其制备方法和应用
WO2024077205A2 (en) * 2022-10-07 2024-04-11 Vaxnewmo Llc Moraxellaceae o-linking oligosaccharyltransferases, glycosylation fragments, and uses thereof

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5892019A (en) 1987-07-15 1999-04-06 The United States Of America, As Represented By The Department Of Health And Human Services Production of a single-gene-encoded immunoglobulin
WO2011109600A1 (en) * 2010-03-05 2011-09-09 Alnylam Pharmaceuticals, Inc. Compositions and methods for modifying the glycosylation pattern of a polypeptide
WO2013067523A1 (en) 2011-11-04 2013-05-10 Cornell University A prokaryote-based cell-free system for the synthesis of glycoproteins
WO2016107819A1 (en) * 2014-12-30 2016-07-07 Glycovaxyn Ag Compositions and methods for protein glycosylation
US9499614B2 (en) * 2013-03-14 2016-11-22 Abbvie Inc. Methods for modulating protein glycosylation profiles of recombinant protein therapeutics using monosaccharides and oligosaccharides
US20180050101A1 (en) * 2015-02-26 2018-02-22 Vaxnewmo Llc Acinetobacter o-oligosaccharyltransferases and uses thereof
WO2019241672A2 (en) * 2018-06-16 2019-12-19 Vaxnewmo Llc Glycosylated comp pilin variants, methods of making and uses thereof

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2671709C (en) 2006-12-13 2016-08-16 The Governors Of The University Of Alberta Methods and systems for o-glycosylating proteins
CA2844831A1 (en) 2011-08-12 2013-02-21 The Governors Of The University Of Alberta Method of diagnosing bacterial infections using bacterial glycoproteins
ES2905107T3 (es) 2012-10-12 2022-04-07 Glaxosmithkline Biologicals Sa Procedimientos de modificación de células hospedadoras
EP3508579B1 (en) 2012-11-07 2021-06-30 GlaxoSmithKline Biologicals SA Production of recombinant vaccine in e. coli by enzymatic conjugation
JP6356229B2 (ja) 2013-06-04 2018-07-11 アイコン ジェネティクス ゲーエムベーハー 植物産生糖タンパク質及び組換え糖タンパク質のn−グリコシル化部位占有率を調節する方法
US9988426B2 (en) 2014-09-18 2018-06-05 University Of Maryland, Baltimore Broad spectrum conjugate vaccine to prevent Klebsiella pneumoniae and Pseudomonas aeruginosa infections
WO2018135860A1 (ko) * 2017-01-17 2018-07-26 포항공과대학교 산학협력단 식물 세포에서의 목적 단백질 발현을 위한 재조합 벡터
EP3492481A1 (en) 2017-11-30 2019-06-05 Vaxxilon AG Vaccine against klebsiella pneumoniae
CN113227125A (zh) 2018-12-12 2021-08-06 葛兰素史密丝克莱恩生物有限公司 用于o-连接的糖基化的修饰的载体蛋白
US12350342B2 (en) 2018-12-21 2025-07-08 Vaxnewmo Llc O-linked glycosylation recognition motifs

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5892019A (en) 1987-07-15 1999-04-06 The United States Of America, As Represented By The Department Of Health And Human Services Production of a single-gene-encoded immunoglobulin
WO2011109600A1 (en) * 2010-03-05 2011-09-09 Alnylam Pharmaceuticals, Inc. Compositions and methods for modifying the glycosylation pattern of a polypeptide
WO2013067523A1 (en) 2011-11-04 2013-05-10 Cornell University A prokaryote-based cell-free system for the synthesis of glycoproteins
US9499614B2 (en) * 2013-03-14 2016-11-22 Abbvie Inc. Methods for modulating protein glycosylation profiles of recombinant protein therapeutics using monosaccharides and oligosaccharides
WO2016107819A1 (en) * 2014-12-30 2016-07-07 Glycovaxyn Ag Compositions and methods for protein glycosylation
US20180050101A1 (en) * 2015-02-26 2018-02-22 Vaxnewmo Llc Acinetobacter o-oligosaccharyltransferases and uses thereof
WO2019241672A2 (en) * 2018-06-16 2019-12-19 Vaxnewmo Llc Glycosylated comp pilin variants, methods of making and uses thereof

Non-Patent Citations (65)

* Cited by examiner, † Cited by third party
Title
"Financial Report", 2017, PFIZER INC.
"Pneumococcal conjugate vaccine for childhood immunization--WHO position paper", WKLY EPIDEMIOL REC, vol. 82, 2007, pages 93 - 104
"Structure of a protective epitope of group B Streptococcus type III capsular polysaccharide.", PROC NATL ACAD SCI USA, vol. 114, no. 19, 2017, pages 5017 - 5022
"UniProtKB/Swiss-Prot", Database accession no. Q6F7F9.1
ARAKAWA, Y. ET AL., INFECT IMMUN, vol. 59, 1991, pages 2043 - 2050
AVCI, F. Y.LI, X.TSUJI, M.KASPER, D. L.: "A mechanism for glycoconjugate vaccine activation of the adaptive immune system and its implications for vaccine design", NAT MED, vol. 17, 2011, pages 1602 - 1609, XP037115828, DOI: 10.1038/nm.2535
AVCI, F.Y.LI, X.TSUJI, M.KASPER, D.L., NATMED, vol. 17, 2011, pages 1602 - 1609
BERTI FADAMO R: "Antimicrobial glycoconjugate vaccines: an overview of classic and modern approaches for protein modification", CHEM SOC REV, vol. 47, no. 24, 2018, pages 9015 - 9025, XP055702534, DOI: 10.1039/C8CS00495A
CASTRIC, P., MICROBIOLOGY, vol. 141, 1995, pages 1247 - 1254
COMER, J.E.MARSHALL, M.A.BLANCH, V.J.DEAL, C.D.CASTRIC, P., INFECT IMMUN, vol. 70, 2002, pages 2837 - 2845
COMSTOCK LEKASPER DL: "Bacterial glycans: key mediators of diverse host immune responses", CELL, vol. 126, no. 5, 2006, pages 847 - 850
DE GREGORIO ERAPPUOLI R: "From empiricism to rational design: a personal perspective of the evolution of vaccine development", NAT REV IMMUNOL, vol. 14, no. 7, 2014, pages 505 - 514, XP038002294, DOI: 10.1038/nri3694
DYKXHOORN, D.M.ST PIERRE, R.LINN, T., GENE, vol. 177, 1996, pages 133 - 136
FARIDMOAYER, A.FENTABIL, M.A.MILLS, D.C.KLASSEN, J.S.FELDMAN, M.F., J BACTERIOL, vol. 189, 2007, pages 8088 - 8098
FELDMAN MF ET AL.: "A promising bioconjugate vaccine against hypervirulent Klebsiella pneumoniae", PROC NATL ACAD SCI USA, 2019
FELDMAN, M.F. ET AL., PROC NATL ACAD SCI USA, vol. 102, 2005, pages 3016 - 3021
FRASCH, C. E.: "Preparation of bacterial polysaccharide-protein conjugates: analytical and manufacturing challenges", VACCINE, vol. 27, no. 46, 2009, pages 6468 - 6470, XP026704485, DOI: 10.1016/j.vaccine.2009.06.013
FRASCH, C.E., VACCINE, vol. 27, 2009, pages 6468 - 6470
GENO KA ET AL.: "Pneumococcal Capsules and Their Types: Past, Present, and Future", CLIN MICROBIOL REV, vol. 28, no. 3, 2015, pages 871 - 899, XP055781906, DOI: 10.1128/CMR.00024-15
GENO, K. A. ET AL., CLIN MICROBIOL REV, vol. 28, 2015, pages 871 - 899
GILTNER, C.L.NGUYEN, Y.BURROWS, L.L., MICROBIOL MOL BIOL REV, vol. 76, 2012, pages 740 - 772
HARDING CM ET AL.: "A platform for glycoengineering a polyvalent pneumococcal bioconjugate vaccine using E. coli as a host", NAT COMMUN, vol. 10, no. 1, 2019, pages 891, XP055667871, DOI: 10.1038/s41467-019-08869-9
HARDING CM ET AL.: "Acinetobacter strains carry two functional oligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O-glycosylation of multiple proteins", MOL MICROBIOL, vol. 96, no. 5, 2015, pages 1023 - 1041, XP009506444, DOI: 10.1111/mmi.12986
HARDING, C. M. ET AL., MOL MICROBIOL, vol. 96, 2015, pages 1023 - 1041
HARDING, C.M., MOLMICROBIOL, vol. 96, 2015, pages 1023 - 1041
HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS
HUTTNER, A. ET AL., LANCET INFECT DIS, vol. 17, 2017, pages 528 - 537
IHSSEN, J. ET AL., OPEN BIOL, vol. 5, 2015, pages 140227
IWASHKIW JA ET AL.: "Identification of a general O-linked protein glycosylation system in Acinetobacter baumannii and its role in virulence and biofilm formation", PLOS PATHOG, vol. 8, no. 6, 2012, pages 1002758, XP009506443, DOI: 10.1371/journal.ppat.1002758
IWASHKIW JA ET AL.: "Pour some sugar on it: the expanding world of bacterial protein O-linked glycosylation", MOL MICROBIOL, vol. 89, no. 1, 2013, pages 14 - 28, XP055414724, DOI: 10.1111/mmi.12265
KOVACH, M.E. ET AL., GENE, vol. 166, 1995, pages 175 - 176
KOWARIK, M. ET AL., EMBO J25, 2006, pages 1957 - 1966
LERY, L. M. ET AL., BMC BIOL, vol. 12, 2014, pages 41
MABRYSNAVELY, IDRUGS, vol. 13, 2010, pages 543 - 9
NOTHAFT HSZYMANSKI CM: "Protein glycosylation in bacteria: sweeter than ever", NAT REV MICROBIOL, vol. 8, no. 11, 2010, pages 765 - 778
O'BRIEN, K. L. ET AL.: "Burden of disease caused by Streptococcus pneumoniae in children younger than 5 years: global estimates", LANCET, vol. 374, 2009, pages 893 - 902, XP026587008, DOI: 10.1016/S0140-6736(09)61204-6
PACE, D.: "Glycoconjugate vaccines", EXPERT OPIN BIOL THER, vol. 13, 2013, pages 11 - 33, XP055278509, DOI: 10.1517/14712598.2012.725718
PACKAGE INSERT - PREVNAR 13 - FDA, Retrieved from the Internet <URL:https://www.fda.gov/downloads/BiologicsBloodVaccines/Vaccines/ApprovedProducts/UCM201669.pdf>
PAN YJ ET AL.: "Genetic analysis of capsular polysaccharide synthesis gene clusters in 79 capsular types of Klebsiella spp", SCI REP, vol. 5, 2015, pages 15573
PAN, C. ET AL., MBIO, vol. 7, 2016
PAN, Y.J. ET AL., SCI REP, vol. 5, 2015, pages 15573
PELICIC, V., MOL MICROBIOL, vol. 68, 2008, pages 827 - 837
POLLARD, A. J.PERRETT, K. P.BEVERLEY, P. C.: "Maintaining protection against invasive bacteria with protein-polysaccharide conjugate vaccines", NAT REV IMMUNOL, vol. 9, 2009, pages 213 - 220, XP037134935, DOI: 10.1038/nri2494
PORSTENDORFER, D.DROTSCHMANN, U.AVERHOFF, B., APPL ENVIRON MICROBIOL, vol. 63, 1997, pages 4150 - 4157
POWER, P.M. ET AL., MOL MICROBIOL, vol. 49, 2003, pages 833 - 847
PREVENTION, C. F. D. C. A. VACCINES FOR CHILDREN PROGRAM (VFC, 2018, Retrieved from the Internet <URL:https://www.cdc.gov/vaccines/programs/vfc/awardees/vaccine-management/price-list/index.html>
PREVENTION, C. F. D. C., PNEUMOCOCCAL VACCINATION, Retrieved from the Internet <URL:https://www.cdc.gov/vaccines/vpd/pneumo/index.html>
RAPPUOLI RDE GREGORIO ECOSTANTINO P: "On the mechanisms of conjugate vaccines", PROC NATL ACAD SCI U S A, vol. 116, no. 1, 2019, pages 14 - 16
RAVENSCROFT, N. ET AL., GLYCOBIOLOGY, vol. 26, 2016, pages 51 - 62
SCHAFFER CMESSNER P: "Emerging facets of prokaryotic glycosylation", FEMS MICROBIALREV, vol. 41, no. 1, 2017, pages 49 - 91
SCHULZ BL ET AL.: "Identification of bacterial protein O-oligosaccharyltransferases and their glycoprotein substrates", PLOS ONE, vol. 8, no. 5, 2013, pages 62768, XP055307413, DOI: 10.1371/journal.pone.0062768
SCHULZ, B.L. ET AL., PLOS ONE, vol. 8, 2013, pages 62768
SCHWARZ, F. ET AL., NAT CHEM BIOL, vol. 6, 2010, pages 264 - 266
SCOTT, N.E. ET AL., MOL CELL PROTEOMICS, vol. 13, 2014, pages 2354 - 2370
See also references of EP3897685A4
STIMSON, E. ET AL., MOL MICROBIOL, vol. 17, 1995, pages 1201 - 1214
STROHLEINHEISS, FUTURE ONCOL., vol. 6, 2010, pages 1387 - 94
SZYMANSKI CM ET AL.: "Evidence for a system of general protein glycosylation in Campylobacter jejuni", MOL MICROBIOL, vol. 32, no. 5, 1999, pages 1022 - 1030, XP002225922, DOI: 10.1046/j.1365-2958.1999.01415.x
VELLA, M.PACE, D.: "Glycoconjugate vaccines: an update", EXPERT OPIN BIOL THER, vol. 15, 2015, pages 529 - 546, XP008175777, DOI: 10.1517/14712598.2015.993375
VIK, A. ET AL., PROC NATL ACAD SCI USA, vol. 106, 2009, pages 4447 - 4452
WACKER M ET AL.: "N-linked glycosylation in Campylobacter jejuni and its functional transfer into E. coli.", SCIENCE, vol. 298, no. 5599, 2002, pages 1790 - 1793, XP002225920, DOI: 10.1126/science.298.5599.1790
WACKER, M. ET AL., PROC NATL ACAD SCI USA, vol. 103, 2006, pages 7088 - 7093
WACKER, M. ET AL., SCIENCE, vol. 298, 2002, pages 1790 - 1793
WU, K.M. ET AL., J BACTERIAL, vol. 191, 2009, pages 4492 - 4501
YEH, K.M. ET AL., J CLIN MICROBIOL, vol. 45, 2007, pages 466 - 471

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11497804B2 (en) 2015-02-26 2022-11-15 Vaxnewmo Llc Acinetobacter O-oligosaccharyltransferases and uses thereof
US11932670B2 (en) 2018-06-16 2024-03-19 Vaxnewmo Llc Glycosylated ComP pilin variants, methods of making and uses thereof
US12577280B2 (en) 2018-06-16 2026-03-17 Vaxnewmo Llc Glycosylated comp pilin variants, methods of making and uses thereof
US12350342B2 (en) 2018-12-21 2025-07-08 Vaxnewmo Llc O-linked glycosylation recognition motifs
WO2022147142A1 (en) * 2020-12-31 2022-07-07 Vaxnewmo Llc Klebsiella pneumoniae o-antigen glycosylated proteins and methods of making and uses thereof
EP4271417A4 (en) * 2020-12-31 2024-11-27 Vaxnewmo Llc GLYCOSYLATED KLEBSIELLA PNEUMONIAE O-ANTIGEN AND METHODS OF PREPARATION AND USES THEREOF
WO2022232256A1 (en) * 2021-04-28 2022-11-03 Vaxnewmo Llc Minimal sequons sufficient for o-linking glycosylation

Also Published As

Publication number Publication date
JP2025032259A (ja) 2025-03-11
JP2022514704A (ja) 2022-02-14
EP3897685B1 (en) 2025-10-08
AU2019404924A1 (en) 2021-07-08
EP3897685A1 (en) 2021-10-27
JP7699543B2 (ja) 2025-06-27
US12350342B2 (en) 2025-07-08
ES3055827T3 (en) 2026-02-16
CA3124312A1 (en) 2020-06-25
EP3897685A4 (en) 2022-07-27
US20220088211A1 (en) 2022-03-24
AU2019404924B2 (en) 2025-09-18

Similar Documents

Publication Publication Date Title
US12350342B2 (en) O-linked glycosylation recognition motifs
US12577280B2 (en) Glycosylated comp pilin variants, methods of making and uses thereof
JP7551618B2 (ja) O-結合型グリコシル化のための修飾キャリアタンパク質
JP2023531242A (ja) 改変Exotoxin Aタンパク質
US20240066109A1 (en) Klebsiella Pneumoniae O-Antigen Glycosylated Proteins and Methods of Making and Uses Thereof
US20240207383A1 (en) Minimal Sequons Sufficient for O-Linking Glycosylation
EP4598942A2 (en) Moraxellaceae o-linking oligosaccharyltransferases, glycosylation fragments, and uses thereof
CN120897997A (zh) 用于生产具有与第二多肽配偶体的异肽键的糖缀合物多肽的组合物和方法以及这些糖缀合物多肽的用途
Mayer et al. A platform for glycoengineering a polyvalent pneumococcal bioconjugate vaccine using E. coli as a host

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19898969

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3124312

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021536212

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019404924

Country of ref document: AU

Date of ref document: 20191105

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019898969

Country of ref document: EP

Effective date: 20210721

WWG Wipo information: grant in national office

Ref document number: 17416106

Country of ref document: US

WWG Wipo information: grant in national office

Ref document number: 2019898969

Country of ref document: EP