WO2020123980A1 - Il-15 compositions and methods of use thereof - Google Patents

Il-15 compositions and methods of use thereof Download PDF

Info

Publication number
WO2020123980A1
WO2020123980A1 PCT/US2019/066287 US2019066287W WO2020123980A1 WO 2020123980 A1 WO2020123980 A1 WO 2020123980A1 US 2019066287 W US2019066287 W US 2019066287W WO 2020123980 A1 WO2020123980 A1 WO 2020123980A1
Authority
WO
WIPO (PCT)
Prior art keywords
activatable proprotein
polypeptide
proprotein
activatable
variant
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/066287
Other languages
English (en)
French (fr)
Inventor
Zijuan Li
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Proviva Therapeutics Hong Kong Ltd
Original Assignee
Proviva Therapeutics Hong Kong Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Proviva Therapeutics Hong Kong Ltd filed Critical Proviva Therapeutics Hong Kong Ltd
Priority to CA3121813A priority Critical patent/CA3121813A1/en
Priority to JP2021534270A priority patent/JP7557465B2/ja
Priority to CN201980082406.XA priority patent/CN114746105A/zh
Priority to US17/413,786 priority patent/US20230045048A1/en
Priority to KR1020217018990A priority patent/KR102911817B1/ko
Priority to AU2019395266A priority patent/AU2019395266A1/en
Priority to EP19897286.1A priority patent/EP3893917A4/en
Publication of WO2020123980A1 publication Critical patent/WO2020123980A1/en
Anticipated expiration legal-status Critical
Priority to JP2024159011A priority patent/JP2024175026A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5443IL-15
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7155Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site

Definitions

  • IL-15 is a pleiotropic cytokine that has been demonstrated to induce and regulate a myriad of immune functions.
  • IL-15 is critical for lymphoid development and peripheral maintenance of innate immune cells and immunological memory of T cells, specifically natural killer (NK) and CD8+ T cell populations.
  • NK natural killer
  • IL-15 does not promote the maintenance of CD4+ CD25+ FOXP3+ regulatory T cells (Tregs)
  • IL-2 has been demonstrated to induce their development and IL-15 has been shown to protect effector T cells from iL-2--mediated activation-induced cell death (AICD).
  • AICD iL-2--mediated activation-induced cell death
  • IL-15 is a four-a-helix protein belonging to a family of cytokines consisting of interleukins IL-2, IL-4, IL-7, IL-9, and IL-21.
  • IL-15 signals through a receptor complex composed of the IL-2/IL-15 receptor b (IL- 1511b) (CD122) subunit, which is shared with IL-2 and the common gamma chain (yC) (CD 132) receptor subunit, which is also utilized by all of the additional family members. While it does not have a crucial direct role in IL-15 signaling per se, IL-15Ra is a critical component of the IL-15 cytokine-receptor complex.
  • IL-15Ra is a transmembrane protein with very high affinity for IL-15 that facilitates IL-15 trafficking from the endoplasmic reticulum (ER) through the cytoplasm and presentation of IL-15/IL-15Ra complexes on the cell surface. In addition to remaining associated throughout cytoplasmic and cell surface expression, IL-15/IL-15Ra can also be cleaved as a complex into the extracellular space.
  • IL-15/IL-15Ra complexes can stimulate neighboring or opposing cells in trans through IL-15R.p/yC.
  • This type of cytokine stimulation requires cell-cell contact and is referred to as transpresentation.
  • trans-presentation is believed to be the primary mode of action for IL-15- mediated development and homeostasis of CD8 T cells, NK cells, NKT cells and intraepithelial lymphocytes.
  • Trans-presentation offers a tighter regulation than that of a secreted cytokine by providing cell-directed delivery of IL-15 to specific cell types.
  • soluble (s) IL-15/IL-15Ra complexes are also cleaved from the cell surface in response to a variety of inflammatory signals, such as TLR ligation, type I Interferons, and CD40 ligation.
  • This production of sIL-15 complexes is generally transient in nature and may provide a short-lived, but strong burst of IL-15 activity to support early immune responses.
  • IL-15Ra binding of IL-15 is not only a platform for IL-15 delivery but also increases the half-life of IL-15 and may also increase the affinity of IL-15 for IL- 15Rp/yC.
  • sIL-15 complexes have been found to be superior in their ability to stimulate IL-15 responses compared to unassociated rIL-15. This garnered a lot of interest in IL-15 and sparked the generation of multiple formulations of sIL-15 complexes that are now being examined for therapeutic efficacy.
  • IL-15 has been shown to exhibit a short half-life and high doses were required to achieve biological responses in vivo, thereby- resulting in clinical toxicities and limited anti -tumor responses in patients.
  • IL-15 and IL-15 derivatives To increase the therapeutic effectiveness and facilitate the use of IL-15 in the immunotherapy of cancer and chronic infection, several companies are currently developing IL-15 and IL-15 derivatives,
  • the present invention solves all of the problems mentioned above by providing an activatable proprotein comprising interleukin 15 (IL-15) that is activated within a cancer tissue or tumor.
  • IL-15 interleukin 15
  • This platform has the potential to address the drawbacks of IL-15 and its derivatives currently being developed for cancer immunotherapy.
  • the invention relates to an activatable proprotein comprising a first polypeptide and a second polypeptide, wherein the first and second polypeptide each comprise a masking moiety operably linked via a first linker on the C-terminus to an IL-15 or variant thereof, wherein the IL-15 or variant thereof is linked via a second linker on the C- terminus to an IL-15Ra or variant thereof, and wherein the masking moiety masks the active portion of the proprotein.
  • the invention relates to an activatable proprotein comprising a first polypeptide and a second polypeptide, wherein the first and second polypeptide each comprise an IL-15 or variant thereof operably linked via a first linker on the C-terminus to an IL-15Ra or variant thereof, wherein the IL-15Ra or variant thereof is linked via a second linker on the C-terminus to a masking moiety present on each of the first and second polypeptides, and wherein the masking moiety masks the active portion of the proprotein.
  • first linker on the first or second polypeptide, or on both the first and the second polypeptide is a cleavable linker.
  • second linker on the first or second polypeptide, or on both the first and the second polypeptide is a cleavable linker.
  • the IL-15 or variant thereof and the IL-15Ra or variant thereof in the first polypeptide and the IL-15 or variant thereof and the IL-15Ra or variant thereof in the second polypeptide comprise one or more Cys substitution mutations.
  • the IL-15 or variant thereof in the first polypeptide comprising one or more Cys substitution mutations forms a disulfide bond with the IL-15Ra or variant thereof comprising one or more Cys substitution mutations in the second polypeptide.
  • the IL-15 or variant thereof in the second polypeptide comprising one or more Cys substitution mutations forms a disulfide bond with the IL-15Ra or variant thereof comprising one or more Cys substitution mutations in the first polypeptide.
  • the proprotein is a dimeric proprotein.
  • the dimeric proprotein comprises a first polypeptide and a second polypeptide each comprising from N-terminus to C-terminus the masking moiety linked via the first linker to the IL-15 or variant thereof, wherein the IL-15 or variant thereof is linked via the second linker to the IL-15Ra or variant thereof, and wherein the masking moiety of the first polypeptide forms covalent disulfide bond or non-covalent bond is fused to the masking moiety of the second polypeptide.
  • the dimeric proprotein comprises a first polypeptide and a second polypeptide each comprising from N-terminus to C-terminus the masking moiety linked via the first linker to the IL-15 or variant thereof, wherein the IL- 15 or variant thereof is linked via the second linker to the IL-15Ra or variant thereof, and wherein the masking moiety of the first polypeptide forms one or more disulfide bonds or non-covalent bonds with the masking moiety of the second polypeptide.
  • the dimeric proprotein comprises significantly reduced biological activity in comparison to native IL-15.
  • the dimeric protein is activatable through protease cleavage to restore the activity of the IL-15 or variant thereof present in the dimeric proprotein.
  • a recombinant nucleic acid molecule encoding an activatable proprotein disclosed herein is provided.
  • a vector comprising the recombinant nucleic acid molecule encoding an activatable proprotein.
  • a pharmaceutical composition comprising the activatable proprotein disclosed herein, and a pharmaceutically acceptable carrier.
  • the invention relates to a method comprising the step of administering the activatable proprotein or the pharmaceutical composition comprising the activatable proprotein disclosed herein to a subject having a cancer to treat the cancer in the subject, wherein following administration, the activatable proprotein is activated through protease cleavage in a cancerous tissue.
  • the activatable proprotein is activated following or after protease cleavage in a cancerous tissue.
  • the invention relates to a method comprising the step of administering the activatable proprotein or the pharmaceutical composition comprising the activatable proprotein disclosed herein to a subject in need thereof, to elicit or enhance an anti -tumor immune response in the subject, wherein following administration, the activatable proprotein is activated through protease cleavage in the tumor.
  • the activatable proprotein is activated following or after protease cleavage in the tumor.
  • the invention relates to a use of the activatable proprotein or the pharmaceutical composition comprising the activatable proprotein disclosed herein for treating a cancer in a subject, comprising the step of administering the activatable proprotein or pharmaceutical composition comprising the same, and wherein following administration, the activatable proprotein is activated through protease cleavage in a cancerous tissue.
  • the invention relates to a use of the activatable proprotein or the pharmaceutical composition comprising the activatable proprotein disclosed herein for eliciting or enhancing an anti -tumor immune response in a subject, comprising the step of administering the activatable proprotein or pharmaceutical composition, and wherein following administration, the activatable proprotein is activated through protease cleavage in a tumor.
  • the protease cleavage partially or completely removes the masking moiety in the activatable proprotein such that the IL-15/IL-IL-15Ra complex in the first and the second polypeptide can bind IL-15Rp/yC present on the surface of a lymphocyte of blood cell in vitro or in vivo.
  • FIG 1A shows the protein topology of human interleukin 15 (IL-15) and human interleukin 15 receptor alpha chain (IL-15Ra)
  • Figure IB shows human_IL-15_LSP: Amino acid sequences of IL-15 with long signal peptide (1-162); human_IL-15_mature: Amino acid sequences of IL-15 without signal peptide (49-162); human_IL-15Ra_FL: full length sequence of IL-15Ra with signal peptide underlined (1-267); human_IL-15Ra-ECD: extracellular domain sequence of IL-15Ra (31- 205); human_IL-15Ra-sushi+: extracellular sushi domain sequence plus the first 13 amino acids from the linker region (31-98) ; human_IL-15Ra-sushi: extracellular sushi domain sequence (31-85).
  • Figure 1C shows quaternary structure of IL-15 in complex with its receptors IL-15Ra (CD215), IL-15RP (CD122) and the common gamma chain (CD132) (PDB:4GS7) with schematic drawing of cell membrane and transmembrane and signaling domains of the receptors.
  • Figure ID illustrates a schematic diagram of IL-15 and cell surface IL-15 receptor complex.
  • Figure 2A illustrates the IL-15 complex with its receptor IL-15Ra-sushi(PDB:2Z3Q) with an artificial flexible peptide linker between the C-terminus of IL-15 and N-terminus of IL-15Ra-sushi (to form an ILR)).
  • the interaction site on IL-15 in ILR with its signaling IL- 15Rp/yc receptors is indicated at IL- 5Rp/yc Interaction interface.
  • Figure 2B illustrates a homodimeric association of ILR fusion proteins described in Figure 2A.
  • the interaction sites on IL-15 in the homodimeric ILR with its signaling IL- 15Rp/yc receptors is indicated at IL- 15Rp/yc Interaction interface.
  • ILR fusion protein favors homodimer formation.
  • FIG. 2C illustrates a schematic diagram of ILR structure described in Figure 2A.
  • IL-15 in the ILR is able to bind to and signal through IL- 15Rp/yc receptors.
  • Figure 2D illustrates a schematic diagram of a dimeric ILR structure described in Figure 2B.
  • IL-15 in the dimeric ILR is able to bind to and signal through IL-15Rp/yc receptors.
  • Figure 3 A illustrates a fusion of the C-terminus of an ILR (described in Figure 2B) to the N-terminus of a fusion moiety. Similar to the structure described in Figure 2B, this fusion also favors a dimer formation.
  • the interaction sites on IL-15 in the homodimeric ILR with its signaling IL-15Rp/yc receptors is indicated at IL-15Rp/yc Interaction interface.
  • Figure 3B illustrates a schematic diagram of a dimeric fusion structure described in Figure 3A.
  • IL-15 in the dimeric ILR is able to bind to and signal through IL-15Rp/yc receptors.
  • IL-15 in this dimeric fusion is able to bind to and signal through IL-15Rp/yc receptors.
  • Figure 3C illustrates a diagram of the protein sequence motifs and configurations for proteins described in Figure 3 A and 3B.
  • Figure 3D illustrates a fusion of the N-terminus of an ILR (described in Figure 2B) to the C-terminus of a fusion moiety (a masking moiety). Similar to the structure described in Figure 2B, this fusion also favors a dimer formation.
  • the interaction sites on IL-15 in the homodimeric ILR with its signaling IL-15R.p/yc receptors is indicated at IL-15R.p/yc Interaction interface.
  • Figure 3E illustrates a schematic diagram of a dimeric fusion structure described in Figure 3D.
  • IL-15 in the dimeric ILR is able to bind to and signal through IL- 15R.p/yc receptors.
  • IL-15 in this dimeric fusion is not able to bind to and signal through IL- 15R.p/yc receptors because of the steric hindrance resulted from the masking moiety and the linkers between the ILR and the masking moiety.
  • Figure 3F illustrates a diagram of the protein sequence motifs and configurations for proteins described in Figure 3D and 3E.
  • Figure 3G illustrates a schematic diagram of a dimeric fusion structure with a protein domain at the C-terminal of IL-15Ra on the first polypeptide.
  • Figure 3H illustrates a diagram of the protein sequence motifs and configurations for proteins described in Figure 3G.
  • Figure 31 illustrates a schematic diagram of a dimeric fusion structure with a protein domain at the C-terminal of IL-15Ra on the second polypeptide.
  • Figure 3J illustrates a diagram of the protein sequence motifs and configurations for proteins described in Figure 31.
  • Figure 3K illustrates a schematic diagram of a dimeric fusion structure with a protein domain at the C-terminal of IL-15Ra on the first and second polypeptides.
  • Figure 3L illustrates a diagram of the protein sequence motifs and configurations for proteins described in Figure 3K.
  • Figure 4A illustrates a diagram of the protein sequence motifs and configurations similar but not limited to what was described in Figure 3F. Any one of more of the protein sequence motifs in the first polypeptide diagram can be different from the corresponding motifs in the second polypeptide as indicated by the double headed arrows.
  • the linker sequence indicated in the diagram can be a flexible and protease cleavable or a flexible and protease non-cleavable or combination of them.
  • Figure 4B illustrates examples of masking motifs in the first and second polypeptides.
  • the masking motif in the first polypeptide can be the same or different than the masking motif in the second polypeptide.
  • the masking motif from the first polypeptide can either form non-covalent interaction or covalent interaction or both covalent and non-covalent interaction with the masking motif in the second polypeptide.
  • Figures 4C-4D illustrate examples of Fab-CH2CH3 (4C) and Fab-Cys-CH2CH3(4D) as masking moieties in polypeptide fusion with ILR.
  • Figures 4E-4F illustrate examples of CH2CH3 (4E) and Cys-CH2CH3(4F) as masking moieties in polypeptide fusion with ILR.
  • Figures 4G-4H show examples of CH3 (4G) and Cys-CH3(4H) as masking moieties in polypeptide fusion with ILR.
  • Figures 4I-4J show examples of VH-CH1 and VL-CL (41) and VH-CHl-Cys and VL- CL-Cys(4J) as masking moieties in polypeptide fusion with ILR
  • Figures 4K-4L show examples of heterodimeric CH2CH3 (4K) and heterodimeric
  • Figures 4M-4N show examples of Leucine zipper (Coiled coil) (4M) and Cys-leucine zipper (Coiled coil) (4N) as masking moieties in polypeptide fusion with ILR
  • Figure 40 shows examples of Cys containing flexible peptide (40) as masking moieties in polypeptide fusion with ILR.
  • Figure 5 shows schematic diagram of dimeric Cys-CH2-CH3-ILR. Lack of IL15 signaling activity through IL15Rp/yc receptors suggests that inter-chain association of IL15 and IL15R is more favorable than the intra-chain association of IL15 and IL15R resulting in the masking of the IL15Rp/yc interaction site on IL15.
  • Figure 6 shows a schematic diagram of activation of dimeric Cys-CH2-CH3-ILR through protease cleavage of the substrate linker sequences in the fusion polypeptide.
  • Example of protease substrate sequence for linker 1 and linker 3 is shown. Digestion of one of the protease substrate sequences (partial digestion) in the linkers releases the steric hindrance imposed by the masking moiety, therefore allow the IL-15 in the fusion to bind to and signal through IL15Rp/yc receptors. Digestion of the both cleavable linkers releases the ILR from the Fc fusion resulting in full activity of the ILR towards the IL l 5R.p/yc receptors.
  • Figure 7 shows a schematic diagram of activation of dimeric Cys-CH2-CH3-ILR through protease cleavage of the substrate linker sequences in the fusion polypeptide.
  • Example of protease substrate sequence for linker 2 and linker 4 is shown. Digestion of one of the two protease substrate sequences in the linkers does not effectively release the steric hindrance imposed by the masking moiety. Therefore full digestion of both protease linkers is necessary to activate the fusion polypeptide signaling through ILl 5Rp/yc receptors.
  • Figure 8 shows a sequence identifier for exemplary fusion proteins.
  • Figures 9A-9F show representative SDS-PAGE results of purified proteins.“M” on the figures represents a protein standard marker.
  • FIGS 10A-10G illustrate representative HPLC analysis results of purified proteins.
  • FIGS 11A-11B illustrate representative fluorescence assisted cell sorting (FACS) gating and dot plot of pSTAT5 cell signaling activity of IL-15 fusion protein PI 185.
  • FACS fluorescence assisted cell sorting
  • Figures 11C-11D illustrate cell signaling activity of IL-15 fusion proteins, as measured by pSTAT5 FACS assay.
  • Figures 12A-12C illustrate representative FACS gating of IL-15 stimulated sample in cell signaling assay using human whole blood.
  • Figures 12D-12F illustrate cell signaling activity of IL-15 fusion proteins using human whole blood, as measured by pSTAT5 FACS assay.
  • Figures 13A-13H illustrate activity of IL15 fusion proteins on M-07e proliferation determined by a colorimetric assay (Cell Counting Kit-8 (CCK-8)).
  • Figure 14A illustrates representative gating of lymphocytes on side scatter (SSC) and forward scatter (FSC) for IL-15 stimulated samples.
  • Figures 14B-14F illustrate human PBMC proliferation assay results for IL-15 fusion proteins.
  • Figures 15A-15I illustrate protease (TEV) cleavage of IL-15 fusion proteins.“M” on the figures represents a protein standard maker.
  • FIGS 16A-16G illustrate cleavage of IL-15 fusion proteins with uPA, matriptase, legumain, MMP-2 and MMP-9.
  • M represents the protein standard marker
  • B represents the sample before protease cleavage
  • uPA represents for uPA protease
  • Mat represents matriptase protease
  • L represents legumain protease
  • M-2 represents MMP-2 protease
  • M-9 represents MMP-9 protease.
  • Red-arrowed band uncleaved protein
  • pink-arrowed band Fc/Fc-L15R
  • yellow arrowed band Fc dimer
  • green arrowed band L15R.
  • Figures 17A-17B illustrate cell signaling activity of ILl 5 fusion proteins, as measured by a pSTAT5 FACS assay.
  • Figures 18A-18I show activity of IL15 fusion proteins on M-07e proliferation determined by a colorimetric assay (Cell Counting Kit-8 (CCK-8)).
  • Figures 19A-19D show human PBMC proliferation assay results of IL-15 fusion protein P1256 with and without TEV protease cleavage. PI 185 was used as positive control.
  • P1256 digested represents for P1256 protein digested by TEV protease at TEV to protein ratio of 1 to 2 at 37°C for overnight.
  • P1256+TEV 1-2 represents for P1256 mixed with TEV at TEV to protein ratio of 1 to 2 for proliferation assay. Cell culture medium was used in TEV digestion reactions.
  • FIGS 20A-20F show protease (TEV) cleavage of IL-15 fusion proteins.
  • M represents a protein standard marker; B represents the protein sample prior to TEV cleavage; A represents the protein sample after TEV cleavage.
  • Figure 21 shows cell signaling activity of IL15 fusion proteins, as measured by a pSTAT5 FACS assay.
  • Figures 22A-22F show the activity of IL15 fusion proteins on M-07e proliferation, as determined by a colorimetric assay (Cell Counting Kit-8 (CCK-8)).
  • Figures 23A-23F show reduced SDS-PAGE results of purified proteins.“M” on the figures represents the protein standard marker.
  • Figures 24A-24F show non-reduced SDS-PAGE results of purified proteins.“M” on the figures represents the protein standard marker.
  • FIGS 25A-25X illustrate representative HPLC analysis results of purified proteins.
  • Figures 26A-26P show SDS-PAGE results of cleavage of IL-15 fusion proteins.“M” on the figures represents the protein standard marker.“B” represents for protein before protease cleavage.“B-4” represents for protein before cleavage and store at 4 degree.“B-37” represents for protein before cleavage and store at 37 degree.“uPA” represents for uPA protease.“Mat” represents for matriptase protease.“L” represents for legumain protease.“M- 2” represents for MMP-2 protease.“M-9” represents for MMP-9 protease.“K5” represents for KLK-5 protease.“K7” represents for KLK-7 protease.
  • Figures 27A-27N and Figures 28A-28W show activity of IL-15 fusion proteins on M- 07e proliferation determined by a colorimetric assay (Cell Counting Kit-8 (CCK-8)).
  • Figures 29A-29F illustrate representative results of in vitro serum stability. Western blot was probed by biotinylated anti-IL-15 antibody and subsequently with streptavidin-HRP.
  • Figure 29A in vitro stability of P1482 in human serum.
  • Figure 29B in vitro stability of P1482 in mouse serum.
  • Figure 29C in vitro protein stability in human serum at the time point of 164h.
  • Figure 29D in vitro protein stability in mouse serum at the time point of 96h.
  • Figure 29E in vitro protein stability in rat serum at the time point of 96h.
  • Figure 29F in vitro protein stability in cyno serum at the time point of 96h.
  • Figures 30A-30B show SDS-PAGE results of purified proteins.
  • Figure 30A shows reduced SDS-PAGE results and 30B shows non-reduced SDS-PAGE results.“M” on the figures represents the protein standard marker.
  • FIGS 31A-31F illustrate representative HPLC analysis results of purified proteins.
  • Figure 32 shows SDS-PAGE results of cleavage of IL-15 fusion proteins.“M” on the figures represents the protein standard marker.“B” represents for protein before protease cleavage.“uPA” represents for uPA protease.“Mat” represents for matriptase protease.“L” represents for legumain protease.“M-2” represents for MMP-2 protease.“K5” represents for KLK-5 protease.“K7” represents for KLK-7 protease.
  • Figures 33A-33J show activity of IL-15 fusion proteins on M-07e proliferation determined by a colorimetric assay (Cell Counting Kit-8 (CCK-8)).
  • Figures 34A-34B illustrates representative results of in vitro serum stability. Western blot was probed using HRP-anti-human IgG antibody.
  • Figure 34A in vitro stability of P18121450 in mouse serum.
  • Figure 34B in vitro stability of P18121450 in rat serum.
  • the current invention provides activatable proproteins comprising a masking moiety and an active portion, which is also interchangeably referred to herein as an“active domain”, wherein the active domain comprises a complex of IL-15/IL-15Ra.
  • the invention further provides compositions comprising the same and methods of administering or using the same for preventing or treating a tumor or cancer.
  • the term“active,” as used herein, refers to a portion, domain or fragment having a biological activity or biological function.
  • the term“active domain” or “active portion” are used interchangeably herein within the context of an activatable protein disclosed herein.
  • the activity is equal to or approximates the activity of the wild-type protein.
  • an active domain of an activatable proprotein comprising an IL-15/IL-15Ra complex as described herein, is expected to have equal activity or approximates the activity of the wild-type IL-15/IL-15Ra complex whether in soluble form or when bound to a cell surface.
  • subject includes, but is not limited to, a mammal, including, e.g., a human, non-human primate (e.g., monkey), mouse, pig, cow, goat, rabbit, rat, guinea pig, hamster, horse, monkey, sheep, or other non-human mammal, a non-mammal, including, e.g., a non-mammalian vertebrate, such as a bird (e.g., a chicken or duck) or a fish; and a non-mammalian invertebrate.
  • the methods and compositions of the invention are used to treat (both prophylactically and/or therapeutically) non-human animals.
  • composition means a composition suitable for pharmaceutical use in a subject, including an animal or human.
  • a pharmaceutical composition generally comprises an effective amount of an active agent (e.g., the activatable proprotein provided herein) and a pharmaceutically acceptable carrier (e.g., a buffer, adjuvant, or the like).
  • an active agent e.g., the activatable proprotein provided herein
  • a pharmaceutically acceptable carrier e.g., a buffer, adjuvant, or the like.
  • the term“effective amount” means a dosage or amount sufficient to produce a desired result.
  • the desired result may comprise an objective or subjective improvement in the recipient of the dosage or amount (e.g., long-term survival, decrease in number and/or size of tumors, effective prevention of a disease state, etc.).
  • A“prophylactic treatment” is a treatment administered to a subject who does not display signs or symptoms of a disease, pathology, or medical disorder, or displays only early signs or symptoms of a disease, pathology, or disorder, such that treatment is administered for the purpose of diminishing, preventing, or decreasing the risk of developing the disease, pathology, or medical disorder.
  • a prophylactic treatment functions as a preventative treatment against a disease or disorder.
  • A“prophylactic activity” is an activity of an agent, such as the activatable proprotein disclosed herein, or composition thereof, that, when administered to a subject who does not display signs or symptoms of a pathology, disease or disorder (or who displays only early signs or symptoms of a pathology, disease, or disorder) diminishes, prevents, or decreases the risk of the subject developing the pathology, disease, or disorder.
  • A“prophylactically useful” agent or compound refers to an agent or compound that is useful in diminishing, preventing, treating, or decreasing development of a pathology, disease or disorder.
  • A“therapeutic treatment” is a treatment administered to a subject who displays symptoms or signs of pathology, disease, or disorder, in which treatment is administered to the subject for the purpose of diminishing or eliminating those signs or symptoms of pathology, disease, or disorder.
  • A“therapeutic activity” is an activity of an agent, such an activatable proprotein provided herein, or a composition thereof, that eliminates or diminishes signs or symptoms of a pathology, disease or disorder, when administered to a subject suffering from such signs or symptoms.
  • a “therapeutically useful” agent or compound indicates that an agent or compound is useful in diminishing, treating, or eliminating such signs or symptoms of the pathology, disease or disorder.
  • treating means reversing, alleviating, or reducing the reoccurrence of, either partially or completely, the growth of tumors, tumor metastases, or other cancer-causing or neoplastic cells in a patient.
  • treatment refers to the act of treating a disease, such as a cancer or tumor.
  • preventing means inhibiting the progress of, delaying the onset of, or reducing the occurrence of, either partially or completely, the growth of tumors, tumor metastases, or other cancer-causing or neoplastic cells in a patient.
  • preventing refers to the act of preventing a disease, such as a cancer or tumor.
  • nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence.
  • sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence).
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • the molecules are identical at that position.
  • substantially identical in the context of two nucleic acids or polypeptides, refers to two or more sequences or subsequences that have at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% identity, or at least 99% identity (e.g., as determined using one of the methods set forth infra).
  • the term "binds,” “specifically binds to,” or is “specific for” refers to measurable and reproducible interactions such as binding between a target and an antibody, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules including biological molecules.
  • an antibody that specifically binds to a target (which can be an epitope) is an antibody that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets.
  • the extent of binding of an antibody to an unrelated target is less than about 10% of the binding of the antibody to the target as measured, for example, by a radioimmunoassay (RIA).
  • an antibody that specifically binds to a target has a dissociation constant (Kd) of ⁇ 1 mM, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, or ⁇ 0.1 nM.
  • activatable proprotein refers to an activatable proprotein comprising at least a masking moiety and an active domain, or derivatives/ variants therefrom, as described herein.
  • the proprotein may also comprise one or more protein domains.
  • polypeptide refers, in one embodiment, to a polymer of amino acids and its equivalent and does not refer to a specific length of a product; thus,“peptides” and“proteins” are included within the definition of a polypeptide. Also included within the definition of polypeptides are“masking moieties” as defined herein.
  • A“polypeptide region” refers to a segment of a polypeptide, which segment may contain, for example, one or more domains or motifs (e.g., a polypeptide region of an antibody can contain, for example, one or more constant domains).
  • fragment refers to a portion of a polypeptide preferably having at least 10 contiguous amino acids of the polypeptide. In another embodiment, the term refers to a portion of a polypeptide having least 20, 30, 40, 50, 60, or 70 contiguous amino acids of the polypeptide.
  • a“derivative” is a polypeptide or fragment thereof having one or more non-conservative or conservative amino acid substitutions relative to another polypeptide (also referred to as a“variant”); or a polypeptide or fragment thereof that is modified by covalent attachment of another molecule such as, e.g., by attachment of a heterologous polypeptide, or by glycosylation, acetylation, phosphorylation, and the like.
  • polypeptides containing one or more analogs of an amino acid e.g., unnatural amino acids and the like
  • polypeptides with unsubstituted linkages as well as other modifications known in the art, both naturally and non-naturally occurring.
  • An“isolated” polypeptide is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the polypeptide, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
  • An isolated polypeptide includes an isolated antibody, or a fragment or derivative thereof.
  • antibody refers to a protein comprising one or more polypeptides substantially or partially encoded by immunoglobulin genes or fragments of immunoglobulin genes.
  • the recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as myriad immunoglobulin variable region genes.
  • Light chains are classified as either kappa or lambda.
  • Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
  • a typical immunoglobulin (e.g., antibody) structural unit comprises a tetramer.
  • Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one“light” (about 25 kD) and one“heavy” chain (about 50 -70 kD).
  • the N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
  • the terms variable light chain (VL) and variable heavy chain (VH) refer to these light and heavy chains, respectively.
  • Antibodies exist as intact immunoglobulins or as a number of well- characterized fragments produced by digestion with various peptidases.
  • pepsin digests an antibody below the disulfide linkages in the hinge region to produce F(ab')2, a dimer of Fab which itself is a light chain joined to VH-CH1 by a disulfide bond.
  • the F(ab')2 may be reduced under mild conditions to break the disulfide linkage in the hinge region thereby converting the F(ab')2dimer into an Fab' monomer.
  • the Fab' monomer is essentially an Fab with part of the hinge region (see, Fundamental Immunology, W. E. Paul, ed., Raven Press, New York (1999), for a more detailed description of other antibody fragments).
  • antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such Fab' fragments, etc. may be synthesized de novo either chemically or by utilizing recombinant DNA methodology.
  • the term antibody as used herein also includes antibody fragments either produced by the modification of whole antibodies or synthesized de novo using recombinant DNA methodologies.
  • Antibodies include single chain antibodies, including single chain Fv (sFv or scFv) antibodies in which a variable heavy and a variable light chain are joined together (directly or through a peptide linker) to form a continuous polypeptide.
  • the terms“antibody portion” and“antibody domain” are used interchangeably herein and refer to a portion/domain of an antibody used to create a masking moiety described herein.
  • an activatable proprotein provided herein comprises a masking moiety linked to an active domain.
  • the activatable proprotein is a dimer.
  • the active domain comprises a dimer complex of IL-15/IL-15Ra.
  • the terms“complex of IL-15/IL-15Ra”, and“IL- 15/IL-15Ra complex” are used interchangeably herein and refer to a monomer that joins to another monomer complex of IL-15/IL-15Ra via one or more linkers and/or one or more disulfide bonds and/or one or more non-covalent bonds, to form a dimer that makes up the active domain of an activatable proprotein described herein.
  • an activatable proprotein provided herein comprises a first polypeptide and a second polypeptide, wherein the first and second polypeptide each comprise a masking moiety operably linked via a first linker on the C-terminus to an IL-15 or variant thereof, wherein the IL-15 or variant thereof is linked via a second linker on the C- terminus to an IL-15Ra or variant thereof, and wherein the masking moiety masks the active portion of the proprotein.
  • such an activatable proprotein comprises the format of Fc-IL-15-linker-IL-15Ra (Fc-ILR), where “Fc” corresponds to the masking domain.
  • a homodimer of an activatable proprotein comprises an amino acid sequence set forth in SEQ ID NO: 26.
  • PALVHQRP APP S (SEQ ID NO: 26).
  • an activatable proprotein disclosed herein comprises SEQ ID NO: 26. In another embodiment, an activatable proprotein disclosed herein consists of SEQ ID NO: 26. In another embodiment, an activatable proprotein disclosed herein comprises a variant or homolog of SEQ ID NO: 26.
  • a cleavable linker comprising a protease cleavage site.
  • An exemplary cleavable linker comprises a protease (TEV) cleavage site, which is demonstrated in bold and italics in SEQ ID NO: 26 above and is represented by SEQ ID NO: 344; the italicized and underlined sequences in SEQ ID NO: 26 above represent linker sequences surrounding the TEV cleavage site.
  • TEV protease
  • the sequence of the proprotein, without a protease cleavage site comprises PI 187 (SEQ ID NO: 18), PI 188 (SEQ ID NO: 19), P1250 (SEQ ID NO: 20), P1251 (SEQ ID NO: 21), and P1252 (SEQ ID NO: 22), PI 254 (SEQ ID NO: 24), PI 255 (SEQ ID NO: 25), PI 279 (SEQ ID NO: 41) and PI 280 (SEQ ID NO: 42), see Example 1 and sequences that follow herein.
  • the activatable proprotein is a dimeric proprotein, where, in another embodiment, the dimeric proprotein comprises a first and second polypeptide each comprising an IL-15 or variant thereof operably linked via a first linker on the C-terminus to an IL-15Ra or variant thereof, wherein the IL-15Ra or variant thereof is linked via a second linker on the C-terminus to a masking moiety present on each of the first and second polypeptides, and wherein the masking moiety masks the active portion of the proprotein, and wherein the masking moiety of the first polypeptide forms one or more covalent disulfide bonds or one or more non-covalent bonds to the masking moiety of the second polypeptide.
  • such an activatable proprotein comprises the format of IL-15 -linker-IL-15Ra-Fc (ILR-Fc), where“Fc” corresponds to the masking domain.
  • the Fc-ILR form of the activatable proprotein comprises one or more protein domains attached to the C-terminal of IL-15Ra on the first polypeptide, the second polypeptide, or both the first and second polypeptides of the activatable proprotein (see for e.g. Fig. 3G- Fig. 3L).
  • an activatable proprotein provided herein is designed to be activated preferentially inside tumor or cancer tissue (not in normal tissues).
  • an activatable proprotein comprising a first polypeptide and a second polypeptide, wherein the first and second polypeptide each comprise an IL-15 or variant thereof operably linked via a first linker on the C-terminus to an IL-15Ra or variant thereof, wherein the IL-15Ra or variant thereof is linked via a second linker on the C-terminus to a masking moiety present on each of the first and second polypeptides, and wherein the masking moiety masks the active portion of the proprotein.
  • such an activatable proprotein comprises SEQ ID NO: 17 or SEQ ID NO: 73 (see also Figure 3B herein).
  • an activatable proprotein disclosed herein is a dimeric proprotein.
  • an activatable proprotein disclosed herein is a dimeric fusion protein.
  • the dimeric proprotein comprises a first polypeptide and a second polypeptide each comprising from N-terminus to C-terminus the IL-15 or variant thereof linked via the first linker on the C-terminus to the IL-15Ra or variant thereof, wherein the IL-15Ra or variant thereof is linked via the second linker on the C-terminus to the masking moiety, and wherein the masking moiety of the first polypeptide forms one or more covalent disulfide bonds or non-covalent bonds with the masking moiety of the second polypeptide.
  • an activatable proprotein is a heterodimeric protein comprising heterodimeric masking moieties. In another embodiment, an activatable proprotein is a heterodimeric protein comprising heterodimeric active domain moieties. In another embodiment, an activatable proprotein provided herein is a heterodimeric protein comprising heterodimeric masking moieties and active domain moieties (see Figures herein).
  • the active domain of the activatable proprotein comprises a IL-15/IL-15Ra complex or variant thereof.
  • IL-15 on the IL- 15/IL-15Ra complex binds IL-15Rp/yC on a cell surface of a lymphocyte of blood cell to activate a series of downstream pathways that lead to increased cellular growth, decreased apoptosis, enhanced immune cell activation and migration.
  • IL-2/15R.p and yC subunits to stimulate Janus kinase (Jak)l, Jak3, and signal transducer and activator of transcription (STAT)-5 pathway. After phosphorylation, STAT5 homo- dimerizes, translocates to the nucleus, and promotes the transcription of target genes. Additionally, IL-15 stimulates both the PI3K-AKT and RAS-MAPK pathways. Altogether, IL-15 signaling stimulates an array of downstream pathways leading to responses that have a crucial role in the development, function, and survival of CD8 T cells, NK cells, NKT cells and intestinal intraepithelial lymphocytes.
  • the IL-15 or variant thereof is a human IL-15 or an amino acid mutant derived therefrom.
  • the IL-15Ra or variant thereof comprises a human IL-15Ra, a truncated human IL-15Ra or an amino acid mutant derived from human IL-15Ra.
  • a IL-15/IL-15Ra complex or variant thereof disclosed herein as part of the activatable proprotein comprises a human IL-15 or an amino acid mutant derived therefrom, and a human IL-15Ra, a truncated human IL-15Ra or an amino acid mutant derived from human IL-15Ra.
  • the precursor amino acid sequence of human IL-15 comprises or consists of SEQ ID NO: 1, (See examples below; underlined sequence corresponds to the signal sequence or signal peptide).
  • the underlined sequence in SEQ ID NO: 1 corresponds to the signal sequence or signal peptide.
  • the mature amino acid sequence of human IL-15 with a point mutation of S162A comprises or consists of SEQ ID NO: 3.
  • a human IL-15 amino acid sequence comprises a variant or homolog of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3.
  • the full-length amino acid sequence of IL-15Ra comprises or consists of SEQ ID NO: 4 (See Examples below; underlined sequence corresponds to the signal sequence or signal peptide).
  • the IL-15Ra extracellular domain (ECD) comprises or consists of SEQ ID NO: 5.
  • the IL-15Ra sushi+ domain comprises or consists of SEQ ID NO: 6.
  • the IL-15Ra, sushi domain comprises or consists of SEQ ID NO: 7.
  • the IL-15 or variant thereof and the IL-15Ra or variant thereof in the first polypeptide and the IL-15 or variant thereof and the IL-15Ra or variant thereof in the second polypeptide comprise one or more Cys substitution mutations. Having these mutations facilitates binding of the IL-15/IL-15 Ra complex on the first polypeptide with the IL-15/IL-15 Ra complex on the second polypeptide through disulfide bonds.
  • the IL-15 or variant thereof in the first polypeptide comprising one or more Cys substitution mutations forms a disulfide bond with the IL-15Ra or variant thereof comprising one or more Cys substitution mutations in the second polypeptide.
  • the IL-15 or variant thereof in the second polypeptide comprising one or more Cys substitution mutations forms a disulfide bond with the IL-15Ra or variant thereof comprising one or more Cys substitution mutations in the first polypeptide.
  • the first linker on the first or second polypeptide of an activatable proprotein disclosed herein, or on both the first and the second polypeptide of the same is a cleavable linker.
  • the second linker on the first or second polypeptide of an activatable proprotein disclosed herein, or on both the first and the second polypeptide of the same is a cleavable linker.
  • linker refers to a molecule (including but not limited to unmodified or modified nucleic acids or amino acids) or group of molecules (for example, 2 or more, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more) connecting two compounds, such as two polypeptides.
  • the linker may be comprised of a single linking molecule or may comprise a linking molecule and at least one spacer molecule, intended to separate the linking molecule and a compound by a specific distance.
  • the linkers include cleavable or non-cleavable linkers.
  • a cleavable linker includes a linker have a cleavage site for a protease, for e.g. a TEV protease.
  • a non-cleavable linker include a linker that is removed or degraded intracellularly or not cleaved.
  • the activatable proprotein described herein and pharmaceutical compositions comprising the same can be used to directly target cancer cells so that the activatable proprotein is essentially activated when the a protease cleavable linker is cleaved so as to provide the active payload or when the non-cleavable linker is degraded or removed intracellularly by the targeted cell type.
  • a non-cleavable linker is used to link any of the components of an activatable proprotein described herein.
  • a non-limiting example of a non- cleavable linker comprises or consists of an amino acid sequence of GGSGGSGGSGGSGGS (SEQ ID NO: 345), or a homolog or variant thereof. It is to be understood that any non- cleavable linker known in the art may be used and is not limited to those disclosed herein.
  • a linker used in the activatable proprotein described herein comprises an immunoglobulin (Ig) / antibody hinge region.
  • the hinge region is obtained from an IgGl antibody.
  • Ig "hinge" region refers to a polypeptide comprising an amino acid sequence that shares sequence identity, or similarity, with a portion of a naturally-occurring Ig hinge region sequence, which includes the cysteine residues at which the disulfide bonds link the two heavy chains of the immunoglobulin. Sequence similarity of the hinge region linkers of the present invention with naturally-occurring immunoglobulin hinge region amino acid sequences can range from at least 50% to about 75-80%, and typically greater than about 90%.
  • a derivative or analog is a polypeptide comprising an amino acid sequence that shares sequence identity, or similarity, with the full-length sequence of the wild type (or naturally occurring protein), except that it has one or more amino acid sequence differences attributable to a deletion, insertion and/or substitution.
  • the present invention also encompasses fragments of the hinge region for use as linkers. Such a fragment need only be long enough to allow the proteins attached by the hinge region fragment to attain a biologically active conformation.
  • the heterodimeric masking moiety of the activatable proprotein provided herein is joined to the heterodimeric active domain through fusion using an Ig hinge region.
  • the masking moiety and the active domain are homodimeric.
  • a cleavable linker comprises or consists of a protease- cleavage site, flanked by linker sequences.
  • non-limiting example of a cleavable linker comprises or consists of an amino acid sequence of GSENLYFQGGS (SEQ ID NO: 346), or a homolog or variant thereof. It is to be understood that any cleavable linker known in the art may be used and is not limited to those disclosed herein. Cleavage sites for proteases disclosed herein are known in the art and are contemplated for use with any of the proteases disclosed herein or proteases available in the art.
  • non-cleavable or cleavable linkers are inserted in an activatable proprotein (in the order of C-terminus to N-terminus) between the masking moiety and IL-15 and between IL-15 and IL-15Ra of an activatable proprotein disclosed herein.
  • non-cleavable or cleavable linkers are inserted in an activatable proprotein (in the order of C-terminus to N-terminus) between IL-15 and IL-15Ra and between IL-15Ra and a masking moiety of an activatable proprotein disclosed herein.
  • the cleavable linker(s) within the activatable proprotein comprises a cleavage site for a protease.
  • a first linker and/or a second linker of an activatable proprotein disclosed herein is a cleavable linker that comprises a cleavage site for a protease.
  • the protease is selected from a metalloprotease, a serine protease, a cysteine protease, an aspartic acid protease or any combination thereof.
  • the protease cleavage site is cleavable by a MMP1, MMP2, MMP3, MMP4, MMP5, MMP6, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13, MMP14, TEV, matriptase, uPA, FAP, Legumain, PSA, Kallikrein, Cathepsin A, or a Cathepsin B protease, or any protease available in the art.
  • the protease is any protease known in the art and is not limited to one disclosed herein. [00136]
  • following a complete protease e.g. - TEV protease
  • the activatable proprotein is cleaved into two cleaved products each comprising two chains :
  • SEQ ID NO: 27 comprises the masking moiety following protease cleavage of the activatable proprotein.
  • SEQ ID NO: 28 comprises the active domain of the activatable proprotein following protease cleavage.
  • the masking moiety in the activatable proprotein is partially removed allowing access of the active domain (IL- 15/IL-15Ra complex) to binding by IL- 15R.p/yC (see Figure 6).
  • the partially cleaved activatable proprotein comprises SEQ ID NO: 29, 30 and 31.
  • Chain 1 Fc-GS-ENLYFQG-GS-IL-15-(GGS)5-IL-15Ra
  • PALVHQRPAPPS (SEQ ID NO: 29)
  • Chain 3 GGS-IL-15-(GGS)5-IL-15Ra
  • Linkers suitable for use in compositions described herein are generally ones that provide flexibility of the masking moiety or activatable proprotein to facilitate the inhibition of the binding active portion of the activatable proprotein, namely the IL-15/IL-15 Ra complex.
  • Such linkers are generally referred to as flexible linkers.
  • Suitable linkers can be readily selected and can be of any of a suitable of different lengths, such as from 1 amino acid (e.g., Gly) to 20 amino acids, from 2 amino acids to 15 amino acids, from 3 amino acids to 12 amino acids, including 4 amino acids to 10 amino acids, 5 amino acids to 9 amino acids, 6 amino acids to 8 amino acids, or 7 amino acids to 8 amino acids, and may be 1, 2, 3, 4, 5, 6, or 7 amino acids.
  • the linker is 26 amino acids long.
  • the linker is 5-9, 10-15, 16-20, 21-25, 26-30, 31-35, 36-40, 41-45, or 46-50 amino acids long.
  • Exemplary flexible linkers include glycine polymers (G)n, glycine-serine polymers (including, for example, (GS)n, (GSGGS)n, and (GGGS)n, where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art, see e.g. United States Patent Serial No. 10,059,762 B2, which is incorporated by reference herein in its entirety. Glycine and glycine-serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between components.
  • an activatable proprotein can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure to provide for a desired activatable proprotein structure.
  • protease cleavage of a cleavable linker in a first or second polypeptide partially removes the masking moiety in the activatable proprotein such that the IL-15/IL-15Ra complex in the first or second polypeptide can bind rL-15Rp/yC present on the surface of a lymphocyte or a blood cell in vivo.
  • protease cleavage of a cleavable linker in a first and second polypeptide completely removes the masking moiety in the activatable proprotein such that the IL-15/IL-IL-15Ra complex in the first and the second polypeptide can bind IL-lSRp/yC present on the surface of a lymphocyte or a blood cell in vivo.
  • the linker may comprise a spacer element and a cleavable element so as to make the cleavable element more accessible to the enzyme responsible for cleavage.
  • an activatable proprotein of the invention comprises a masking moiety dimer that masks the active domain.
  • a masking moiety via one or more cleavable linkers
  • specific binding of the active domain to its target is blocked, reduced or inhibited, as compared to the specific binding of the active domain not modified by the addition of a masking moiety.
  • the active domain comprising an IL-15/IL-IL-15Ra complex when modified by the addition of a masking moiety (for example, via one or more cleavable linkers) and is in the presence of the target (IL-15Rp/yC), specific binding of the active domain to its target is blocked, reduced or inhibited, as compared to the specific binding of the active proprotein in the presence of sufficient protease enzyme or protease enzyme activity to partially or completely cleave the masking moiety from the activatable proprotein.
  • protease cleavage of linkers between the masking moiety and the active domain in the activatable proprotein leads to activation (“frees up”) the active domain.
  • the masking moiety is fused to an active domain to form a fusion protein.
  • the fusion protein is recombinantly generated.
  • the fusion protein is chemically generated (i.e.- chemically fused).
  • the masking moiety specific binds to the active domain. In another embodiment, the masking moiety lacks the ability to specifically bind to the active domain. In one embodiment, the masking moiety and the linkers between the ILR and the masking moiety sterically hinder the ability of IL-15 in the active domain to bind to and signal through IL-15R.p/yc.
  • a masking moiety of an activatable proprotein disclosed herein comprises the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11.
  • a masking moiety of an activatable proprotein disclosed herein comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 and SEQ ID NO: 11.
  • the masking moiety can sterically inhibit the binding of the active domain of the activatable proprotein to a target, wherein in another embodiment, the target is IL- 15R.p/yC. In another embodiment, the masking moiety can allosterically inhibit the binding of the activatable proprotein to its target.
  • the active domain when the active domain is modified by coupling to a masking moiety (to form an activatable proprotein as described herein) and in the presence of target, there is no binding or substantially no binding of the active domain to the target, or no more than 0.001%, 0.01%, 0.1%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% binding of the active domain to the target, as compared to the binding of the active domain not modified with a masking moiety or the binding of the active domain not coupled to a masking moiety for at least 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, 96 hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months or greater when measured in vivo or in a Target Displacement in vitro assay available in the art.
  • the masking moiety when the active domain is in a‘masked’ state, even in the presence of a target the masking moiety interferes with or inhibits the binding of the active domain to the target. However, in the unmasked state of the active domain, the masking moiety’s interference with target binding to the active domain is reduced, thereby allowing greater access of the active domain to the target and providing for target binding.
  • the active domain in the activatable proprotein can be unmasked upon cleavage, in the presence of enzyme, where in a preferred embodiment, the enzyme is a disease-specific enzyme, such as a cancer-specific or a tumor-specific protease.
  • the masking moiety is one that when the active domain within the activatable proprotein is uncleaved provides for masking of the active domain from target binding, but does not substantially or significantly interfere or compete for binding of the target to the active domain when the activatable proprotein has been cleaved.
  • the activatable proprotein facilitates the switchable/activatable phenotype, with the masking moiety decreasing binding of target when the activatable proprotein is uncleaved, and with cleavage of the masking moiety by protease providing for increased binding of target by the active domain.
  • the structural properties of the masking moiety will vary according to a variety of factors such as the minimum amino acid sequence required for interference with active domain binding to target, the length of the linker between the masking moiety and the active domain, the presence or absence of a cysteine within or flanking the active domain that is suitable for providing dissociation of a cysteine-cysteine disulfide bond, and the like.
  • the masking moiety in the first polypeptide and/or in the second polypeptide comprises one or more protein domains.
  • the masking moiety in the first polypeptide and/or in the second polypeptide comprises a CH3 variant domain of an antibody constant (Fc) region.
  • the CH3 variant domain of an antibody constant (Fc) region comprises a CHI, CH2, CH3, CH2CH3, or CH1CH2CH3 domain.
  • the masking moiety in the first polypeptide and/or in the second polypeptide comprises a CHI, CH2, CH3, CH2CH3, or CH1CH2CH3 domain of an antibody constant (Fc) region.
  • the masking moiety in the first polypeptide comprises one or more heterodimers of at least two different CH3 variant domains of an antibody constant (Fc) region.
  • the masking moiety in the first polypeptide and/or in the second polypeptide comprises a CH3 variant domain of an antibody constant (Fc) region, wherein the CH3 variant domain comprises one or more mutations.
  • the masking moiety in the first polypeptide and/or in the second polypeptide comprises a fusion of an antigen binding domain with a CH3 variant domain of an antibody constant (Fc) region.
  • the masking moiety in the first polypeptide and/or in the second polypeptide comprises a fusion of an antigen binding domain with a CHI, CH2, CH3, CH2CH3, or CH1CH2CH3 domain of an antibody constant (Fc) region.
  • the masking moiety in the first polypeptide and/or in the second polypeptide does not bind an antigen.
  • the masking moiety in the first polypeptide and/or in the second polypeptide binds to an antigen.
  • the masking moiety in the first polypeptide and/or in the second polypeptide comprises an antigen binding domain.
  • the antigen binding domain is a variable heavy chain domain (VH), a variable domain from a heavy chain antibody (VHH), or an antigen specific peptide.
  • the antigen binding domain comprises an antibody light chain (LC) and an antibody heavy chain (HC).
  • the masking moiety comprises a constant domain of an antibody light chain (CL), wherein the light chain is a lambda or kappa chain.
  • the antibody domain of the fusion protein disclosed herein optionally comprises all or part of an immunoglobin molecule and optionally contains all or part of an immunoglobin constant domain region (Fc region).
  • the antibodies used herein optionally comprise IgG domains.
  • other embodiments comprise alternate immunoglobins such as IgM, IgA, IgD, and IgE.
  • IgGl, IgG2, IgG3, etc. are all possible molecules in the antibody domains of the antibody-immunostimulant fusion proteins used in the invention.
  • different embodiments of the invention comprise various hinge regions (or functional equivalents thereof). Such hinge regions provide flexibility between the different domains of the antibody-immunostimulant fusion proteins.
  • the antibody portion used in the compositions and methods provided herein is from an immunoglobulin class selected from IgGl, IgG2, IgG3, IgG4, IgD, IgA, or IgM.
  • the masking moiety can be selected through a screening procedure that determines the optimal combination of masking moiety with cleavable linker that yields optimal inhibition of an active domain within the context of an activatable proprotein.
  • the masking moiety in the first and/or second polypeptide prevents binding of a complex of IL-15/IL-15Ra in the first and/or second polypeptide to IL- 15 Rp/yC present on the surface of a lymphocyte or a blood cell in vitro or in vivo.
  • the cleavage of the masking moieties in any one of the first and/or second polypeptides in the activatable proprotein leads to partial activation of the activatable proprotein.
  • the masking moiety can interact or not interact with the complex of IL-15/IL-15Ra following partial activation (partial cleavage) of the activatable proprotein.
  • the cleavage of the masking moiety in both the first and second polypeptides in the activatable proprotein leads to complete activation of the activatable proprotein into an active complex of IL-15/IL-15Ra or a variant thereof.
  • a humanized antibody may be used in the compositions and methods provided herein. In another embodiment, a humanized antibody may be used to generate a masking moiety provided herein. In another embodiment, a humanized antibody may be used to generate a masking moiety comprising an antigen binding domain provided herein. In another embodiment, a humanized antibody may be used to generate an antigen binding domain provided herein. In some embodiments, the term "humanized antibody” or “humanized version of an antibody” refers to antibodies in which the framework or "complementarity determining regions" (CDR) have been modified to comprise the CDR of an immunoglobulin of different specificity as compared to that of the parent immunoglobulin.
  • CDR complementarity determining regions
  • the CDRs of the VH and VL are grafted into the framework region of a human antibody to prepare the "humanized antibody.” See e.g. Riechmann, L., et al, Nature 332 (1988) 323-327; and Neuberger, M.S., et al, Nature 314 (1985) 268-270.
  • the heavy and light chain variable framework regions can be derived from the same or different human antibody sequences.
  • the human antibody sequences can be the sequences of naturally occurring human antibodies. Human heavy and light chain variable framework regions are listed e.g.
  • the framework region can be modified by further mutations.
  • humanized antibody as used herein also comprises such antibodies which are modified in the constant region to generate the properties according to the invention, especially in regard to Clq binding and/or FcR binding, e.g. by "class switching" i.e. change or mutation of Fc parts (e.g.
  • human antibody is intended to include antibodies having variable and constant regions derived from human germ line immunoglobulin sequences. Human antibodies are well-known in the state of the art (van Dijk, M.A., and van de Winkel, J.G., Curr. Opin. Chem. Biol. 5 (2001) 368-374). Human antibodies can also be produced in transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire or a selection of human antibodies in the absence of endogenous immunoglobulin production.
  • Human antibodies can also be produced in phage display libraries (Hoogenboom, H.R., and Winter, G., J. Mol. Biol.
  • human antibody as used herein also comprises such antibodies or portions thereof which are modified in the constant region to generate the properties according to the invention.
  • the mAb comprised by the activatable proprotein provided herein comprises at least one or more domains from the Fc region and/or one or more domains from the Variable regions.
  • a recombinant human antibody may be the source of the masking moiety of the disclosed activatable proprotein.
  • the term "recombinant human antibody”, as used herein, is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from a host cell, for example a NS0 or CHO cell or from an animal (e.g. a mouse) that is transgenic for human immunoglobulin genes or antibodies expressed using a recombinant expression vector transfected into a host cell.
  • Such recombinant human antibodies have variable and constant regions in a rearranged form.
  • the recombinant human antibodies according to the invention have been subjected to in vivo somatic hypermutation.
  • the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germ line VH and VL sequences, may not naturally exist within the human antibody germ line repertoire in vivo.
  • a masking moiety comprising an antigen binding domain that binds to an antigen as disclosed herein binds to the antigen with an optimal binding affinity.
  • a masking moiety comprising an antigen binding domain that binds to an antigen as disclosed herein binds to the antigen with a binding affinity within a range of KD 1.0 x 10 8 mol/1 - 1.0 x 10 13 mol/1) at 25°C.
  • the binding affinity is determined with a standard binding assay at 25°C, such as surface plasmon resonance technique (BIAcore®, GE-Healthcare Uppsala, Sweden).
  • a masking moiety comprised by an activatable proprotein disclosed herein comprises a variable region heavy (VH) chain and/or a variable region light (VL) chain.
  • the antibody constant domains present in a masking moiety of an activatable proprotein provided herein is glycosylated.
  • the glycosylation is N-glycosylation. In other embodiments, the glycosylation is O-glycosylation.
  • a vector comprising a recombinant nucleic acid molecule or polynucleotide encoding the activatable proprotein disclosed herein.
  • nucleic acid molecule encoding the activatable proprotein of the invention.
  • one or more native or recombinant nucleic acid molecules are used to arrive at any of the amino acid sequences disclosed in the Sequence Listing, including SEQ ID NO: 1 - SEQ ID NO: 346.
  • the disclosure further provides vectors and nucleic acid constructs which include sequences coding for a proprotein disclosed herein.
  • Suitable nucleic acid constructs include, but are not limited to, constructs which are capable of expression in prokaryotic or eukaryotic cells. Expression constructs are generally selected so as to be compatible with the host cell in which they are to be used.
  • the vector encodes an activatable proprotein (masking moiety, IL-15/IL-15Ra complex and cleavable linkers).
  • non-viral and/or viral constructs vectors may be prepared and used, including plasmids, which provide for replication of a proprotein - encoding DNA and/or expression in a host cell.
  • the choice of vector will depend on the type of cell in which propagation is desired and the purpose of propagation. Certain constructs are useful for amplifying and making large amounts of the desired DNA sequence.
  • Other vectors are suitable for expression in cells in culture. The choice of appropriate vector is well within the skill of the art. Many such vectors are available commercially. Methods for generating constructs can be accomplished using methods well known in the art.
  • a polynucleotide encoding an activatable proprotein disclosed herein or component thereof is operably linked to a regulatory sequence as appropriate to facilitate the desired expression properties.
  • regulatory sequences can include promoters, enhancers, terminators, operators, repressors, and inducers.
  • Expression constructs generally also provide a transcriptional and translational initiation region as may be needed or desired, which may be inducible or constitutive, where the coding region is operably linked under the transcriptional control of the transcriptional initiation region, and a transcriptional and translational termination region. These control regions may be native to the species from which the nucleic acid is obtained, or may be derived from exogenous sources.
  • the masking moiety may be produced via recombinant means along with the additional components of a first polypeptide and a second polypeptide of the activatable proprotein (i.e.- IL-15/IL-15Ra and linkers), where the first and second polypeptide are joined via disulfide bonds and/or non-covalent bonds to form a dimer.
  • a first polypeptide and a second polypeptide of the activatable proprotein i.e.- IL-15/IL-15Ra and linkers
  • Such methods are widely known in the state of the art and comprise protein expression in prokaryotic and eukaryotic cells with subsequent isolation of the activatable proprotein and usually purification to a pharmaceutically acceptable purity.
  • nucleic acids encoding the components of the activatable proprotein are inserted into expression vectors by standard methods. Expression is performed in appropriate prokaryotic or eukaryotic host cells, such as CHO cells, NS0 cells, SP2/0 cells, HEK293 cells, COS cells, yeast, or E. coli cells, and the activatable proprotein is recovered from the cells (from the supernatant or after cells lysis).
  • a nucleic acid sequence is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
  • a nucleic acid presequence or secretory leader is operably linked to a nucleic acid encoding a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
  • a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • “operably linked” means that the nucleic acid sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading frame. However, enhancers are optionally contiguous. Linking can be accomplished, for example, by ligation at convenient restriction sites. If such sites do not exist, synthetic oligonucleotide adaptors, linkers or other methods known in the art can be used. In another embodiment, the“operably linked” also refers to the functional pairing of distinct amino acid sequences, peptides or proteins, as in the pairing of the masking moiety and IL-15 described herein via a linker sequence also described herein.
  • Constructs can also include a selectable marker operative in the host to facilitate, for example, growth of host cells containing the construct of interest.
  • selectable marker genes can provide a phenotypic trait for selection of transformed host cells such as dihydrofolate reductase or neomycin resistance for eukaryotic cell culture.
  • the heavy and light chain constant domains in a masking moiety according to the invention are combined with sequences of promoter, translation initiation, constant region, 3' untranslated region, polyadenylation, and transcription termination to form expression vector constructs.
  • the heavy and light chain expression constructs can be combined into a single vector, co-transfected, serially transfected, or separately transfected into host cells which are then fused to form a single host cell expressing both chains.
  • the heavy and light chains are recombinantly constructed together with the other components of an activatable proprotein disclosed herein.
  • the activatable proprotein utilized in the current invention may be optionally obtained or created by any method known in the art.
  • nucleic acid sequences encoding the appropriate components are optionally cloned and ligated into appropriate vectors (e.g., expression vectors for, e.g., prokaryotic or eukaryotic organisms).
  • nucleic acid sequences encoding the appropriate components are optionally cloned into the same vector in the appropriate orientation and location so that expression from the vector produces an activatable proprotein of the invention.
  • Some optional embodiments also require post-expression modification, e.g., assembly of antibody subunits, etc.
  • an activatable proprotein provided herein is administered to a patient in therapeutically effective amount which is the amount of the subject compound or combination that will elicit the biological or medical response of a tissue, system, animal or human that is being sought by a researcher, veterinarian, medical doctor or other clinician.
  • the present invention provides a composition, e.g. a pharmaceutical composition comprising the activatable proprotein of the invention.
  • a pharmaceutical composition comprising the activatable proprotein, and a pharmaceutically acceptable carrier.
  • pharmaceutical compositions comprising the activatable proprotein disclosed herein formulated together with a pharmaceutical carrier.
  • the activatable proprotein amino acid sequence is homologous to any amino acid sequence encoding an activatable proprotein disclosed herein.
  • the term“homology” may refer to identity to an a sequence disclosed herein of greater than 70%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 72%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 75%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 78%. In another embodiment,“homology” refers to identity to any of SEQ ID SEQ ID NO: X-Y of greater than 80%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 82%.
  • “homology” refers to identity to any sequence disclosed herein of greater than 83%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 85%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 87%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 88%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 90%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 92%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 93%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 95%.
  • “homology” refers to identity to any sequence disclosed herein of greater than 96%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 97%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 98%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of greater than 99%. In another embodiment,“homology” refers to identity to any sequence disclosed herein of 100%.
  • the determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • a non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul, 1990, Proc. Natl. Acad. Sci. USA81 :2264-2268, modified as in Karlin and Altschul, 1993, Proc. Natl. Acad. Sci. £7X490:5873-5877.
  • Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul et al., 1990, J. Mol. Biol.215:403-410.
  • Gapped BLAST can be utilized as described in Altschul et al., 1997, Nucleic Acids Res.25 :3389-3402.
  • PSI-Blast can be used to perform an iterated search which detects distant relationships between molecules (id.).
  • protein sequence alignment may be carried out using the CLUSTAL W algorithm, as described by Higgins et al., 1996, Methods Enzymol.266:3&3-402.
  • polynucleotides of the present invention are prepared using PCR techniques using procedures and methods known to one skilled in the art.
  • the procedure involves the ligation of two different DNA sequences (See, for example,“Current Protocols in Molecular Biology”, eds. Ausubel et al., John Wiley & Sons, 1992).
  • an affinity tag be included in an activatable proprotein disclosed herein.
  • Affinity tags are well known in the art and are attached to a target and used to detect or isolate the target using a molecule that binds the affinity tag.
  • any peptide or protein for which an antibody or other specific binding agent is available can be used as an affinity tag.
  • Exemplary affinity tags suitable for use include, but are not limited to, a monocytic adaptor protein (MONA) binding peptide, a T7 binding peptide, a streptavidin binding peptide, a polyhistidine tract, protein A (Nilsson et al., EMBO J. 4:1075 (1985); Nilsson et al., Methods Enzymol.
  • MONA monocytic adaptor protein
  • Glu-Glu affinity tag Grussenmeyer et al., Proc. Natl. Acad. Sci. USA 82:7952 (1985)), substance P, FLAG peptide (Hopp et al., Biotechnology 6: 1204 (1988)), or other antigenic epitope or binding domain. See, in general, Ford et al., Protein Expression and Purification 2:95 (1991). DNA molecules encoding affinity tags are available from commercial suppliers (e.g., Pharmacia Biotech, Piscataway, N.J.). In one embodiment, a His6 tag is included in an activatable proprotein disclosed herein.
  • polynucleotides of the present invention are inserted into expression vectors (i.e., a nucleic acid construct) to enable expression of the polypeptides described herein.
  • the expression vector of the present invention includes additional sequences which render this vector suitable for replication and integration in prokaryotes.
  • the expression vector of the present invention includes additional sequences which render this vector suitable for replication and integration in eukaryotes.
  • the expression vector of the present invention includes a shuttle vector which renders this vector suitable for replication and integration in both prokaryotes and eukaryotes.
  • cloning vectors comprise transcription and translation initiation sequences (e.g., promoters, enhancer) and transcription and translation terminators (e.g., polyadenylation signals).
  • prokaryotic or eukaryotic cells can be used as host-expression systems to express the polypeptides of the present invention.
  • these include, but are not limited to, microorganisms, such as bacteria transformed with a recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vector containing the polypeptide coding sequence; yeast transformed with recombinant yeast expression vectors containing the polypeptide coding sequence.
  • non-bacterial expression systems are used (e.g., mammalian expression systems such as CHO cells) to express the polypeptide of the present invention.
  • the expression vector used to express polynucleotides of the present invention in mammalian cells is pCI-DHFR vector comprising a CMV promoter and a neomycin resistance gene.
  • a number of expression vectors can be advantageously selected depending upon the use intended for the polypeptide expressed.
  • large quantities of polypeptide are desired.
  • vectors that direct the expression of high levels of the protein product, possibly as a fusion with a hydrophobic signal sequence, which directs the expressed product into the periplasm of the bacteria or the culture medium where the protein product is readily purified are desired.
  • vectors adaptable to such manipulation include, but are not limited to, the pET series of E. coli expression vectors [Studier et ah, Methods in Enzymol. 185:60-89 (1990)].
  • yeast expression systems are used.
  • a number of vectors containing constitutive or inducible promoters can be used in yeast as disclosed in U.S. Pat. No. 5,932,447.
  • vectors which promote integration of foreign DNA sequences into the yeast chromosome are used.
  • the expression vector of the present invention can further include additional polynucleotide sequences that allow, for example, the translation of several proteins from a single mRNA such as an internal ribosome entry site (IRES) and sequences for genomic integration of the promoter-chimeric polypeptide.
  • IRS internal ribosome entry site
  • mammalian expression vectors include, but are not limited to, pcDNA3, pcDNA3.1 (+/-), pGL3, pZeoSV2(+/-), pSecTag2, pDisplay, pEF/myc/cyto, pCMV/myc/cyto, pCR3.1, pSinRep5, DH26S, DHBB, pNMTl, pNMT41, pNMT81, which are available from Invitrogen, pCI which is available from Promega, pMbac, pPbac, pBK-RSV and pBK-CMV which are available from Strategene, pTRES which is available from Clontech, and their derivatives.
  • expression vectors containing regulatory elements from eukaryotic viruses such as retroviruses are used by the present invention.
  • SV40 vectors include pSVT7 and pMT2.
  • vectors derived from bovine papilloma virus include pBV-lMTHA, and vectors derived from Epstein Bar virus include pHEBO, and p205.
  • exemplary vectors include pMSG, pAV009/A + , pMTO10/A + , pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the SV-40 early promoter, SV-40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
  • recombinant viral vectors are useful for in vivo expression of the polypeptides of the present invention since they offer advantages such as lateral infection and targeting specificity.
  • lateral infection is inherent in the life cycle of, for example, retrovirus and is the process by which a single infected cell produces many progeny virions that bud off and infect neighboring cells.
  • the result is that a large area becomes rapidly infected, most of which was not initially infected by the original viral particles.
  • viral vectors are produced that are unable to spread laterally. In one embodiment, this characteristic can be useful if the desired purpose is to introduce a specified gene into only a localized number of targeted cells.
  • various methods can be used to introduce the expression vector encoding the polypeptides of the present invention into cells. Such methods are generally described in Sambrook et ah, Molecular Cloning: A Laboratory Manual, Cold Springs Harbor Laboratory, New York (1989, 1992), in Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1989), Chang et al., Somatic Gene Therapy, CRC Press, Ann Arbor, Mich. (1995), Vega et al., Gene Targeting, CRC Press, Ann Arbor Mich. (1995), Vectors: A Survey of Molecular Cloning Vectors and Their Uses, Butterworths, Boston Mass. (1988) and Gilboa et at.
  • the activatable proproteins or polypeptides comprised thereby of the present invention can also be expressed from a nucleic acid construct administered to the individual employing any suitable mode of administration, described hereinabove (i.e., in-vivo gene therapy).
  • the nucleic acid construct is introduced into a suitable cell via an appropriate gene delivery vehicle/method (transfection, transduction, homologous recombination, etc.) and an expression system as needed and then the modified cells are expanded in culture and returned to the individual (i.e., ex- vivo gene therapy).
  • the expression construct of the present invention can also include sequences engineered to optimize stability, production, purification, yield or activity of the expressed polypeptide.
  • transformed cells are cultured under effective conditions, which allow for the expression of high amounts of an activatable proprotein or polypeptides that make up the same (i.e. - a first and a second polypeptide as further described herein).
  • effective culture conditions include, but are not limited to, effective media, bioreactor, temperature, pH and oxygen conditions that permit protein production.
  • an effective medium refers to any medium in which a cell is cultured to produce an activatable proprotein provided herein.
  • a medium typically includes an aqueous solution having assimilable carbon, nitrogen and phosphate sources, and appropriate salts, minerals, metals and other nutrients, such as vitamins.
  • cells of the present invention can be cultured in conventional fermentation bioreactors, shake flasks, test tubes, microtiter dishes and petri plates.
  • culturing is carried out at a temperature, pH and oxygen content appropriate for a recombinant cell.
  • culturing conditions are within the expertise of one of ordinary skill in the art.
  • the resultant polypeptides of the activatable proprotein provided herein either remain within a recombinant cell, are secreted into the fermentation medium, are secreted into a space between two cellular membranes, such as the periplasmic space in E. coli, or are retained on the outer surface of a cell or viral membrane.
  • recovery of the activatable proprotein or polypeptides that make up the same is effected.
  • the phrase“recovering the activatable proprotein or polypeptides comprised by or that make up the same” used herein refers to collecting the whole fermentation medium containing the activatable proprotein/polypeptides and need not imply additional steps of separation or purification.
  • an activatable proprotein or polypeptides that make up the same of the present invention are purified using a variety of standard protein purification techniques, such as, but not limited to, affinity chromatography, ion exchange chromatography, filtration, electrophoresis, hydrophobic interaction chromatography, gel filtration chromatography, reverse phase chromatography, concanavalin A chromatography, chromatofocusing and differential solubilization.
  • standard protein purification techniques such as, but not limited to, affinity chromatography, ion exchange chromatography, filtration, electrophoresis, hydrophobic interaction chromatography, gel filtration chromatography, reverse phase chromatography, concanavalin A chromatography, chromatofocusing and differential solubilization.
  • the expressed coding sequence can be engineered to encode an activatable proprotein of the present invention.
  • the activatable proprotein can be designed so that it can be readily isolated by affinity chromatography; e.g., by immobilization on a column specific for the cleavable moiety.
  • an activatable proprotein of the present invention is retrieved in“substantially pure” form.
  • the phrase“substantially pure” refers to a purity that allows for the effective use of an activatable proprotein in the applications described herein.
  • an activatable proprotein provided herein can also be synthesized using in vitro expression systems.
  • in vitro synthesis methods are well known in the art and the components of the system are commercially available.
  • an activatable proprotein disclosed herein is synthesized and purified, their therapeutic efficacy can be assayed in vivo or in vitro.
  • the pharmaceutical composition provided herein comprising an activatable proprotein of the invention is further formulated with a pharmaceutical carrier.
  • pharmaceutical carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • Activatable proproteins described herein can be selected for use in methods of treatment of suitable subjects in need thereof.
  • the activatable proproteins or pharmaceutical compositions provided herein can be administered by any suitable means, including oral, parenteral, subcutaneous, intraperitoneal, intrapulmonary, intranasal, spinal or epidermal administration (e.g. by injection or infusion), and, if desired for local injection (e.g., at the site of a solid tumor).
  • Parenteral administration routes include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
  • a method comprising administering the activatable proprotein or the pharmaceutical composition disclosed herein to a subject having a cancer to prevent or treat the cancer in the subject, wherein following administration, the activatable proprotein is activated through protease cleavage in a cancerous tissue.
  • a method comprising administering the activatable proprotein or the pharmaceutical composition disclosed herein to a subject in need thereof, to elicit or enhance an anti -tumor immune response in the subject, wherein following administration, the activatable proprotein is activated through protease cleavage in the tumor.
  • a use of the activatable proprotein or the pharmaceutical composition disclosed herein for preventing or treating a cancer in a subject comprising the step of administering the activatable proprotein or pharmaceutical composition, and wherein following administration, the activatable proprotein is activated through protease cleavage in a cancerous tissue.
  • activatable proprotein or the pharmaceutical composition disclosed herein for eliciting or enhancing an anti-tumor immune response in a subject, comprising the step of administering the activatable proprotein or pharmaceutical composition, and wherein following administration, the activatable proprotein is activated through protease cleavage in a tumor.
  • treatment site or disease site is meant to refer to a site at which an activatable proprotein is designed to be switchable, as described herein, e.g., a site at which a masking moiety is cleaved from the active domain.
  • Treatment sites include tissues that can be accessed by local administration (e.g., injection, infusion (e.g., by catheter), etc.) or by systemic administration (e.g., administration to a site remote from a treatment site).
  • Treatment sites include those that are relatively biologically confined (e.g., an organ, sac, tumor site, and the like).
  • a disease disclosed herein is a cancer.
  • a cancer disclosed herein is selected from adrenocortical carcinoma, AIDS- related cancers, AIDS-related lymphoma, lymphoma, thyroid cancer, pancreatic cancer, anal cancer, anorectal cancer, cancer of the anal canal, appendix cancer, childhood cerebellar astrocytoma, childhood cerebral astrocytoma, basal cell carcinoma, biliary cancer, extrahepatic bile duct cancer, intrahepatic bile duct cancer, bladder cancer, urinary bladder cancer, bone and joint cancer, osteosarcoma and malignant fibrous histiocytoma, brain cancer, brain tumor, brain stem glioma, neuroblastoma, cerebellar astrocytoma, cerebral astrocytoma/malignant glioma, ependymoma, medulloblastoma, supratentorial primitive neuroectodermal tumors,
  • the present invention provides a method of treating a disease or condition in a subject in need thereof, the method comprising administering a therapeutically effective amount of the activatable proprotein or the pharmaceutical composition disclosed herein.
  • the present invention provides a method of treating a cancer or tumor disclosed herein in a subject in need thereof, the method comprising administering a therapeutically effective amount of the activatable proprotein or a pharmaceutical composition disclosed herein.
  • the present invention provides a method of preventing, inhibiting, suppressing or delaying the onset of a cancer or tumor in a subject, the method comprising administering an effective amount of the activatable proprotein or the pharmaceutical composition described herein.
  • treating a patient with a pharmaceutical composition comprising the activatable proprotein provided herein can result in increase in average survival time of a population of treated subjects in comparison to a population receiving monotherapy with a drug that is not a compound of the disclosure, or a pharmaceutically acceptable salt, solvate, analog or derivative thereof.
  • the average survival time is increased by more than 30 days; more preferably, by more than 60 days; more preferably, by more than 90, 120, or 365 days; more preferably, by more than 365 days.
  • An increase in average survival time of a population may be measured by any reproducible means.
  • An increase in average survival time of a population may be measured, for example, by calculating for a population the average length of survival following initiation of treatment with an active compound.
  • An increase in average survival time of a population may also be measured, for example, by calculating for a population the average length of survival following completion of a first round of treatment with the pharmaceutical composition disclosed herein.
  • treating a patient with a pharmaceutical composition comprising the activatable proprotein provided herein can result in a decrease in the mortality rate of a population of treated subjects in comparison to a population receiving carrier alone.
  • Treating cancer can result in a decrease in the mortality rate of a population of treated subjects in comparison to an untreated population.
  • Treating cancer can result in a decrease in the mortality rate of a population of treated subjects in comparison to a population receiving monotherapy with a drug that is not a compound of the disclosure, or a pharmaceutically acceptable salt, solvate, analog or derivative thereof.
  • the mortality rate is decreased by more than 2%; more preferably, by more than 5%; more preferably, by more than 10%; and most preferably, by more than 25%.
  • a decrease in the mortality rate of a population of treated subjects may be measured by any reproducible means.
  • a decrease in the mortality rate of a population may be measured, for example, by calculating for a population the average number of disease-related deaths per unit time following initiation of treatment with an active compound.
  • a decrease in the mortality rate of a population may also be measured, for example, by calculating for a population the average number of disease-related deaths per unit time following completion of a first round of treatment with the pharmaceutical composition disclosed herein.
  • An activatable proprotein or pharmaceutical composition comprising the same can be parenterally administered to a subject in need thereof, or can be administered by a variety of methods known in the art.
  • the route and/or mode of administration will vary depending upon the desired results.
  • the compound may be administered to a subject in an appropriate carrier, for example, liposomes, or a diluent.
  • Pharmaceutically acceptable diluents include saline and aqueous buffer solutions.
  • Pharmaceutical carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art.
  • preparations for administration to subjects include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
  • Some embodiments include non-aqueous solvents such as propylene glycol, polyethylene glycol, vegetable oils (e.g., olive oils), organic esters (e.g., ethyl oleate) and other solvents known to those of skill in the art.
  • Physiologically acceptable carriers are optionally used in certain embodiments of the invention. Examples of such include, e.g., saline, PBS, Ringer's solution, lactated Ringer's solution, etc.
  • preservatives and additives are optionally added to the compositions to help ensure stability and sterility.
  • antibiotics and other bacteriocides, antioxidants, chelating agents, and the like are all optionally present in various embodiments of the compositions herein.
  • parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intra arterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intra-articular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
  • the compounds of the present invention which may be used in a suitable hydrated form, and/or the pharmaceutical compositions of the present invention, are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those of skill in the art.
  • the activatable proprotein, or pharmaceutical composition comprising the same are optionally administered to subjects in need of treatment (either therapeutically or prophylactically) in any appropriate sterile pharmaceutical carrier.
  • Such pharmaceutical carrier acts to maintain the solubility and action of then activatable proprotein.
  • it may be desired to administer additional components in conjunction with the activatable proprotein.
  • chemotherapeutic agents, antibiotics, additional formulations comprising the activatable proprotein provided herein and one or more standard of care agents, etc. are all optionally included with the compositions of the invention.
  • combination treatment As used herein, the terms“combination treatment,”“combination therapy,” and “co-therapy” are used interchangeably and generally refer to treatment modalities featuring an activatable proprotein or pharmaceutical composition comprising the same as provided herein and an additional therapeutic agent.
  • combination treatment modalities are part of a specific treatment regimen intended to provide a beneficial effect from the concurrent action of the therapeutic agent combination.
  • the beneficial effect of the combination may include, but is not limited to, pharmacokinetic or pharmacodynamic co action resulting from the combination of therapeutic agents.
  • Administration of these therapeutic agents in combination typically is carried out over a defined time period (usually minutes, hours, days or weeks depending upon the combination selected).
  • combination treatment comprises administration of two or more therapeutic agents in a sequential manner, wherein each therapeutic agent is administered at a different time, as well as administration of these therapeutic agents, or at least two of the therapeutic agents, in a substantially simultaneous manner.
  • Substantially simultaneous administration can be accomplished, for example, by administering to the subject a single dosage form having a fixed ratio of each therapeutic agent or in multiple, separate dosage forms for the therapeutic agents.
  • Sequential or substantially simultaneous administration of each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, intramuscular routes, and direct absorption through mucous membrane tissues.
  • the therapeutic agents can be administered by the same route or by different routes.
  • the therapeutic agents can be administered according to the same or to a different administration interval.
  • a first therapeutic agent of the combination selected may be administered by intravenous injection while the other therapeutic agents of the combination may be administered orally.
  • all therapeutic agents may be administered orally or all therapeutic agents may be administered by intravenous injection.
  • combination therapy also embraces the administration of the therapeutic agents as described above in further combination with other biologically active ingredients and non-drug therapies (e.g surgery or radiation treatment).
  • the combination therapy further comprises a non-drug treatment
  • the non-drug treatment may be conducted at any suitable time so long as a beneficial effect from the co-action of the combination of the therapeutic agents and non-drug treatment is achieved.
  • the beneficial effect is still achieved when the non-drug treatment is temporally removed from the administration of the therapeutic agents, perhaps by days or even weeks.
  • the additional therapeutic agent is a chemotherapeutic agent (also referred to as an anti-neoplastic agent or anti-proliferative agent), e.g., an alkylating agent; an antibiotic; an anti-metabolite; a detoxifying agent; an interferon; a polyclonal or monoclonal antibody; an EGFR inhibitor; a HER2 inhibitor; a histone deacetylase inhibitor; a hormone; a mitotic inhibitor; an MTOR inhibitor; a multi-kinase inhibitor; a serine/threonine kinase inhibitor; a tyrosine kinase inhibitors; a VEGF/VEGFR inhibitor; a taxane or taxane derivative, an aromatase inhibitor, an anthracycline, a microtubule targeting drug, a topoisomerase poison drug, an inhibitor of a molecular target or enzyme (e.g., a kinase or a kinase or
  • alkylating agents suitable for use according to the combination treatment modalities provided herein include, but are not limited to, cyclophosphamide (Cytoxan; Neosar); chlorambucil (Leukeran); melphalan (Alkeran); carmustine (BiCNU); busulfan (Busulfex); lomustine (CeeNU); dacarbazine (DTIC-Dome); oxaliplatin (Eloxatin); carmustine (Gliadel); ifosfamide (Ifex); mechlorethamine (Mustargen); busulfan (Myleran); carboplatin (Paraplatin); cisplatin (CDDP; Platinol); temozolomide (Temodar); thiotepa (Thioplex); bendamustine (Treanda); or streptozocin (Zanosar).
  • cyclophosphamide Cytoxan; Neosar
  • chlorambucil
  • anthracyclines include, but are not limited to, doxorubicin (Adriamycin); doxorubicin liposomal (Doxil); mitoxantrone (Novantrone); bleomycin (Blenoxane); daunorubicin (Cerubidine); daunorubicin liposomal (DaunoXome); dactinomycin (Cosmegen); epirubicin (Ellence); idarubicin (Idamycin); plicamycin (Mithracin); mitomycin (Mutamycin); pentostatin (Nipent); or valrubicin (Valstar).
  • doxorubicin Adriamycin
  • Doxil doxorubicin liposomal
  • mitoxantrone Novantrone
  • bleomycin Blenoxane
  • daunorubicin Cerubidine
  • daunorubicin liposomal DaunoXome
  • Exemplary anti-metabolites include, but are not limited to, fluorouracil (Adrucil); capecitabine (Xeloda); hydroxyurea (Hydrea); mercaptopurine (Purinethol); pemetrexed (Alimta); fludarabine (Fludara); nelarabine (Arranon); cladribine (Cladribine Novaplus); clofarabine (Clolar); cytarabine (Cytosar-U); decitabine (Dacogen); cytarabine liposomal (DepoCyt); hydroxyurea (Droxia); pralatrexate (Folotyn); floxuridine (FUDR); gemcitabine (Gemzar); cladribine (Leustatin); fludarabine (Oforta); methotrexate (MTX; Rheumatrex); methotrexate (Trexall); thioguan
  • Exemplary detoxifying agents include, but are not limited to, amifostine (Ethyol) or mesna (Mesnex).
  • interferons include, but are not limited to, interferon alfa-2b (Intron A) or interferon alfa-2a (Roferon-A).
  • Exemplary polyclonal or monoclonal antibodies include, but are not limited to, trastuzumab (Herceptin); ofatumumab (Arzerra); bevacizumab (Avastin); rituximab (Rituxan); cetuximab (Erbitux); panitumumab (Vectibix); tositumomab/iodine-131 tositumomab (Bexxar); alemtuzumab (Campath); ibritumomab (Zevalin; In-111; Y-90 Zevalin); gemtuzumab (Mylotarg); eculizumab (Soliris) or denosumab.
  • Exemplary EGFR inhibitors include, but are not limited to, gefitinib (Iressa); lapatinib (Tykerb); cetuximab (Erbitux); erlotinib (Tarceva); panitumumab (Vectibix); PKI- 166; canertinib (CI-1033); matuzumab (EMD 72000) or EKB-569.
  • Exemplary HER2 inhibitors include, but are not limited to, trastuzumab (Herceptin); lapatinib (Tykerb) or AC-480.
  • Histone Deacetylase Inhibitors include, but are not limited to, vorinostat (Zolinza).
  • Exemplary hormones include, but are not limited to, tamoxifen (Soltamox; Nolvadex); raloxifene (Evista); megestrol (Megace); leuprolide (Lupron; Lupron Depot; Eligard; Viadur); fulvestrant (Faslodex); letrozole (Femara); triptorelin (Trelstar LA; Trelstar Depot); exemestane (Aromasin); goserelin (Zoladex); bicalutamide (Casodex); anastrozole (Arimidex); fluoxymesterone (Androxy; Halotestin); medroxyprogesterone (Provera; Depo- Provera); estramustine (Emcyt); flutamide (Eulexin); toremifene (Fareston); degarelix (Firmagon); nilutamide (Nilandron); a
  • Exemplary mitotic inhibitors include, but are not limited to, paclitaxel (Taxol; Onxol; Abraxane); docetaxel (Taxotere); vincristine (Oncovin; Vincasar PFS); vinblastine (Velban); etoposide (Toposar; Etopophos; VePesid); teniposide (Vumon); ixabepilone (Ixempra); nocodazole; epothilone; vinorelbine (Navelbine); camptothecin (CPT); irinotecan (Camptosar); topotecan (Hycamtin); amsacrine or lamellarin D (LAM-D).
  • Exemplary MTOR inhibitors include, but are not limited to, everolimus (Afmitor) or temsirolimus (Torisel); rapamune, ridaforolimus; or AP23573.
  • Exemplary multi-kinase inhibitors include, but are not limited to, sorafenib (Nexavar); sunitinib (Sutent); BIBW 2992; E7080; Zd6474; PKC-412; motesanib; or AP24534.
  • Exemplary serine/threonine kinase inhibitors include, but are not limited to, ruboxistaurin; eril/fasudil hydrochloride; flavopiridol; seliciclib (CYC202; Roscovitine); SNS-032 (BMS-387032); Pkc412; bryostatin; KAI-9803; SF1126; VX-680; Azdl l52; Arry- 142886 (AZD-6244); SCIO-469; GW681323; CC-401; CEP-1347 or PD 332991.
  • Exemplary tyrosine kinase inhibitors include, but are not limited to, erlotinib (Tarceva); gefitinib (Iressa); imatinib (Gleevec); sorafenib (Nexavar); sunitinib (Sutent); trastuzumab (Herceptin); bevacizumab (Avastin); rituximab (Rituxan); lapatinib (Tykerb); cetuximab (Erbitux); panitumumab (Vectibix); everolimus (Afmitor); alemtuzumab (Campath); gemtuzumab (Mylotarg); temsirolimus (Torisel); pazopanib (Votrient); dasatinib (Sprycel); nilotinib (Tasigna); vatalanib (Ptk787; ZK222584); CEP-701;
  • VEGF/VEGFR inhibitors include, but are not limited to, bevacizumab (Avastin); sorafenib (Nexavar); sunitinib (Sutent); ranibizumab; pegaptanib; or vandetinib.
  • microtubule targeting drugs include, but are not limited to, paclitaxel, docetaxel, vincristin, vinblastin, nocodazole, epothilones and navelbine.
  • topoisomerase poison drugs include, but are not limited to, teniposide, etoposide, adriamycin, camptothecin, daunorubicin, dactinomycin, mitoxantrone, amsacrine, epirubicin and idarubicin.
  • Exemplary taxanes or taxane derivatives include, but are not limited to, paclitaxel and docetaxol.
  • Exemplary general chemotherapeutic, anti -neoplastic, anti-proliferative agents include, but are not limited to, altretamine (Hexalen); isotretinoin (Accutane; Amnesteem; Claravis; Sotret); tretinoin (Vesanoid); azacitidine (Vidaza); bortezomib (Velcade) asparaginase (Elspar); levamisole (Ergamisol); mitotane (Lysodren); procarbazine (Matulane); pegaspargase (Oncaspar); denileukin diftitox (Ontak); porfimer (Photofrin); aldesleukin (Proleukin); lenalidomide (Revlimid); bexarotene (Targretin); thalidomide (Thalomid); temsirolimus (Torisel); arsenic trioxide (Hexal
  • combination treatment modalities are provided in which the additional therapeutic agent is a cytokine, e.g., G-CSF (granulocyte colony stimulating factor).
  • a pharmaceutical composition provided herein may be administered in combination with radiation therapy. Radiation therapy can also be administered in combination with a pharmaceutical composition provided herein and another chemotherapeutic agent described herein as part of a multi-agent therapy.
  • a pharmaceutical composition provided herein may be administered in combination with standard chemotherapy combinations such as, but not restricted to, CMF (cyclophosphamide, methotrexate and 5-fluorouracil), CAF (cyclophosphamide, adriamycin and 5-fluorouracil), AC (adriamycin and cyclophosphamide), FEC (5-fluorouracil, epirubicin, and cyclophosphamide), ACT or ATC (adriamycin, cyclophosphamide, and paclitaxel), rituximab, Xeloda (capecitabine), Cisplatin (CDDP), Carboplatin, TS-1 (tegafur, gimestat and otastat potassium at a molar ratio of 1 :0.4: 1), Camptothecin-11 (CPT-11, Irinotecan or CamptosarTM), CHOP (cyclophosphamide,
  • CMF
  • a pharmaceutical composition provided herein may be administered with an inhibitor of an enzyme, such as a receptor or non-receptor kinase.
  • Receptor and non-receptor kinases are, for example, tyrosine kinases or serine/threonine kinases.
  • Kinase inhibitors described herein are small molecules, polynucleic acids, polypeptides, or antibodies.
  • Exemplary kinase inhibitors include, but are not limited to, Bevacizumab (targets VEGF), BIBW 2992 (targets EGFR and Erb2), Cetuximab/Erbitux (targets Erbl), Imatinib/Gleevec (targets Bcr-Abl), Trastuzumab (targets Erb2), Gefitinib/Iressa (targets EGFR), Ranibizumab (targets VEGF), Pegaptanib (targets VEGF), Erlotinib/Tarceva (targets Erbl), Nilotinib (targets Bcr-Abl), Lapatinib (targets Erbl and Erb2/Her2), GW- 572016/lapatinib ditosylate (targets HER2/Erb2), Panitumumab/Vectibix (targets EGFR), Vandetinib (targets RET/VEGFR),
  • an activatable proprotein or pharmaceutical composition comprising the same polypeptide disclosed herein is administered to a subject once a day.
  • the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject once every two days.
  • the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject once every three days.
  • the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject once every four days.
  • the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject once every five days.
  • the activatable proprotein or pharmaceutical composition comprising the same polypeptide is administered to a subject once every six days.
  • the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject once every week. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject once every 7-14 days. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject once every 10-20 days. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject once every 5-15 days. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject once every 15-30 days.
  • a dose of an activatable proprotein of the present invention comprises from 0.005 to 0.1 milligrams/kg in an injectable solution. In another embodiment, the dose comprises from 0.005 to 0.5 milligrams/kg of the activatable proprotein. In another embodiment, the dose comprises from 0.05 to 0.1 micrograms of the activatable proprotein. In another embodiment, the dose comprises from 0.005 to 0.1 milligrams/kg of the activatable proprotein in an injectable solution.
  • an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.0001 mg to 0.6 mg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.001 mg to 0.005 mg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.005 mg to 0.01 mg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.01 mg to 0.3 mg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.2 mg to 0.6 mg.
  • an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 1-100 mcg/kg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 10-80 mcg/kg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 20-60 mcg/kg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 10-50 mcg/kg.
  • the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 40-80 mcg/kg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 10-30 mcg/kg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 30-60 mcg/kg.
  • an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 100 mg/kg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 50 mg/kg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 25 mg/kg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 10 mg/kg.
  • the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 5 mg/kg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 1 mg/kg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 0.1 mg/kg.
  • an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.2 mg to 2 mg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 2 mg to 6 mg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 4 mg to 10 mg. In another embodiment, the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 5 mg and 15 mg.
  • an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 10 pg/kg-1000 pg/kg. In another embodiment, an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 25 pg/kg-600 pg/kg. In another embodiment, an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 50 pg/kg-400 pg/kg. In another embodiment, an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 25 pg/kg.
  • an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 50 pg/kg. In another embodiment, an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 100 pg/kg. In another embodiment, an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 200 pg/kg. In another embodiment, an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 300 pg/kg. In another embodiment, an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 400 pg/kg.
  • an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 500 pg/kg. In another embodiment, an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 600 pg/kg.
  • a single one time dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject.
  • a total of two doses are administered to the subject.
  • a total of two or more doses are administered to the subject.
  • a dose of an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject at least once a day. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject at least once every two days. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject at least once a every two or more days. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject every week, biweekly or every three weeks. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject at least once a week.
  • a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject at least once every two weeks. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject at least once every three weeks. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject at least once every three or more weeks. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject two or more times a week. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject two or more times a month.
  • a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject two or more times a year. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject two or more times every two years. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered to a subject two or more times every two or more years.
  • a dose of an activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 36 hours. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 48 hours. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 60 hours. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 72 hours. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 84 hours. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 96 hours.
  • a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 5 days. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 6 days. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 7 days. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 8-10 days. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 10-12 days. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 12-15 days. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 15-25 days. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 20-30 days.
  • a dose of an activatable proprotein or pharmaceutical composition comprising the same is administered to a subject at least once every 1 month. In one embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 2 months. In one embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 3 months. In one embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 4 months. In one embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 5 months. In one embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 6 months.
  • a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered at least once every 6-12 months. In another embodiment, a dose of the activatable proprotein or pharmaceutical composition comprising the same is administered quarterly. In another embodiment, the dose is administered daily, weekly, biweekly, monthly or annually. In another embodiment, the dose is administered once, twice, or two or more times a day, a week, a month or a year. In another embodiment, the dose is administered every two, three, four, or at least five years.
  • repeat administrations (doses) of compositions of this invention may be undertaken immediately following the first course of treatment or after an interval of days, weeks, or years to achieve the desired effect as further provided herein (e.g. to prevent or treat cardiovascular disease or condition, or a CNS-related disease or condition).
  • the pharmaceutical compositions are administered by intravenous, intra-arterial, subcutaneous or intramuscular injection of a liquid preparation.
  • liquid formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
  • the pharmaceutical compositions are administered intravenously, and are thus formulated in a form suitable for intravenous administration.
  • the pharmaceutical compositions are administered intra-arterially, and are thus formulated in a form suitable for intra-arterial administration.
  • compositions for use in the methods disclosed herein comprise solutions or emulsions, which in some embodiments are aqueous solutions or emulsions comprising a safe and effective amount of the compounds disclosed herein and optionally, other compounds, intended for intravenous or subcutaneous administration.
  • kits for conducting/using the methods and/or the compositions of the invention can also comprise appropriate excipients (e.g., pharmaceutically acceptable excipients) for performing therapeutic and/or prophylactic treatments of the invention.
  • excipients e.g., pharmaceutically acceptable excipients
  • kits optionally contain additional components for the assembly and/or use of the compositions of the invention including, but not limited to, e.g., diluents, etc.
  • kits can optionally include such components as, e.g., buffers, reagents, serum proteins, antibodies, substrates, etc.
  • prepackaged reagents the kits optionally include pre-measured or pre-dosed amounts that are ready to incorporate into the methods without measurement, e.g., pre-measured fluid aliquots, or pre-weighed or pre-measured solid reagents that can be easily reconstituted by the end-user of the kit.
  • kits also typically include appropriate instructions for performing the methods of the invention and/or using the compositions of the invention.
  • the components of the kits/packages are provided in a stabilized form, so as to prevent degradation or other loss during prolonged storage, e.g., from leakage.
  • a number of stabilizing processes/agents are widely used for reagents, etc. that are to be stored, such as the inclusion of chemical stabilizers (i.e., enzymatic inhibitors, microbicides/bacteriostats, anticoagulants), etc.
  • Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
  • the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • the composition must be sterile and fluid to the extent that the composition is deliverable by syringe.
  • the carrier preferably is an isotonic buffered saline solution. Proper fluidity can be maintained, for example, by use of coating such as lecithin, by maintenance of required particle size in the case of dispersion and by use of surfactants.
  • isotonic agents for example, sugars, polyalcohols such as mannitol or sorbitol, and sodium chloride in the composition.
  • compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
  • the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • a reference to“A and/or B”, when used in conjunction with open-ended language such as“comprising” can refer, in one embodiment, to A only (optionally including elements 5 other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
  • the phrase“at least one,” in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements.
  • This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase“at least one” refers, whether related or unrelated to those elements specifically identified.
  • “at least one of A and B” can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
  • the present invention further provides a kit for preventing, treating or delaying a cardiovascular disease or condition in a human, wherein the kit comprises one or more doses of pharmaceutical composition comprising an activatable proprotein disclosed herein used for preventing, treating or delaying a cardiovascular disease or condition, and instructions on how to use the pharmaceutical preparation or composition.
  • the present invention further provides a kit for preventing, treating or delaying a CNS-related disease or condition in a human, wherein the kit comprises one or more doses of pharmaceutical composition comprising an activatable proprotein disclosed herein used for preventing, treating or delaying a cardiovascular disease or condition, and instructions on how to use the pharmaceutical preparation or composition.
  • the present invention further provides a kit for preventing, treating or delaying heart failure with preserved ejection fraction in a human, wherein the kit comprises one or more doses of pharmaceutical composition comprising an activatable protein disclosed herein used for preventing, treating or delaying heart failure with preserved ejection fraction, and instructions on how to use the pharmaceutical preparation or composition.
  • Fc-IL-15- linker-IL-15Ra fusion proteins (hereon referred to as Fc-ILR fusion proteins) were generated as prodrugs (i.e.- activatable proprotein as described elsewhere herein).
  • the prodrugs have very low activities. Full activities can be restored upon protease cleavage of the designed protease specific linker sequence within the prodrugs.
  • Plasmids coding for single chain IL-15-linker-IL-15Ra (ILR) with or without Fc fusion were constructed by standard gene synthesis, followed by sub-cloning into pTT5 expression vector. Schematics of illustrative Fc-ILR fusion protein formats are depicted in Figure 3E, 3F, 4A, and 4F.
  • Illustrative proteins of Fc-ILR format without protease cleavage site include PI 187 (SEQ ID NO: 18), PI 188 (SEQ ID NO: 19), P1250 (SEQ ID NO: 20), P1251 (SEQ ID NO: 21), and PI 252 (SEQ ID NO: 22).
  • Illustrative proteins of IL-15-linker-IL-15Ra-Fc (ILR-Fc) format are PI 186 (SEQ ID NO: 17) and P1331 (SEQ ID NO: 73).
  • Illustrative proteins of IL-15-linker-IL-15Ra format ( Figures 2C and 2D) with His6-tag at the C-terminal of IL-15Ra are PI 185 (SEQ ID NO: 16) and P1275 (SEQ ID NO: 39).
  • Illustrative proteins of ILR-Fc-a format are P1332 (SEQ ID NO: 74) and PI 333 (SEQ ID NO: 75).
  • C-terminal serine (S162) of IL-15 in IL15 fusion proteins is a potential glycosylation site in IL-15 fusion protein and glycosylation of SI 62 may affect the potency of the fusion proteins.
  • a point mutation was introduced by standard mutagenesis techniques into IL- 15 -linker-IL- 15Ra-F c (ILR-Fc), Fc- IL-15-linker-IL-15Ra (Fc-ILR) and IL-15-linker-IL- 15Ra (ILR).
  • An illustrative protein of ILR-Fc with S162A is P1253 (SEQ ID NO: 23).
  • Illustrative proteins of Fc-ILR with S162A are P1254 (SEQ ID NO: 24), P1255 (SEQ ID NO: 25), P1279 (SEQ ID NO: 41) and P1280 (SEQ ID NO: 42).
  • Illustrative proteins of ILR-His6 with SI 62 A are PI 274 (SEQ ID NO: 38) and PI 276 (SEQ ID NO: 40).
  • Fc fusion proteins were produced by transient transfection in Expi293 cells and purified by a two-step purification process comprising MabSelect SuRe chromatography (GE Healthcare) and size exclusion chromatography (Superdex 200, GE Healthcare).
  • His-tagged protein were produced by transient transfection in Expi293 cells and purified by a two-step purification process comprising nickel affinity chromatography (GE Healthcare) and size exclusion chromatography (Superdex 75 or Superdex 200, GE Healthcare).
  • Purified proteins were characterized by SDS-PAGE and high performance liquid chromatography (HPLC) for purity and homogeneity assessment. HPLC analysis was performed using Nanofilm SEC-250 column (Sepax) and Agilent 1260 according to the manufacturer’s instructions. Representative SDS-PAGE and HPLC results were shown in Figures 9A-9F and Figures 10A-10G. Purified protein showed good purity and homogeneity. For ILR-His format, P1274 (SEQ ID NO: 38) with 15 amino acid linker and P1276 (SEQ ID NO: 40) with 26 amino acid linker, the theoretic MW of monomer is around 24KD and dimer is around 50KD.
  • Figures 11A and 11B depict selection of cell population following incubation with PI 185 (SEQ ID NO: 16). Lymphocytes were first gated on the basis of side scatter (SSC) and forward scatter (FSC) ( Figure 11 A). Lymphocytes were then gated based on CD3 expression and STAT5 phosphorylation ( Figure 11B). The signaling assay results are summarized in Figure 11C and Figure 11D.
  • ILR-His PI 185 with SEQ ID NO: 16, PI 275 with SEQ ID NO: 39, PI 274 with SEQ ID NO: 38 and PI 276 with SEQ ID NO: 40
  • ILR-Fc PI 186 with SEQ ID NO: 17, P1331 with SEQ ID NO: 73, P1253 with SEQ ID NO: 23, P1332 with SEQ ID NO: 74 and P1333 with SEQ ID NO: 75
  • Fc-ILR PI 187 with SEQ ID NO: 18, PI 188 with SEQ ID NO: 19, P1250 with SEQ ID NO: 20, P1251 with SEQ ID NO: 21, P1252 with SEQ ID NO: 22, P1254 with SEQ ID NO: 24, P1255 with SEQ ID NO: 25, P1279 with SEQ ID NO: 41 and P1280 with SEQ ID NO: 42
  • P1255 with SEQ ID NO: 25 P1279 with SEQ ID NO: 41 and P1280 with SEQ ID NO: 42
  • Cell signaling assay was also performed using human whole blood for a few purified fusion proteins. Human whole blood samples were collected from healthy individuals and used following the guidelines according to signed consent agreement. Purified fusion proteins were incubated with fresh human whole blood at 37°C for 15 minutes. Following incubation, cellular stimulation was terminated by the addition of a lysis and fixation buffer (BD, Cat# 558049) to remove red blood cells and fix the remaining cells for cellular staining. Anti-CD3-FITC (UCHT1, BD, Cat# 555916) was added to the cell suspensions and incubated for 1 h at 37°C for staining before being removed by two washing steps using phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • M-07e (IL-2RD/Dc) cells were cultured in RPMI 1640 supplemented with 20% fetal bovine serum (FBS), 1% non-essential amino acids (NEAA) and 10% of 5637 cell culture supernatant.
  • FBS fetal bovine serum
  • NEAA non-essential amino acids
  • M-07e cells were harvested in their logarithmic growth phase and washed twice with PBS.
  • 90pl of cell suspension (2> ⁇ 10 4 cells/well) was seeded into 96-well plate and incubated for 4 hours in assay medium (RPMI 1640 supplemented with 10% FBS and 1% NEAA) for cytokine starvation at 37°C and 5% CO2.
  • IL-15 and purified proteins samples used in assays were prepared in assay medium to an initial concentration of 300 nM, followed by 1/3 serial dilutions. 10m1 diluted protein was added into corresponding wells and incubated at 37°C and 5% CO2 for 72 hours. Colorimetric assays using a Cell Counting Kit-8 (CCK-8, Dojindo, CK04) were performed to measure the amount of live cells and the results are shown in Figures 13A and 13C.
  • PI 186 SEQ ID NO 17
  • P1331 SEQ ID NO: 73
  • P1333 SEQ ID NO: 75
  • Proliferation assay was also performed using human peripheral blood mononuclear cells (PBMCs) for a few purified fusion proteins. Human PBMCs were prepared by Ficoll centrifugation and stained with 5-(6)-carboxy-fluorescein succinimidyl ester (CFSE, Thermofisher, Cat# C34554) according to the manufacturer’s instructions.
  • PBMCs peripheral blood mononuclear cells
  • EXAMPLE 2 Engineering of Fc-IL-15-linker-IL-15Rq fusion proteins with protease cleavage site in the linker between Fc and IL-15
  • TEV protease cleavage site was used to prove the concept and introduced into the linker between Fc and IL-15 of Fc-ILR constructs.
  • Plasmids coding for Fc-TEV-ILR were constructed by standard gene synthesis and sub-cloned into pTT5 expression vector with different lengths of linker flanking TEV cleavage site.
  • Cartoon schematics of illustrative Fc-TEV-ILR fusion protein format are depicted in Figure 6.
  • Illustrative proteins of Fc-TEV-ILR format include P1256 (SEQ ID NO: 26), P1261 (SEQ ID NO: 32), P1281 (SEQ ID NO: 43), P1282 (SEQ ID NO: 49), P1283 (SEQ ID NO: 55), P1284 (SEQ ID NO: 61) and P1285 (SEQ ID NO: 67).
  • IL-15/IL-15Ra complex To form tighter IL-15/IL-15Ra complex, a disulfide bond was introduced between IL-15 and IL-15Ra with L52C mutation on IL-15 and S40C mutation on IL-15Ra.
  • Illustrative proteins of this format include P1378 (SEQ ID NO: 226) and P1379 (SEQ ID NO: 232).
  • PSs real protease cleavage sites
  • Plasmids coding for Fc-PSs-ILR were constructed by standard gene synthesis and sub-cloned into pTT5 expression vector with linker flanking protease cleavage sites.
  • Cartoon schematics of illustrative Fc-PSs-ILR fusion protein format are depicted in Figure 6.
  • Illustrative proteins of Fc-PSs-ILR format include P1334 (SEQ ID NO: 76), P1335 (SEQ ID NO: 87), P1336 (SEQ ID NO: 98), P1337 (SEQ ID NO: 114), P1338 (SEQ ID NO: 130), P1339 (SEQ ID NO: 146), P1340 (SEQ ID NO: 162), P1341 (SEQ ID NO: 178), P1342 (SEQ ID NO: 194), P1343 (SEQ ID NO: 210), P1380 (SEQ ID NO: 238), P1381 (SEQ ID NO: 254), P1382 (SEQ ID NO: 270), PI 383 (SEQ ID NO: 286), PI 423 (SEQ ID NO: 338), PI 424 (SEQ ID NO: 339), P1425 (SEQ ID NO: 340), P1426 (SEQ ID NO: 341), P1427 (SEQ ID NO: 342) and P1428 (SEQ ID NO
  • Fc fusion proteins were produced, purified and characterized as described in Example 1.
  • Purified Fc-PSs-ILR proteins were tested for protease cleavage assays by protease uPA(R&D, Cat# 1310-SE-010), matriptase (R&D, Cat# 3946-SEB-010), legumain (R&D, Cat# 2199-CY-OlO), MMP-2 (R&D, Cat# 902-MP-010) and MMP-9 (R&D, Cat# 911-MP-010) respectively and the results are shown in Figures 16A-16G.
  • the purified proteins could be cleaved completely or partially by the above proteases.
  • TEV protease cleavage site was used to prove the concept and introduced into the linker between IL-15 and IL-15Ra of Fc-ILR constructs.
  • Plasmids were constructed using the same method as described in Example 2. Cartoon schematics of illustrative Fc-ILR fusion protein format are depicted in FIG. 8. Illustrative proteins of Fc-IL-15 (S162A)-TEV-IL-15Ra format include PI 393 (SEQ ID NO: 302), P1394 (SEQ ID NO: 308) and P1395 (SEQ ID NO: 314).
  • Illustrative proteins of Fc-IL-15 (S162A, L52C)-TEV-IL-15Ra (S40C) format include P1396 (SEQ ID NO: 320), P1397 (SEQ ID NO: 326) and P1398 (SEQ ID NO: 332).
  • Fc fusion proteins were produced, purified and characterized as described in Example 1.
  • Illustrative proteins of Fc-PS-IL-15-stable linker-IL-15Ra include P1423, PI 424, P1425, P1426, P1427, P1428, P1471, P1472, P1473, P1474, P1475, P1476, P1477,
  • Illustrative proteins of Fc-PS-IL-15mut-stable linker-IL-15Ra include P1652, P1653, P1654, P1655, P1656 and P1657.
  • Illustrative proteins of Fc-PS-IL-15-stable linker-IL-15Ra with optimized codon for IL-15 and IL-15Ra include PI 660, PI 661 and PI 663.
  • Illustrative proteins of Fc-PS-IL-15-stable linker-IL-15Ra with different stable linker length include P2162, P2163, P2164, P2165, P2166, P2167, P2168 and P2169.
  • Illustrative proteins of Fc-stable linker-IL-15-PS-IL-15Ra include P1542, P1636, PI 696, P1697, P1698, P1699, P1700, P1701, P1702, P1703, P1704, P1705, P1706 and P1707.
  • Illustrative proteins of Fc-stable linker-IL-15-PS-IL-15Ra with disulfide bond between two IL-15Ra molecules include PI 973, PI 974 and PI 975.
  • Illustrative proteins of Fc-PS-IL-15-stable linker-IL-15Ra-sushi include P1682 and P1683.
  • Fc fusion proteins were produced, purified and characterized as described in Example 1. Representative SDS-PAGE and HPLC results are summarized in Figures 23 A- 23F, Figures 24A-24F, and Figures 25A-25X. Purified proteins showed good purity based on the SDS-PAGE results. Most of the purified proteins showed good homogeneity based on the HPLC results. Dimer and/or polymer were observed for the fusion proteins with shorter linker between IL-15 and IL-15Ra, e.g. P2163, P2164, P2166 and P2167.
  • Protein in vitro serum stability was tested in serum from human, cyno, mouse and rat. Equivalent amounts of protein were incubated with fresh serum at 37°C for different times. Protein was run on 12% SDS-PAGE gel and transferred to nitrocellulose membrane. Membranes were blocked with non-fat dry milk or BSA in TBST, probed with biotinylated anti-IL-15 antibody (R&D, Cat# BAF247), and subsequently probed with streptavidin-HRP. Alternatively, membranes were probed with HRP-anti-human IgG antibody. Representative western blot results are shown in Figures 29A-29F.
  • IL-15 prodrug was fused onto the C-terminal of anti-FAP antibody with protease cleavable sequence between Fc and IL-15 or/and with cleavable protease sequence between IL-15 and IL-15Ra. Plasmids coding anti-FAP-IL-15 prodrug was synthesized by standard gene synthesis and sub-cloned into pTT5 vector.
  • Illustrative proteins with protease cleavage site between Fc and IL-15 include P15431450 and P16401450.
  • Illustrative proteins with protease cleavage site between IL-15 and IL-15Ra include P18121450, P18131453, P18141563, P18151450, P18161453, P18171563, P19681450 and P19691450.
  • Illustrative proteins with protease cleavage site between Fc and IL-15 and with protease cleavage site between IL-15 and IL-15Ra include P24872158, P24882158, P24892158, P24902158, P24912158, P25162158 and P25172158.
  • Anti-FAP-IL-15 fusion proteins were produced, purified and characterized as described in Example 1. Representative SDS-PAGE and HPLC results were summarized in Figures 30A-30B and Figures 31A-31F. Purified proteins showed good purity based on the SDS-PAGE results. Most of the purified proteins showed good homogeneity based on the HPLC results.
  • Fc-IL-15-IL-15Ra backbone 1 (SEQ ID NO: 8)
  • Fc-IL-15-IL-15Rg backbone 2 (SEQ ID NO: 9)
  • Fc-IL-15-IL-15Rg backbone 3 (SEQ ID NO: 10)
  • Fc-IL-15-IL-15Rg backbone 4 (SEQ ID NO: 11)
  • IL-15 (L52C) - (GGS) 5-IL-15Rg (S40C) (SEQ ID NO: 13)
  • IL-15- (GGS) 5-IL-15Rg-G4S-HHHHHH homodimer SEQ ID NO: 16
  • IL-15- (GGS) 5-IL-15Rg-G4S-Fc homodimer SEQ ID NO: 17
  • IL-15 (S162A) - (GGS) 5-IL-15Rg-GGGGS-Fc homodimer SEQ ID NO: 23
  • GGS-IL-15- GGS-IL-15- (GGS) 5-IL-15Rg homodimer (product from complete cleavage, active) (SEQ ID NO: 28)
  • Chain 1 Fc-GS-ENLYFQG-GS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 29) [00372] EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWY
  • Chain 2 Fc-GSENLYFQ ( SEQ ID NO: 30)
  • Chain 3 GGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 31)
  • GGGGGS-IL-15- (GGS) 5-IL-15Ra homodimer (product from complete cleavage, active) (SEQ ID NO: 34)
  • Chain 1 Fc-GGGGS-ENLYFQG-GGGGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO:
  • Chain 2 Fc-GGGGSENLYFQ ( SEQ ID NO: 36)
  • Chain 3 GGGGGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 37)
  • IL-15 S162A - (GGS) 2-EPKSSDKTHT- (GGS) 2-GGGS-IL-15Rg-
  • GGGGSHHHHHH SEQ ID NO: 40
  • P1276_L26R IL15-S162A
  • GGGGGSGS-IL-15- (GGS) 5-IL-15Rg homodimer (product from complete cleavage, active) (SEQ ID NO: 45)
  • Chain 1 Fc-GSGGGGS-ENLYFQG-GGGGSGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO:
  • Chain 2 Fc-GSGGGGSENLYFQ ( SEQ ID NO: 47)
  • Chain 3 GGGGGSGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 48)
  • Chain 1 Fc-GGGSGGGGS-ENLYFQG-GGGGSGGGS-IL-15- (GGS) 5-IL-
  • Chain 2 Fc-GGGSGGGGSENLYFQ ( SEQ ID NO: 53)
  • Chain 3 GGGGGSGGGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 54) [00428] GGGGGSGGGSNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLE
  • Chain 1 Fc-GSGGGSGGGGS-ENLYFQG-GGGGSGGGSGS-IL-15- (GGS) 5-IL-
  • Chain 2 Fc-GSGGGSGGGGSENLYFQ (SEQ ID NO: 59)
  • Chain 3 GGGGGSGGGSGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 60)
  • Chain 1 Fc-GGGSGGGSGGGGS-ENLYFQG-GGGGSGGGSGGGS-IL-15- (GGS) 5-
  • Chain 2 Fc-GGGSGGGSGGGGSENLYFQ (SEQ ID NO: 65)
  • Chain 3 GGGGGSGGGSGGGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 66)
  • Chain 1 Fc-GSGGGSGGGSGGGGS-ENLYFQG-GGGGSGGGSGGGSGS-IL-15-
  • Chain 2 Fc-GSGGGSGGGSGGGGSENLYFQ ( SEQ ID NO: 71)
  • Chain 3 GGGGGSGGGSGGGSGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 72)
  • GSLGGSGR/ SANAGS-IL-15- (GGS) 5-IL-15Ra product from partial cleavage, active )
  • Chain 1 Fc-b-GSLGGSGRSANAGS-IL-15 (S162A) - (GGS) 5-IL-15Ra (SEQ ID NO:
  • Chain 2 Fc-b-GSLGGSGR ( SEQ ID NO: 80)
  • Chain 3 SANAGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 81)
  • GSLGGSGRSAN/AGS-IL-15- (GGS) 5-IL-15Ra product from partial cleavage, active
  • Chain 1 Fc-b-GSLGGSGRSANAGS-IL-15 (S162A) - (GGS) 5-IL-15Ra (SEQ ID NO:
  • Chain 2 Fc-b-GSLGGSGRSA (SEQ ID NO: 85)
  • Chain 3 AGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 86)
  • IRDPALVHQRPAPPS [00514] Expected cleavage products from uPA or matriptase cleavage of
  • Chain 1 Fc-b-GGSLSGRSANAGGS-IL-15 (S162A) - (GGS) 5-IL-15Ra (SEQ ID NO:
  • Chain 2 Fc-b-GGSLSGR ( SEQ ID NO: 91)
  • Chain 3 SANAGGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 92)
  • GGSLSGRSAlSi/AGGS-IL-15- (GGS) 5-IL-15Ra (product from partial cleavage, active )
  • Chain 1 Fc-b-GGSLSGRSANAGGS-IL-15 (S162A) - (GGS) 5-IL-15Ra (SEQ ID NO:
  • Chain 2 Fc-b-GGSLSGRSA ( SEQ ID NO: 96)
  • Chain 3 AGGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 97)
  • Chain 1 Fc-b-GPLGLAGRSANAGS-IL-15 (S162A) - (GGS) 5-IL-15Ra (SEQ ID NO: 101)
  • Chain 3 SANAGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 103)
  • GPLGLAGRSAN/AGS-IL-15- (GGS) 5-IL-15Ra product from partial cleavage, active )
  • Chain 1 Fc-b-GPLGLAGRSANAGS-IL-15 (S162A) - (GGS) 5-IL-15Ra (SEQ ID NO:
  • Chain 2 Fc-b-GPLGLAGRSAN ( SEQ ID NO: 107) [00571] EPKSSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLYITREPEVTCVWDVSHEDPEVKFNWY
  • Chain 3 AGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 108)
  • Chain 1 Fc-b-GPLGLAGRSANAGS-IL-15 (S162A) - (GGS) 5-IL-15Ra (SEQ ID NO:
  • Chain 2 Fc-b-GPLG ( SEQ ID NO: 112) [00585] EPKSSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLYITREPEVTCVWDVSHEDPEVKFNWY
  • Chain 3 LAGRSANAGS-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 113)
  • Fc-b-PLGLSGRSANAGPA-IL-15 (S162A) - (GGS) 5-IL-15Rg (SEQ ID NO: 114)
  • Chain 1 Fc-b-PLGLSGRSANAGPA-IL-15 (S162A) - (GGS) 5-IL-15Ra (SEQ ID NO:
  • Chain 2 Fc-b-PLGLSGR ( SEQ ID NO: 118)
  • Chain 3 SANAGPA-IL-15- (GGS) 5-IL-15Ra (SEQ ID NO: 119)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Immunology (AREA)
  • Cell Biology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2019/066287 2018-12-14 2019-12-13 Il-15 compositions and methods of use thereof Ceased WO2020123980A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CA3121813A CA3121813A1 (en) 2018-12-14 2019-12-13 Il-15 compositions and methods of use thereof
JP2021534270A JP7557465B2 (ja) 2018-12-14 2019-12-13 Il-15組成物およびその使用方法
CN201980082406.XA CN114746105A (zh) 2018-12-14 2019-12-13 Il-15组合物及其使用方法
US17/413,786 US20230045048A1 (en) 2018-12-14 2019-12-13 Il-15 compositions and methods of use thereof
KR1020217018990A KR102911817B1 (ko) 2018-12-14 2019-12-13 Il-15 조성물 및 이의 사용 방법
AU2019395266A AU2019395266A1 (en) 2018-12-14 2019-12-13 IL-15 compositions and methods of use thereof
EP19897286.1A EP3893917A4 (en) 2018-12-14 2019-12-13 IL-15 COMPOSITIONS AND METHODS OF USE THEREOF
JP2024159011A JP2024175026A (ja) 2018-12-14 2024-09-13 Il-15組成物およびその使用方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862779793P 2018-12-14 2018-12-14
US62/779,793 2018-12-14

Publications (1)

Publication Number Publication Date
WO2020123980A1 true WO2020123980A1 (en) 2020-06-18

Family

ID=71075819

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/066287 Ceased WO2020123980A1 (en) 2018-12-14 2019-12-13 Il-15 compositions and methods of use thereof

Country Status (8)

Country Link
US (1) US20230045048A1 (https=)
EP (1) EP3893917A4 (https=)
JP (2) JP7557465B2 (https=)
KR (1) KR102911817B1 (https=)
CN (1) CN114746105A (https=)
AU (1) AU2019395266A1 (https=)
CA (1) CA3121813A1 (https=)
WO (1) WO2020123980A1 (https=)

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021257808A3 (en) * 2020-06-17 2022-01-27 Proviva Therapeutics (Hong Kong) Limited Antibodies to fibroblast activation protein and b7h3
US11365233B2 (en) 2020-04-10 2022-06-21 Cytomx Therapeutics, Inc. Activatable cytokine constructs and related compositions and methods
WO2022235551A3 (en) * 2021-05-03 2022-12-22 President And Fellows Of Harvard College Fc-fusion protein therapeutic for the treatment of pancreatitis
US11667687B2 (en) 2021-03-16 2023-06-06 Cytomx Therapeutics, Inc. Masked activatable interferon constructs
EP4072593A4 (en) * 2019-12-13 2024-01-03 Cugene Inc. BIOACTIVABLE CYTOKINE DRUGS AND ASSOCIATED METHODS OF USES
US11866476B2 (en) 2018-09-27 2024-01-09 Xilio Development, Inc. Masked IL-2-Fc fusion polypeptides
WO2024054425A1 (en) * 2022-09-08 2024-03-14 Cugene Inc. Novel pd1-targeted il-15 immunocytokine and vitokine fusions
WO2024047585A3 (en) * 2022-08-31 2024-04-11 Proviva Therapeutics (Hong Kong) Limited Il-15 procytokine antibody fusion proteins
US12104178B2 (en) 2017-03-03 2024-10-01 Obsidian Therapeutics, Inc. DHFR tunable protein regulation
WO2024216170A3 (en) * 2023-04-12 2024-12-26 Cytomx Therapeutics, Inc. Activatable cytokine constructs and related compositions and methods
US12280120B2 (en) 2020-11-25 2025-04-22 Xilio Development, Inc. Tumor-specific cleavable linkers

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025085744A1 (en) * 2023-10-18 2025-04-24 Memorial Sloan-Kettering Cancer Center Fusion polypeptides and uses thereof
WO2025180355A1 (zh) * 2024-02-27 2025-09-04 江苏奥赛康生物医药有限公司 Il-15前药与免疫检查点抑制剂的组合

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130101555A1 (en) * 2009-02-23 2013-04-25 Cytomx Therapeutics, Inc. Proproteins and Methods of Use Thereof
WO2017201352A1 (en) * 2016-05-18 2017-11-23 Modernatx, Inc. Mrna combination therapy for the treatment of cancer
US20180291384A1 (en) * 2017-01-10 2018-10-11 Intrexon Corporation Modulating expression of polypeptides via new gene switch expression systems

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9912350D0 (en) * 1999-05-26 1999-07-28 European Molecular Biology Lab Embl Modified cytokine
FI117667B (fi) * 2001-07-05 2007-01-15 Univ Zuerich Farmaseuttinen koostumus, joka soveltuu käytettäväksi ortopediassa ja hammaslääketieteessä
ES2327830T3 (es) * 2002-03-29 2009-11-04 Schering Corporation Anticuerpos monoclonales humanos anti-interleuquina-5 y metodos y composiciones que los contienen.
US20110178279A1 (en) * 2009-08-03 2011-07-21 Williams John C Development of masked therapeutic antibodies to limit off-target effects: application to anti-egfr antibodies
US20100189651A1 (en) * 2009-01-12 2010-07-29 Cytomx Therapeutics, Llc Modified antibody compositions, methods of making and using thereof
GB201203442D0 (en) * 2012-02-28 2012-04-11 Univ Birmingham Immunotherapeutic molecules and uses
WO2016004383A1 (en) * 2014-07-03 2016-01-07 City Of Hope Tumor-selective ctla-4 antagonists
WO2016210447A1 (en) * 2015-06-26 2016-12-29 University Of Southern California Masking chimeric antigen receptor t cells for tumor-specific activation
CN110214147A (zh) * 2016-10-14 2019-09-06 Xencor股份有限公司 IL15/IL15Rα异源二聚体FC-融合蛋白

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130101555A1 (en) * 2009-02-23 2013-04-25 Cytomx Therapeutics, Inc. Proproteins and Methods of Use Thereof
WO2017201352A1 (en) * 2016-05-18 2017-11-23 Modernatx, Inc. Mrna combination therapy for the treatment of cancer
US20180291384A1 (en) * 2017-01-10 2018-10-11 Intrexon Corporation Modulating expression of polypeptides via new gene switch expression systems

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
See also references of EP3893917A4 *
VAMOSI ET AL.: "IL -2 and IL -15 receptor a-subunits are coexpressed in a supramolecular receptor cluster in lipid rafts of T cells", PNAS, vol. 101, no. 30, 27 July 2004 (2004-07-27), pages 11082 - 11087, XP055719140 *

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12104178B2 (en) 2017-03-03 2024-10-01 Obsidian Therapeutics, Inc. DHFR tunable protein regulation
US11866476B2 (en) 2018-09-27 2024-01-09 Xilio Development, Inc. Masked IL-2-Fc fusion polypeptides
EP4072593A4 (en) * 2019-12-13 2024-01-03 Cugene Inc. BIOACTIVABLE CYTOKINE DRUGS AND ASSOCIATED METHODS OF USES
US12091442B2 (en) 2020-04-10 2024-09-17 Cytomx Therapeutics, Inc. Activatable cytokine constructs and related compositions and methods
US11365233B2 (en) 2020-04-10 2022-06-21 Cytomx Therapeutics, Inc. Activatable cytokine constructs and related compositions and methods
WO2021257808A3 (en) * 2020-06-17 2022-01-27 Proviva Therapeutics (Hong Kong) Limited Antibodies to fibroblast activation protein and b7h3
US12280120B2 (en) 2020-11-25 2025-04-22 Xilio Development, Inc. Tumor-specific cleavable linkers
US11667687B2 (en) 2021-03-16 2023-06-06 Cytomx Therapeutics, Inc. Masked activatable interferon constructs
WO2022235551A3 (en) * 2021-05-03 2022-12-22 President And Fellows Of Harvard College Fc-fusion protein therapeutic for the treatment of pancreatitis
US20240182537A1 (en) * 2022-08-31 2024-06-06 Proviva Therapeutics (Hong Kong) Limited Il-15 procytokine antibody fusion proteins
WO2024047585A3 (en) * 2022-08-31 2024-04-11 Proviva Therapeutics (Hong Kong) Limited Il-15 procytokine antibody fusion proteins
WO2024054425A1 (en) * 2022-09-08 2024-03-14 Cugene Inc. Novel pd1-targeted il-15 immunocytokine and vitokine fusions
WO2024216170A3 (en) * 2023-04-12 2024-12-26 Cytomx Therapeutics, Inc. Activatable cytokine constructs and related compositions and methods

Also Published As

Publication number Publication date
EP3893917A1 (en) 2021-10-20
US20230045048A1 (en) 2023-02-09
EP3893917A4 (en) 2023-01-11
CA3121813A1 (en) 2020-06-18
JP2022513888A (ja) 2022-02-09
CN114746105A (zh) 2022-07-12
KR20210104060A (ko) 2021-08-24
AU2019395266A1 (en) 2021-06-17
KR102911817B1 (ko) 2026-01-14
JP7557465B2 (ja) 2024-09-27
JP2024175026A (ja) 2024-12-17

Similar Documents

Publication Publication Date Title
JP7557465B2 (ja) Il-15組成物およびその使用方法
JP7631420B2 (ja) ヒトニューレグリン-1(nrg-1)組換え型融合タンパク質組成物及びその使用方法
CA3245956A1 (en) METHODS FOR TREATING FIBROSIS AND ARRHYTHMIA WITH A NEREGULIN-1 FUSION PROTEIN
US20240254184A1 (en) Il-15 fusion proteins and methods of making and using the same
HK40106026A (en) Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
HK40098241A (zh) Il-15融合蛋白以及制备和使用其的方法
EA052095B1 (ru) Композиции на основе рекомбинантного слитого белка, содержащего нейрегулин-1 (nrg-1) человека, и способы их применения
HK40044003A (en) Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
HK40044003B (en) Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19897286

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3121813

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021534270

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019395266

Country of ref document: AU

Date of ref document: 20191213

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20217018990

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019897286

Country of ref document: EP

Effective date: 20210714

WWW Wipo information: withdrawn in national office

Ref document number: 776555

Country of ref document: NZ