WO2020109642A1 - Myticin peptide and its use in cell regeneration - Google Patents
Myticin peptide and its use in cell regeneration Download PDFInfo
- Publication number
- WO2020109642A1 WO2020109642A1 PCT/ES2019/070815 ES2019070815W WO2020109642A1 WO 2020109642 A1 WO2020109642 A1 WO 2020109642A1 ES 2019070815 W ES2019070815 W ES 2019070815W WO 2020109642 A1 WO2020109642 A1 WO 2020109642A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- peptide
- wound
- fusion protein
- cell
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
Definitions
- Miticin peptide and its use in cell regeneration The present invention relates to peptides that comprise the sequence SEQ ID NO: 2 and their therapeutic uses, specifically in cell and / or tissue regeneration.
- Antimicrobial peptides are innate immune effectors and have a wide range of actions against many microorganisms.
- AMRs are the main elements of the immune response.
- mytilus galloprovincialis several types of AMR have been described, including miticin C.
- Miticin C is a cysteine-rich antimicrobial peptide isolated from hemocytes of the mussel Mytilus galloprovincialis whose antibacterial and chemotactic activity has been tested in vitro (Martinez-Lopez et al., Mar Drugs. 11 (7): 2328 - 46 (2013)). Its antiviral effect has also been demonstrated not only against mollusc viruses, such as the oyster herpervirus OsHV-1, but also against human herpes simplex (HSV-1 and HSV-2) (Novoa B., et al., J Virol. 90 (17): 7692-702 (2016)) and against pathogenic fish rhabdoviruses (Balseiro P. et al., PLoS One. 6 (8): e23140 (2011)).
- wounds During the life of any animal, wounds inevitably occur, and can be the consequence of a wide variety of events, such as contact with sharp or hot objects, or appear in certain clinical disorders, such as diabetes.
- Another important clinical example is the development of pressure ulcers, that is, injuries caused by unmitigated pressure on any part of the body, especially portions on bony or cartilaginous areas.
- the skin is a vital organ that fulfills multiple functions, such as sensory functions, protective functions against external aggressions, as well as immunological, metabolic or thermoregulatory functions. These roles are possible due to the complex structure that associates various tissues.
- the skin consists of three distinct overlapping layers: the epidermis, the dermis, and the hypodermis.
- the epidermis is a lining epithelium, which constitutes the external structure of the skin and provides its protective function. This function is provided by the cohesion of the epithelial cells and by the production of a resistant and filamentous protein, keratin.
- wound healing is described as consisting of three phases, namely, the inflammatory phase, the proliferative phase, and the maturation phase (termed acute inflammatory phase, synthesis of extracellular and collagen matrix, and remodeling).
- the sequence of the healing process begins during an acute inflammatory phase with the deposit of provisional tissue. This is followed by reepitalization, collagen synthesis and deposition, fibroblast proliferation, and neovascularization, all of which ultimately define the remodeling phase.
- the inflammatory phase is characterized by hemostasis and inflammation.
- the collagen exposed during wound formation activates the coagulation cascade (both the intrinsic and extrinsic pathways), initiating the inflammatory phase.
- Platelets the first response cell, release multiple chemokines that help stabilize the wound by forming a clot. These mediators act to control bleeding and limit the extent of the injury.
- the second response cell that migrates to the wound, neutrophils are responsible for debris uptake, complement-mediated opsonization of bacteria, and destruction of bacteria by oxidative burst mechanisms (i.e., formation of superoxide and peroxide. hydrogen).
- Macrophages are essential for wound healing. Numerous enzymes and cytokines are secreted by macrophages, which marks the transition to the tissue reconstruction process, that is, the proliferative phase.
- epithelialization During the proliferative phase, epithelialization, angiogenesis, granulation tissue formation, and collagen deposition are the main stages in the healing of wounds. Epithelialization appears at an early stage of wound repair. Angiogenesis, stimulated, for example, by TNF-alpha, is noted by endothelial cell migration and capillary formation. The new capillaries transport nutrients to the wound and help maintain the bed of granulation tissue. The final part of the proliferative phase is the formation of granulation tissue. Fibroblasts differentiate and produce basal substance and then collagen. The basal substance is deposited in the wound bed; the collagen is then deposited as the wound undergoes the final phase of repair. Many different cytokines, including PDGF, insulin-like growth factor (IGF), and EGF, are involved in the proliferative phase of wound repair. During the maturation phase, the wound undergoes a contraction that ultimately results in less scar tissue being seen.
- IGF insulin-like growth factor
- patent EP0575484 discloses a pharmaceutical composition for the regeneration and repair of mammalian tissues, which includes PDGF and dexamethasone.
- miticin-C (QSVACRSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR, SEQ ID NO: 1) is expressed in response to injury or tissue damage, thus enhancing cell regeneration and tissue repair after damage.
- the role of miticin-C in cell regeneration was demonstrated by an in vitro assay using cells from human keratinocytes (HaCat line), and by an in vivo test using zebrafish larvae (Danio rer ⁇ o). In both cases, it was seen that the wound healed faster in the presence of miticin-C than, in its absence, thus promoting healing and repairing tissue damage (see Example 1, Figures 1 and 2).
- the inventors designed a library of overlapping short small peptides from the amino acid sequence of miticin-C (see Table 1), in order to identify that minimum sequence necessary for miticin-C to play its role. in cellular and / or tissue regeneration.
- the inventors observed that some peptides named P1 to P4 were able to repair the wound or damage generated.
- These peptides present the consensus SYYCSK sequence (SEQ ID NO: 2), this being therefore the amino acid sequence responsible for carrying out the best regeneration rates after 48 hours.
- amino acids F and C are added at the carboxyl terminus, they show an improvement in total wound healing at 72 h, SYYCSKFC (SEQ ID NO: 3), as can be seen in Figure 3 with the peptides called P2b, P3 and P4.
- the present invention relates to a peptide comprising at least 80% identity with the SYYCSK sequence (SEQ ID NO: 2), preferably having a size of between 6 to 99 amino acids, and not is miticin-C with sequence SEQ ID NO: 1, preferably the peptide comprises at least 80% identity with the sequence SYYCSKFC (SEQ ID NO: 3), which preferably has a size between 6 to 99 amino acids, and that it is not miticin-C with sequence SEQ ID NO: 1.
- SYYCSK sequence SEQ ID NO: 2
- SEQ ID NO: 3 sequence that it is not miticin-C with sequence SEQ ID NO: 1.
- peptide refers to a molecule formed by the binding, in a defined order, of alpha-amino acids via a peptide bond. It will be understood that the terms “peptide bond”, “peptide”, “polypeptide” and protein are known to those skilled in the art. Hereinafter, “peptide” and “polypeptide” will be used interchangeably.
- the peptide of the invention can be obtained by techniques widely known in the state of the art, such as chemical synthesis, genetic recombination, expression of the polynucleotide that encodes the polypeptide of the invention, etc. All of these techniques are routine practice for the person skilled in the art. Additionally, the carboxyl and amino terminal ends of the peptide of the invention can be protected against proteolysis. For example, the amino terminal end may be in the form of an acetyl group (Ac) and / or the carboxyl terminal end may be in the form of an amide group (Am). It is also possible to carry out internal modifications of the peptides so that they are resistant to proteolysis.
- All of these peptides chemically modified to resist proteolysis are also contemplated within the present invention. Additional modifications to the peptide of the invention include covalent attachment to a polyethylene glycol (PEG) molecule by its carboxyl terminus or to a lysine residue, in order to decrease its urinary elimination and therapeutic dose, and to increase the half-life of the peptide in blood plasma.
- the half-life of the peptide can also be increased by including the peptide in a biodegradable and biocompatible polymeric material to form microspheres that are used as a drug delivery system.
- Polymers and copolymers include, without limitation, poly (D, L-lactide-co-glycolic) or PLGA. The techniques and procedures of how to manufacture lipid microspheres or nanocapsules for use in drug administration are widely known to the person skilled in the art.
- the peptide of the invention comprises at least 80% identity with the sequence SEQ ID NO: 2, preferably at least 80% identity with the sequence SEQ ID NO: 3.
- identity is understood or “sequence identity” to the degree of similarity between two nucleotide or amino acid sequences obtained by aligning the two sequences. Depending on the number of common residues between the aligned sequences, a degree of identity expressed as a percentage will be obtained.
- the degree of identity between two amino acid sequences can be determined by conventional methods, for example, by standard sequence alignment algorithms known in the state of the art, such as BLAST.
- BLAST programs eg BLASTN, BLASTX, and TBLASTX, BLASTR and TBLASTN
- NBI National Center for Biotechonology Information
- the peptide of the invention comprises an identity of at least 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% with the sequence SEQ ID NO: 2 or SEQ ID NO: 3.
- the peptide of the invention comprises a sequence identity of 100% with the sequence SEQ ID NO: 2 or from SEQ ID NO: 3.
- Assays to identify peptides functionally equivalent to the peptide of the invention can be found in the Example of the present description.
- the peptide of the invention refers to a peptide comprising the sequence SEQ ID NO: 2, preferably SEQ ID NO: 3, which can be between 6 and 99 amino acids in size, and which does not it is miticin-C with the sequence SEQ ID NO: 1.
- the peptide of the invention has a size of between 6 and 99 amino acids, preferably between 6 and 50, more preferably between 6 and 40. In a more particular embodiment, it has a size of between 6 and 25 amino acids, and in another still more particular embodiment, between 6 and 20 amino acids or between 6 and 15 amino acids. In another even more particular embodiment, the peptide of the invention has a size of 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids.
- the peptide of the invention refers to a peptide comprising the sequence QSVACRSYYCSK (SEQ ID NO: 4), VACRSYYCSKFC (SEQ ID NO: 5), CRSYYCSKFCGS (SEQ ID NO: 6) or SYYCSKFCGSAG (SEQ ID NO: 7).
- the peptide of the invention refers to a peptide consisting of the sequence SYYCSK (SEQ ID NO: 2), SYYCSKFC (SEQ ID NO: 3), QSVACRSYYCSK (SEQ ID NO: 4), VACRSYYCSKFC (SEQ ID NO: 5), CRSYYCSKFCGS (SEQ ID NO: 6) or SYYCSKFCGSAG (SEQ ID NO: 7). More preferably the peptide consists of the sequence VACRSYYCSKFC (SEQ ID NO: 5), CRSYYCSKFCGS (SEQ ID NO: 6), or SYYCSKFCGSAG (SEQ ID NO: 7).
- the peptides of the invention may be protected against proteolysis, particularly the peptide of the invention refers to a peptide comprising the sequence SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 , SEQ ID NO: 11 or SEQ ID NO: 12.
- fusion protein of the invention relates to a fusion protein comprising the peptide of the invention, hereinafter "fusion protein of the invention”.
- fusion protein refers to an artificially designed polypeptide chain comprising two or more amino acid sequences of different origins, natural and / or artificial. Fusion protein, by definition, is never found in nature as such.
- the fusion protein of the invention can be obtained by any suitable technique that allows obtaining peptides in a single polynucleotide chain.
- suitable techniques include recombinant techniques, where a gene construct encoding the fusion protein is introduced into a suitable vector for expression in a suitable expression system, and protein ligation techniques that involve the formation of a peptide bond between two polypeptides, such as native chemical ligation or expressed protein ligation.
- the fusion protein of the invention may further comprise an N-terminal signal peptide domain, which enables processing, eg, extracellular secretion, in a suitable host cell.
- the N-terminal signal peptide domain comprises a protease, eg, a signal peptidase cleavage site, and therefore can be removed after or during expression to obtain the mature protein.
- the fusion protein may comprise a domain of recognition / purification, eg, an Estrep brand domain and / or a poly-His domain, which may be located at the N-terminus or the C-terminus.
- the fusion protein of the invention may further comprise a flexible C-terminal element, having a length of, for example, 1-50, preferably 10-30 amino acids that can include and / or connect to a recognition domain / purification as described in this document.
- the peptide of the invention can be linked to other amino acid sequences through a linker, which can be flexible.
- both the peptide and the protein of the invention can be contained in a nanoparticle for better administration, conservation, etc.
- the present invention relates to a nanoparticle comprising the peptide or fusion protein of the invention.
- nanoparticle refers to any material having dimensions in the range of from 1 to 1,000 nm. In some embodiments, the nanoparticles have dimensions in the range of 2-200 nm, preferably in the range of 2-150 nm, and even more preferably in the range of 2-100 nm. Nanoparticles can help preserve the integrity of the peptide or fusion protein in biological fluids until it reaches the target organ. Finally, nanoparticles can also be modified to target the nanoparticle to an organ of interest, by adding ligands without compromising the ability of the nanoparticles to deliver their peptide payloads. This is contemplated to allow delivery to specific cells, tissues, and organs.
- the targeting specificity of ligand-based delivery systems is based on the distribution of ligand receptors in different cell types.
- the targeting ligand can be non-covalently or covalently associated with a nanoparticle, and can be conjugated to the nanoparticles by a variety of methods.
- Suitable nanoparticles that can be used in the context of the present invention include nanoscale materials such as a lipid based nanoparticle, a superparamagnetic nanoparticle, a nano helix, a semiconductor nanocrystal, a quantum dot, a polymer based nanoparticle, a silicone based nanoparticle , a silica-based nanoparticle, a metal-based nanoparticle, a fullerene and a nanotube.
- nanoscale materials such as a lipid based nanoparticle, a superparamagnetic nanoparticle, a nano helix, a semiconductor nanocrystal, a quantum dot, a polymer based nanoparticle, a silicone based nanoparticle , a silica-based nanoparticle, a metal-based nanoparticle, a fullerene and a nanotube.
- the peptide of the invention or the protein of the invention can also be contained within a particle. Therefore, in another aspect, the invention relates to a virus-like particle comprising the peptide or the fusion protein.
- virus-like particle also called “VLP” refers to non-infectious virus-like particles that do not contain any viral genetic material. VLPs are the result of the expression of viral structural proteins, such as capsid proteins and their self-assembly.
- the VLP may comprise, or alternatively consist of, structural proteins of Parvovirus, Rotavirus; Norwalk virus structural proteins; alphavirus structural proteins; foot-and-mouth disease virus structural proteins; measles virus structural proteins, Sindbis virus structural proteins, structural proteins of Hepatitis B virus retrovirus structural proteins (eg, an HBcAg); structural proteins of the tobacco mosaic virus; structural proteins of the FlockHouse virus; structural proteins of human papillomavirus; polyoma virus structural proteins; Bacteriophage structural proteins, RNA phage structural proteins.
- the peptide or fusion protein of the invention couples or binds to the capsid of the virus-like particle.
- the binding of the peptide or fusion protein to the capsid can be by a covalent or non-covalent bond.
- the peptide of the invention can be obtained by techniques widely known in the state of the art, such as the expression in a cell of the poiinucleotide that encodes the polypeptide of the invention, or the protein of the invention, and its subsequent isolation. Therefore, in another aspect, the invention relates to a poiinucleotide, hereinafter "poiinucleotide of the invention", which encodes the peptide of the invention or the fusion protein of the invention.
- the polynucleotides can contain deoxyribonucleotides, ribonucleotides and / or their analogs. Nucleotides can have any three-dimensional structure and can perform any function, known or unknown.
- polynucleotide includes, for example, single-stranded, double-stranded, and triple helix molecules, a gene or gene fragment, exons, introns, mRNAs, tRNAs, rRNAs, ribozymes, cDNAs, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, DNA isolated from any sequence, RNA isolated from any sequence, nucleic acid probes and primers.
- a nucleic acid molecule of the present invention may also comprise modified nucleic acid molecules.
- mRNA refers to an RNA that can be translated into a cell.
- the polynucleotide of the invention is an mRNA.
- the mRNA can be chemically synthesized, can be obtained by in vitro transcription, or can be synthesized in vivo in the target cell.
- the nucleotide sequences that make up the nucleic acid encoding the conjugate or fusion protein of the invention are in the same correct reading frame for expression thereof.
- the polynucleotide encoding the peptide or fusion protein of the invention may have various modifications made to the coding region as long as the amino acid, peptide or fusion protein sequence does not change, due to degeneration of the codons. , or taking into consideration the codons preferred by the organism in which they are to be expressed and various modifications or alterations can be introduced even in different regions of the coding region, as long as they do not influence the expression of the gene.
- an expression vector comprises, in addition to the polynucleotide encoding the peptide of the invention or the fusion protein of the invention, a promoter that directs its transcription (for example, pT7, plac, ptrc, ptac, pBAD, ret, etc.), to which it is operatively linked, and other necessary or appropriate sequences that control and regulate said transcription and, where appropriate, the translation of the product of interest, for example, transcription start and end signals (tlt2, etc.).
- a promoter that directs its transcription
- expression vectors can be selected according to the conditions and needs of each specific case among expression plasmids, viral vectors (DNA or RNA), cosmids, artificial chromosomes, etc. they may also contain markers usable for selecting cells transfected or transformed with the gene or genes of interest. The choice of vector will depend on the host cell and the type of use to be made.
- said vector can be a viral vector (adenovirus, adenovirus-associated virus as well as retrovirus and, in particular, lentivirus) or non-viral (pcDNA3, pHCMV / Zeo, pCR3.1, pEFI / His, pIND / GS, pRc / HCMV2, pSV40 / Zeo2, pTRACER-HCMV, pUB6 / V5-His, pVAXI, pZeoSV2, pCI, pSVL and pKSV-10, pBPV-1, pML2d and pTDTI).
- Said vectors can be administered directly to the subject by conventional methods.
- said vectors can be used to transform, transfect or infect cells, for example, mammalian cells, ex vivo, and subsequently implant them in the animal body to obtain the desired therapeutic effect.
- said cells will be formulated in a suitable medium that does not adversely affect the viability of said cells.
- Obtaining said vector can be carried out by conventional methods known to those skilled in the art, as well as by using different widely known methods for the transformation of microorganisms and eukaryotic cells.
- the invention in another aspect, relates to a gene construct, hereinafter "gene construct of the invention", comprising the polynucleotide of the invention.
- the gene construct of the invention comprises the polynucleotide of the invention operatively linked to expression regulatory sequences of the polynucleotide of the invention.
- any promoter can be used in the gene constructs of the present invention, as long as said promoter is compatible with the cells in which it is desired to express the polynucleotide.
- a promoter, or promoter region is a nucleotide sequence that controls the transcription of a given gene (nucleotide sequences). In the present invention it refers to a nucleotide sequence that controls the transcription of the polynucleotide of the invention.
- Promoter sequences can be unidirectional or bidirectional. A unidirectional promoter is one that controls the transcription of one gene or more genes that are in tandem with the first one. "Tandem" refers to the 3 'end of the first gene being followed, either consecutively or separated by a certain nucleotide sequence, at the 5 'end of the second gene.
- a bidirectional promoter refers to the promoter region that controls transcription in two opposite directions, that is, that a bidirectional promoter directs the transcription of two genes located divergently, that is, in the opposite direction, the 5 'end of both sequences being nucleotide closer to each other than the 3 'end.
- promoter and “promoter region” are used interchangeably.
- the promoters in the present invention can be either constitutive or inducible.
- inducible refers to the possibility that the promoter has a control element that allows to activate or deactivate (repress) the transcription of the gene that it regulates, in the presence of a external factor to the promoter.
- the gene construct of the invention may contain labels or tags that allow the isolation of the peptide of the invention once it is synthesized in the cell.
- the polynucleotide or the gene construct of the invention may be part of a vector.
- the invention relates to a vector, hereinafter "vector of the invention", comprising the polynucleotide or the gene construct of the invention.
- vector refers to a nucleic acid sequence that comprises the necessary sequences so that upon transcription and translation of those sequences into a cell, a polypeptide encoded by the nucleic acid of the invention. Said sequence is operatively linked to additional segments that provide its autonomous replication in a host cell of interest.
- the vector is an expression vector, which is defined as a vector that, in addition to the regions of autonomous replication in a host cell, contains regions operatively linked to the nucleic acid of the invention and that are capable of enhancing the expression of the nucleic acid products according to the invention.
- the vectors of the invention can be obtained by means of techniques widely known in the state of the art. The person skilled in the art will appreciate that there is no limitation as to the type of vector that can be used, since said vector can be a cloning vector suitable for propagation or an expression vector.
- suitable vectors include, without limitation, (i) prokaryotic expression vectors such as pUC18, pUC19, Bluescript and its derivatives, mp18, mp19, pBR322, pMB9, Col El, pCRI, RP4, phages and shuttle vectors such as pSA3 and pAT28, (ii) yeast expression vectors such as 2-micron plasmid type vectors, integration plasmids, YEP vectors, centromeric plasmids and the like, (iii) expression vectors in insect cells such as pAC series and pVL series vectors, ( ⁇ v) plant expression vectors such as pIBI series vectors, pEarleyGate, pAVA, pCAMBIA, pGSA, pGWB, pMDC, pMY, pORE and Similar and (v) superior eukaryotic cell expression vectors well based on viral vectors, including, but not limited to
- the vector of the invention can be used to transform, transfect or infect cells capable of being transformed, transfected or infected by said vector.
- Said cells can be prokaryotes or eukaryotes.
- the vector into which said DNA sequence is introduced can be a plasmid or a vector that, when introduced into a host cell, is integrated into the genome of said cell and replicates together with the chromosome / s in the / those that have been integrated. Obtaining said vector can be carried out by conventional methods known to those skilled in the art.
- the invention relates to a cell, hereinafter "cell of the invention", comprising a peptide, a fusion protein, a polynucleotide, a gene construct, or a vector according to the present invention , for which said cell has been able to be transformed, transfected or infected with the construct or vector provided by this invention.
- Transformed, transfected or infected cells can be obtained by conventional methods known to those skilled in the art, including, without limitation, electroporation, protoplast fusion, co-precipitation with calcium phosphate (CaPO 4 ) and precipitation with calcium chloride (CaCl 2 ).
- said host cell is an animal cell, preferably a mammalian cell and more preferably a human cell, transfected or infected with an appropriate vector.
- Suitable host cells for expression of the polypeptide of the invention include, but are not limited to, mammalian cells, plant cells, insect cells, fungal cells, and bacterial cells.
- Mammalian cells suitable for in the present invention include epithelial cell lines (porcine, human, etc.), osteosarcoma cell lines (human, etc.), neuroblastoma cell lines (human, etc.), epithelial carcinomas (human, etc.). .), glial cells (murine, human, etc.), liver cell lines (monkey, etc.), CHO cells (ChineseHamsterOvary), COS cells, BHK cells, HeLa cells, 911, AT1080, A549, 293 or PER.
- human ECCs 5 NTERA-2 cells human ECCs 5 NTERA-2 cells, mESC line D3 cells, human embryonic stem cells such as HS293 and BGV01, SHEF1, SHEF2 and HS181, NIH3T3, 293T, REH and MCF-7 cells and hMSCs cells (human mesenchymalstemcells ), and GliNS2 cells (glioma stem cells).
- human embryonic stem cells such as HS293 and BGV01, SHEF1, SHEF2 and HS181, NIH3T3, 293T, REH and MCF-7 cells and hMSCs cells (human mesenchymalstemcells ), and GliNS2 cells (glioma stem cells).
- the invention relates to a composition, preferably a pharmaceutical or cosmetic composition, comprising a therapeutically or cosmetically effective amount of the peptide, fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector or cell of the invention, and optionally a pharmaceutically or cosmetically acceptable excipient or vehicle.
- peptide, fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector, and cell of the invention have been previously defined.
- the term "pharmaceutical composition” refers to a formulation that has been adapted to administer a predetermined dose of one or more useful therapeutic agents to a cell, a group of cells, an organ, a tissue or an animal in which there is damage or injury and requires tissue and / or cell regeneration.
- the term “cosmetic composition” refers to a formulation that has been adapted to administer a predetermined dose of one or more useful cosmetic agents to a cell, a group of cells, an organ, a tissue or an animal in which there is aesthetic damage or injury and requires tissue and / or cell regeneration.
- terapéuticaally or cosmetically effective amount is understood as an amount capable of providing a therapeutic or cosmetic effect, and which can be determined by the person skilled in the art by commonly used means.
- the amount of the peptide, fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector or cell of the invention that can be included in the pharmaceutical or cosmetic compositions according to the invention will vary depending on the subject and in the particular way of the administration.
- the appropriate dose of the active ingredient (s) within the pharmaceutical or cosmetic composition will depend on the type of tissue damage to be treated, the severity and course of the disease or damage, whether the composition is administered for cosmetic, preventive or therapeutic purposes, prior therapy , patient's medical history and response to the peptide or polypeptide, and the discretion of the treating physician.
- the amount of the peptide, fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector, or cell of the invention is suitably administered to the patient or subject at one time or during a series of treatments.
- an appropriate dose level will generally be from about 0.1 to about 10 mg / kg; more preferably from about 0.5 to about 5 mg / kg, even more preferably from about 0.75 to about 2.5 mg / kg, even more preferably about 1 mg / kg, which can be administered in single or multiple doses.
- the compounds can be administered on a regimen of 1 to several times per day or for two, three, four, five, six or seven days, preferably once every other day.
- the pharmaceutical or cosmetic composition can be administered for at least 1, 2, 3, 4, 5, 6, 7, 14, 21, 28 or more days, preferably for 14 days.
- the pharmaceutical or cosmetic composition can preferably be administered once every other day for 14 days.
- compositions of the invention also contain one or more additional pharmaceutically acceptable excipients.
- pharmaceutically acceptable excipient is meant a therapeutically inactive substance that is used to incorporate the active ingredient and that is acceptable to the patient from a pharmacological / toxicological point of view and to the pharmaceutical chemist who manufactures it from a physical / chemical point of view. regarding composition, formulation, stability, patient acceptance and bioavailability.
- the excipient or vehicle also includes any substance that serves to improve the supply and efficacy of the active ingredient within the pharmaceutical composition.
- Examples of pharmaceutically acceptable carriers include one or more of the list comprising: water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, and the like, as well as combinations thereof. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances, such as wetting or emulsifying agents, preservatives, or buffers, that improve the shelf life or efficacy of the fusion protein or of the compositions that are part of the pharmaceutical compositions. Examples of suitable vehicles are well known in the literature.
- Examples of vehicles without limitation are a series of saccharides such as lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, and maltitol; a series of starches such as corn starch, wheat starch, rice starch and potato starch; a series of cellulose such as cellulose, methyl cellulose, sodium carboxymethyl cellulose and hydroxypropylmethyl cellulose; and a series of fillers such as gelatin and polyvinylpyrrolidone.
- a disintegrant such as cross-linked polyvinylpyrrolidone, agar, alginic acid, or sodium alginate can be added.
- the cosmetic composition may further comprise adjuvants, excipients and other usual additives in the cosmetic and dermatological field, such as, for example and without limitation, stabilizers, preservatives, antioxidants, solvents, perfumes, chelating agents, odor absorbers, chemical or mineral filters. , mineral pigments, organic solvents, silicones, thickeners, softeners, emulsifiers, antifoaming agents, moisturizers, fragrances, surfactants, anionic, cationic, nonionic or amphoteric polymers or their mixtures, sequestering agents, propellants, acidifying or basifying agents, dyes, colorants , pigments or nanopigments, or any other ingredient normally used in cosmetic products and compositions.
- adjuvants such as, for example and without limitation, stabilizers, preservatives, antioxidants, solvents, perfumes, chelating agents, odor absorbers, chemical or mineral filters. , mineral pigments, organic solvents, silicones, thickeners, softeners, emul
- composition of the invention may further comprise any substance that can be administered to a wound, tissue injury, or site of inflammation.
- the disclosed composition may further comprise one or more classes of antibiotics (eg aminoglycosides, cephalosporins, chloramphenicol, clindamycin, erythromycin, fluoroquinolones, macrolides, azolides, metronidazole, penicillins, tetracyclines, trimethoprim-sulfamethoxazole, vancomins) for example andrans (for example testosterone), cholestanes (for example cholesterol), colic acids (for example col ico acid), corticosteroids (for example dexamethasone), estranes (for example estradiol), pregnanes (for example progesterone), narcotic analgesics and no narcotics (eg morphine, codema, heroma, hydromorphone, levorphanol, meperidine, methadone, oxyco
- compositions of the invention can be administered by any suitable type of route, such as orally, nasally, ocularly, topically, intradermally, intracranially, or intravenously.
- suitable route of administration of such pharmaceutical compositions is the oral, nasal, ocular, topical, intracranial or intradermal route.
- Oral route is understood as the pharmaceutical composition incorporated into the body after swallowing.
- nasal route is meant the administration of the pharmaceutical composition blown into the nose.
- the “topical route” is understood as the application on the outside of the body, such as, for example, the skin, the scalp and the nails; and also the application to mucosa such as, without limitation, oral, nasal or rectal mucosa.
- “Intradermally” is understood as the administration of the pharmaceutical composition by injection into the dermis.
- “Intracranial route” is understood as the administration of the pharmaceutical composition into the skull.
- Intravenous route is understood as the administration of the pharmaceutical composition by injection into the blood stream.
- the cosmetic composition of the present invention may be presented, for example and without limitation, in the form of an aqueous, hydroalcoholic or oily solution, an oil-in-water or water-in-oil emulsion, or multiple, of an aqueous gel or oily, from an anhydrous liquid product, from an oil dispersion in an aqueous phase with the help of spheroids (such as nanospheres, nanocapsules and lipid vesicles), silicone emulsions in water, microemulsions, pastes, milks, balms, foams , lotions, creams, soaps, hydroalcoholic solutions, hydro-glycolic solutions, liniments, serums, serums, polysaccharide films, ointments, fatty ointments, mousses, ointments, gels, cream gels, foam gels, emulsion-gels and solutions.
- spheroids such as nanospheres, nanocapsules and lipid vesicles
- compositions disclosed herein are also contemplated by the present invention (eg, peptides, fusion proteins, nucleic acids, vectors, cells, polynucleotides, etc.).
- materials used to treat wounds are disclosed, in which the materials are coated with the peptide, fusion protein, nanoparticle, the virus-like particle, polynucleotide, vector, cell, or composition of the invention.
- materials used to treat wounds include bandages, surgical tape, sutures, staples, or grafts (eg, skin grafts).
- the material can be soaked in the disclosed peptide at a suitable concentration.
- the material can Then dry and seal in a sterile container.
- the peptide can also be incorporated into a crosslinkable hydrogel system, such as poly (lactic-co-glycolic acid) (PLGA) or polyurethane, which can then be designed as materials to treat wounds (eg, bandage, surgical tape, suture, staple, graft).
- PLGA poly (lactic-co-glycolic acid)
- polyurethane polyurethane
- Medical implants coated with the peptide of the invention are also disclosed prior to implantation in a subject.
- a common problem in such implant surgeries is the formation of a contraction capsule around the implant from the formation of scar tissue leading to undue hardening, contraction, and ultimately deformation of the tissue of interest.
- the use of the present polypeptides in or on the implant can reduce or prevent this deformation.
- Non-limiting examples of medical implants include: limb prostheses, breast implants, penile implants, testicular implants, artificial eyes, facial implants, artificial joints, heart valve prostheses, vascular prostheses, dental prostheses, facial prostheses, inclined disc valve , caged ball valve, hearing aid, nose prosthesis, pacemaker, cochlear implants, and skin substitutes (eg, pig / pig skin heterograft, BIOBRANE, cultured keratinocytes).
- the peptide according to the invention is coated on a medical implant or wound treatment material. Therefore, another aspect of the invention relates to a material or implant comprising the peptide, the fusion protein, the nanoparticle, the virus-like particle, the polynucleotide, the gene construct, the vector, the cell or the composition. described in the present invention.
- Another aspect of the present invention relates to the peptide, the fusion protein, the nanoparticle, the virus-like particle, the polynucleotide, the gene construct, the vector, the cell, the composition, the material or the implant of the present invention for use as a medicine.
- this aspect of the invention relates to the use of the peptide, the fusion protein, the nanoparticle, the virus-like particle, the polynucleotide, the gene construct, the vector, the cell, the composition, the material or the implant for the manufacture of a medicine.
- the present invention further provides a method of promoting wound healing after tissue injury in a subject, comprising administering to the subject one or more of the compositions of the present invention (eg, peptides, polynucleotides or vectors) in a pharmaceutically acceptable vehicle. Further disclosed is a method of treating a subject with tissue injury, comprising administering to the subject one or more of the compositions disclosed herein (eg, peptides, polynucleotides, or vectors) in a pharmaceutically acceptable vehicle.
- the compositions of the present invention eg, peptides, polynucleotides or vectors
- Promoter refers to an increase in an activity, response, status, disease, or other biological parameter. This may include but is not limited to the onset of activity, response, status, or disease. This may also include, for example, a 10% increase in activity, response, status, or disease compared to the native or control level. So the increase can be 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of increase in between compared to levels native or control.
- treating or “treating” is meant a method of reducing the effects of a disease or condition.
- Treatment may also refer to a method of reducing the underlying cause of the disease or condition itself, rather than just the symptoms.
- Treatment may be any reduction in native levels and may be but is not limited to complete suppression of the disease, condition or symptoms of the disease or condition.
- a disclosed method of promoting wound healing is considered a treatment if there is a 10% reduction in one or more symptoms of the disease in a subject with the disease compared to native levels in the same subject or control subjects. . Therefore, the reduction can be 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of reduction in between compared to native levels or control.
- subject includes, but is not limited to, animals or plants.
- the subject may be a vertebrate, more specifically a mammal (eg, a human, horse, pig, rabbit, dog, sheep, goat, non-human primate, cow, cat, guinea pig, or rodent), a fish, a bird, or a reptile or amphibian.
- the subject may be an invertebrate, more specifically an arthropod (eg, insects and crustaceans).
- arthropod eg, insects and crustaceans
- Another aspect of the present invention relates to the fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector, cell, composition, material, or implant of the present invention for its use in cellular and / or tissue regeneration, in particular for use in the treatment of a wound, preferably the wound is selected from the group consisting of a skin wound, a pressure ulcer and / or an external wound or internal.
- Another aspect of the present invention relates to cosmetic use of the fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector, cell, composition, material, or implant of the The present invention as a healing and / or skin repairing agent, preferably, the use would be in dermocosmetic treatments as a healing and skin repairing agent or in topically applied dermocosmetic compositions.
- Another aspect of the invention relates to a peptide comprising the sequence SEQ ID NO: 2, for use in cell regeneration, in particular for use in treating a wound, preferably the wound is selected from the group consisting of a skin wound, a pressure ulcer, and / or an external or internal wound. More preferably the peptide comprises the sequence SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 or SEQ ID NO: 7.
- the peptide It consists of the sequence SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, or SEQ ID NO: 7, most preferably the peptide It consists of the sequence SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 6 or SEQ ID NO: 7.
- the term "regeneration” refers to the process by which the structure and function of damaged organs or body parts are recovered.
- the regeneration process can occur at multiple states, levels of biological organization, and the ability of different organisms to regenerate missing parts is highly variable.
- Regeneration can take place at the cellular (cellular regeneration), tissue (tissue regeneration), organ, structure and even whole body levels.
- Non-limiting examples of injuries are: - a burn wound, which is the injury resulting from exposure to heat, electricity, radiation (for example, sunburn and laser surgery), or caustic chemicals,
- diabetes mellitus which are generally foot injuries due to numbness caused by nerve damage (diabetic neuropathy) and decreased blood flow to the legs and feet.
- nerve damage diabetic neuropathy
- the most serious injury is a foot ulcer.
- Diabetic foot ulcers have a very high risk of being infected, and sometimes cannot be cured. Unhealed foot ulcers are a common cause of amputation in people with diabetes,
- decubitus wounds that is, injuries caused by unmitigated pressure on any part of the body, especially portions on bony or cartilaginous areas,
- - skin wounds due to aging or the environment. This includes, for example, cracks, dry skin, roughness of the skin, and the like.
- the wounds can be an internal wound, an oral wound, a skin wound, an external wound, an ulcer and / or a pressure ulcer, damage to the eye, an eye injury, for example, conjunctiva.
- Other conditions that can be treated with the peptides according to the disclosure include oral ulcers, oral aphthous lesions, glossodynia, burning tongue, psoriasis, eczema, and hair loss.
- An internal wound is a wound present in the body, for example, due to a surgical incision.
- An oral wound is a wound present in the oral cavity.
- a skin wound is a wound on the skin.
- An external wound should be understood as a wound that is visible and accessible from outside the body.
- An ulcer is an injury to the skin surface or a mucous surface.
- a pressure ulcer is a wound or ulcer caused by prolonged pressure on the skin and tissues when in a position for a long period of time, such as lying in bed.
- the bony areas of the body are the most frequently affected sites, which become ischemic under sustained and constant pressure.
- Skin aging is the change in the appearance of the skin due to time or exposure to the environment or the state of health of an individual.
- Cellulite is the definition used in cosmetics in relation to a flabby or wavy appearance of the skin (orange peel in Dutch).
- the peptide of the invention is used for the treatment of a skin wound.
- Skin wounds can be wounds to the epidermis or dermis of the skin.
- the use of a peptide according to the invention can improve the general health of the skin.
- the method is used for the treatment of an oral wound. Oral wounds are wounds in any part of the oral cavity in which the oral mucosa is damaged.
- the peptide of the invention is used for the treatment of an internal wound.
- Internal wounds are wounds in which cell layers of endodermal or mesodermal origin are damaged. Examples are wounds in arteries or veins, peritoneum or pericardium.
- the therapeutic or cosmetic use of all those embodiments that, directly or indirectly, comprise the peptide comprising the sequence SEQ ID NO: 2, for the treatment of a skin wound as previously defined is also contemplated. in the present description. Examples of such embodiments relate to the fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector, cell, composition, material or implant comprising the peptide comprising the sequence SEQ ID NO: 2. All of these terms have also been previously defined in the present description.
- Figure 1 (A and B) Effect of the entire peptide of miticin C on wound healing in HaCat cells.
- FIG. 1 Appearance of the tail of zebrafish larvae with the tail intact.
- B Fish after sectioning off a piece of tail.
- C Evolution over time of tail tissue regeneration.
- D Comparison of tissue regeneration in fish treated and not treated with miticin after 4 days.
- Figure 4 Effect of the complete peptide of miticin on the proliferation of human keratinocyte cells (HaCat).
- the mature miticin-C (Myt-C) chain consisting of 40 amino acids with the sequence QSVACRSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR (SEQ ID NO: 1), was taken as a model for the synthesis of 14 dodecapeptides with a sequence shift of two amino acid residues and amidated at the terminal carboxyl and acetylated at the amino.
- the complete chain and the peptides thus designed were synthesized and purified by high-performance liquid chromatography (HPLC) at the Proteomics service of the National Center for Biotechnology of the CSIC with a purity of> 95%. Its sequences were verified by mass spectrometry.
- Table 1 Synthetic peptides designed from the miticin-C sequence with its molecular weight (MW).
- Example 2 Determination of the cytotoxicity of Miticin C in vitro.
- Example 3 Determination of Mythicin C wound repair activity in vitro.
- the determination of the wound repair activity in vitro was carried out using monolayers of the HaCat line of human keratinocytes.
- a “wound” was made and photographed at different times to determine the degree of its closure, in the presence and absence of miticin C peptides.
- the capacity of the miticin C peptide was confirmed (SEQ ID NO: 1) to stimulate wound healing in keratinocytes in vitro ( Figure 1).
- Cells treated with a concentration of 5 mM showed faster wound healing than control cells.
- the closure of the wound was significantly higher in the treated cells and at 72 h the wound was totally repaired unlike the control cells.
- the presence of neutrophils in the wound area was evaluated using for this the line of transgenic fish Tg (Mpx: GFP) i114, which have neutrophils labeled with GFP. In this way, the ability of miticin C in the resolution of inflammation associated with the wound was determined.
Abstract
The present invention relates to peptides derived from myticin C and to their therapeutic use, more specifically in cell and/or tissue regeneration.
Description
DESCRIPCIÓN DESCRIPTION
Péptido de miticina y su uso en regeneración celular La presente invención se refiere a unos péptidos que comprende la secuencia SEQ ID NO: 2 y sus usos terapéuticos, concretamente en la regeneración celular y/o tisular. Miticin peptide and its use in cell regeneration The present invention relates to peptides that comprise the sequence SEQ ID NO: 2 and their therapeutic uses, specifically in cell and / or tissue regeneration.
ANTECEDENTES DE LA INVENCIÓN Los péptidos antimicrobianos (AMR) son efectores inmunes innatos y tienen una amplia gama de acciones contra muchos microorganismos. En invertebrados marinos, que viven en ambientes con una abundancia de microorganismos potencialmente patógenos, los AMR son los elementos principales de la respuesta inmune. Por ejemplo, en Mejillones mediterráneos ( Mytilus galloprovincialis), se han descrito varios tipos de AMR, entre ellos la miticina C. BACKGROUND OF THE INVENTION Antimicrobial peptides (AMRs) are innate immune effectors and have a wide range of actions against many microorganisms. In marine invertebrates, living in environments with an abundance of potentially pathogenic microorganisms, AMRs are the main elements of the immune response. For example, in Mediterranean mussels (Mytilus galloprovincialis), several types of AMR have been described, including miticin C.
La miticina C (Myt-C) es un péptido antimicrobiano rico en cisteínas aislado de hemocitos del mejillón Mytilus galloprovincialis cuya actividad anti bacteriana y quimiotáctica ha sido probada in vitro (Martinez-Lopez et al., Mar Drugs. 11(7): 2328- 46 (2013)). También se ha demostrado su efecto antiviral no solo frente a virus de moluscos, como es el caso del herpervirus de la ostra OsHV-1 , sino también frente a herpes simplex de humanos (HSV-1 y HSV-2) (Novoa B., et al., J Virol. 90(17):7692- 702 (2016)) y frente a rhabdovirus patógenos de peces (Balseiro P. et al., PLoS One. 6(8):e23140 (2011)). Miticin C (Myt-C) is a cysteine-rich antimicrobial peptide isolated from hemocytes of the mussel Mytilus galloprovincialis whose antibacterial and chemotactic activity has been tested in vitro (Martinez-Lopez et al., Mar Drugs. 11 (7): 2328 - 46 (2013)). Its antiviral effect has also been demonstrated not only against mollusc viruses, such as the oyster herpervirus OsHV-1, but also against human herpes simplex (HSV-1 and HSV-2) (Novoa B., et al., J Virol. 90 (17): 7692-702 (2016)) and against pathogenic fish rhabdoviruses (Balseiro P. et al., PLoS One. 6 (8): e23140 (2011)).
Durante la vida de cualquier ser animal, se producen inevitablemente heridas, y pueden ser consecuencia de una amplia diversidad de sucesos, tales como el contacto con objetos afilados o calientes, o aparecer en ciertos trastornos clínicos, tales como la diabetes. Otro ejemplo clínico importante es el desarrollo de úlceras de decúbito, es decir, lesiones provocadas por una presión no mitigada sobre cualquier parte del cuerpo, en especial de porciones sobre áreas óseas o cartilaginosas. Aunque son completamente tratables si se descubren en una fase temprana, las úlceras de decúbito, sin atención médica, como cualquier otra herida, pueden llegar a ser mortales. En el caso de un estado de salud general reducida, el cierre (cicatrización) de las heridas puede retrasarse, y puede provocar otros problemas, tales como infecciones, inflamación, necrosis de tejidos, y el cierre ineficaz de una herida vuelve a
ser, de nuevo, potencialmente mortal. During the life of any animal, wounds inevitably occur, and can be the consequence of a wide variety of events, such as contact with sharp or hot objects, or appear in certain clinical disorders, such as diabetes. Another important clinical example is the development of pressure ulcers, that is, injuries caused by unmitigated pressure on any part of the body, especially portions on bony or cartilaginous areas. Although fully treatable if discovered early, bedsores, without medical attention, like any other wound, can be fatal. In the case of reduced general health, wound closure (healing) can be delayed, and can lead to other problems, such as infection, inflammation, tissue necrosis, and ineffective wound closure. again, potentially life-threatening.
Las heridas se producen generalmente en la piel. La piel es un órgano vital que cumple múltiples funciones, tales como funciones sensitivas, funciones protectoras frente a agresiones externas, así como funciones inmunológicas, metabólicas o termorreguladoras. Estos papeles son posibles debido a la compleja estructura que asocia diversos tejidos. La piel consiste en tres capas diferenciadas superpuestas: la epidermis, la dermis y la hipodermis. La epidermis es un epitelio de revestimiento, que constituye la estructura externa de la piel y proporciona su función de protección. Esta función es proporcionada por la cohesión de las células epiteliales y por la producción de una proteína filamentosa y resistente, la queratina. Wounds generally occur on the skin. The skin is a vital organ that fulfills multiple functions, such as sensory functions, protective functions against external aggressions, as well as immunological, metabolic or thermoregulatory functions. These roles are possible due to the complex structure that associates various tissues. The skin consists of three distinct overlapping layers: the epidermis, the dermis, and the hypodermis. The epidermis is a lining epithelium, which constitutes the external structure of the skin and provides its protective function. This function is provided by the cohesion of the epithelial cells and by the production of a resistant and filamentous protein, keratin.
En general, la cicatrización de heridas se describe como consistente en tres fases, concretamente, la fase inflamatoria, la fase proliferativa, y la fase de maduración (denominadas fase inflamatoria aguda, síntesis de matriz extracelular y de colágeno, y remodelación). La secuencia del proceso de cicatrización se inicia durante una fase inflamatoria aguda con el depósito de tejido provisional. A esto le sigue una reepitalización, la síntesis y depósito de colágeno, la proliferación de fibroblastos, y una neovascularización, todo lo cual define en última instancia la fase de remodelación. In general, wound healing is described as consisting of three phases, namely, the inflammatory phase, the proliferative phase, and the maturation phase (termed acute inflammatory phase, synthesis of extracellular and collagen matrix, and remodeling). The sequence of the healing process begins during an acute inflammatory phase with the deposit of provisional tissue. This is followed by reepitalization, collagen synthesis and deposition, fibroblast proliferation, and neovascularization, all of which ultimately define the remodeling phase.
La fase inflamatoria se caracteriza por una hemostasis e inflamación. El colágeno expuesto durante la formación de la herida activa la cascada de la coagulación (tanto la vía intrínseca como la extrínseca), iniciando la fase inflamatoria. Las plaquetas, la primera célula de respuesta, liberan múltiples quimioquinas que ayudan a estabilizar a la herida mediante la formación del coágulo. Estos mediadores actúan para controlar el sangrado y limitar el alcance de la lesión. La segunda célula de respuesta que migra hacia la herida, los neutrófilos, son responsables de la captación de residuos, la opsonización mediada por el complemento de bacterias, y la destrucción de bacterias mediante mecanismos de estallido oxidativo (es decir, formación de superóxido y peróxido de hidrógeno). Los macrófagos son fundamentales para la cicatrización de las heridas. Numerosas enzimas y citoquinas son segregadas por los macrófagos, lo cual marca la transición al proceso de reconstrucción del tejido, es decir, la fase proliferativa. The inflammatory phase is characterized by hemostasis and inflammation. The collagen exposed during wound formation activates the coagulation cascade (both the intrinsic and extrinsic pathways), initiating the inflammatory phase. Platelets, the first response cell, release multiple chemokines that help stabilize the wound by forming a clot. These mediators act to control bleeding and limit the extent of the injury. The second response cell that migrates to the wound, neutrophils, are responsible for debris uptake, complement-mediated opsonization of bacteria, and destruction of bacteria by oxidative burst mechanisms (i.e., formation of superoxide and peroxide. hydrogen). Macrophages are essential for wound healing. Numerous enzymes and cytokines are secreted by macrophages, which marks the transition to the tissue reconstruction process, that is, the proliferative phase.
Durante la fase proliferativa, la epitelización, la angiogénesis, la formación de tejido de granulación y el depósito de colágeno son las etapas principales en la cicatrización de
heridas. La epitelización aparece en una fase temprana de la reparación de heridas. La angiogénesis, estimulada, por ejemplo, por TNF-alfa, se advierte por la migración de células endoteliales y la formación de capilares. Los nuevos capilares transportan nutrientes hacia la herida y ayudan a mantener el lecho del tejido de granulación. La parte final de la fase proliferativa es la formación de tejido granulación. Los fibroblastos se diferencian y producen sustancia basal y después colágeno. La sustancia basal se deposita en el lecho de la herida; después, el colágeno se deposita a medida que la herida se somete a la fase final de reparación. Muchas citoquinas diferentes, que incluyen PDGF, el factor del crecimiento de tipo insulínico (IGF) y EGF, están implicadas en la fase proliferativa de la reparación de heridas. Durante la fase de maduración, la herida sufre una contracción que da como resultado, en último término, que se aprecie una cantidad menor de tejido cicatricial. During the proliferative phase, epithelialization, angiogenesis, granulation tissue formation, and collagen deposition are the main stages in the healing of wounds. Epithelialization appears at an early stage of wound repair. Angiogenesis, stimulated, for example, by TNF-alpha, is noted by endothelial cell migration and capillary formation. The new capillaries transport nutrients to the wound and help maintain the bed of granulation tissue. The final part of the proliferative phase is the formation of granulation tissue. Fibroblasts differentiate and produce basal substance and then collagen. The basal substance is deposited in the wound bed; the collagen is then deposited as the wound undergoes the final phase of repair. Many different cytokines, including PDGF, insulin-like growth factor (IGF), and EGF, are involved in the proliferative phase of wound repair. During the maturation phase, the wound undergoes a contraction that ultimately results in less scar tissue being seen.
A partir de lo anterior, resulta obvio que la cicatrización adecuada de una herida implica una interacción compleja de células y sustancias, tales como citoquinas, que actúan en concierto. Basándose en la investigación básica, se han propuesto muchos fármacos, sustancias y procedimientos de tratamiento para estimular la cicatrización de heridas. From the above, it is obvious that proper wound healing involves a complex interaction of cells and substances, such as cytokines, that act in concert. Based on basic research, many drugs, substances, and treatment procedures have been proposed to stimulate wound healing.
Muchas de estas sustancias proporcionan al paciente alivio parcial de heridas, necesitan largo tiempo de curación y no consiguen mostrar la respuesta óptima al tratamiento. Por ejemplo, la patente EP0575484 divulga una composición farmacéutica para la regeneración y la reparación de tejidos de mamífero, que incluye PDGF y dexametasona. Many of these substances provide the patient with partial relief from wounds, require a long healing time and fail to show the optimal response to treatment. For example, patent EP0575484 discloses a pharmaceutical composition for the regeneration and repair of mammalian tissues, which includes PDGF and dexamethasone.
Por tanto, se hace necesario proporcionar nuevas sustancias y composiciones con un alto poder en la regeneración celular, dando lugar a una cicatrización y reparando el daño tisular de manera efectiva. DESCRIPCIÓN DE LA INVENCIÓN Therefore, it is necessary to provide new substances and compositions with a high power in cell regeneration, leading to scarring and effectively repairing tissue damage. DESCRIPTION OF THE INVENTION
Los inventores de la presente invención han observado que la miticina-C (QSVACRSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR, SEQ ID NO: 1) se expresa en respuesta a heridas o daños en los tejidos, potenciando así la regeneración celular y la reparación del tejido tras el daño. El papel de la miticina-C en la regeneración celular se demostró mediante un ensayo in vitro utilizando células de
queratinocitos humanos (línea HaCat), y mediante un ensayo in vivo empleando larvas de pez cebra ( Danio rerío). En ambos casos se vió que la herida cicatrizaba más rápido en presencia de miticina-C que, en su ausencia, promoviendo así la cicatrización y reparando el daño tisular (ver Ejemplo 1, Figuras 1 y 2). The inventors of the present invention have observed that miticin-C (QSVACRSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR, SEQ ID NO: 1) is expressed in response to injury or tissue damage, thus enhancing cell regeneration and tissue repair after damage. The role of miticin-C in cell regeneration was demonstrated by an in vitro assay using cells from human keratinocytes (HaCat line), and by an in vivo test using zebrafish larvae (Danio rerío). In both cases, it was seen that the wound healed faster in the presence of miticin-C than, in its absence, thus promoting healing and repairing tissue damage (see Example 1, Figures 1 and 2).
A continuación, los inventores diseñaron una librería de péptidos pequeños cortos solapantes a partir de la secuencia de aminoácidos de la miticina-C (ver Tabla 1), con la finalidad de identificar aquella secuencia mínima necesaria para que la miticina-C pueda ejercer su papel en la regeneración celular y/o tisular. Así, mediante ensayos in vitro e in vivo, los inventores observaron que algunos péptidos denominados P1 a P4 eran capaces de reparar la herida o daño generado. Estos péptidos presentan la secuencia consenso SYYCSK (SEQ ID NO: 2), siendo ésta por tanto la secuencia de aminoácidos responsable de llevar a cabo las mejores tasas de regeneración a las 48 horas. Particularmente si se añaden los aminoácidos F y C en el extremo carboxilo terminal, presentan una mejora en la cicatrización total de la herida a las 72 h, SYYCSKFC (SEQ ID NO: 3), como se puede ver en la Figura 3 con los péptidos denominados P2b, P3 y P4. Next, the inventors designed a library of overlapping short small peptides from the amino acid sequence of miticin-C (see Table 1), in order to identify that minimum sequence necessary for miticin-C to play its role. in cellular and / or tissue regeneration. Thus, through in vitro and in vivo tests, the inventors observed that some peptides named P1 to P4 were able to repair the wound or damage generated. These peptides present the consensus SYYCSK sequence (SEQ ID NO: 2), this being therefore the amino acid sequence responsible for carrying out the best regeneration rates after 48 hours. Particularly if amino acids F and C are added at the carboxyl terminus, they show an improvement in total wound healing at 72 h, SYYCSKFC (SEQ ID NO: 3), as can be seen in Figure 3 with the peptides called P2b, P3 and P4.
Así, en un aspecto, la presente invención se refiere a un péptido que comprende al menos un 80% de identidad con la secuencia SYYCSK (SEQ ID NO: 2), que presenta preferiblemente un tamaño de entre 6 a 99 aminoácidos, y que no es la miticina-C con secuencia SEQ ID NO: 1, preferiblemente el péptido comprende al menos un 80% de identidad con la secuencia SYYCSKFC (SEQ ID NO: 3), que presenta preferiblemente un tamaño de entre 6 a 99 aminoácidos, y que no es la miticina-C con secuencia SEQ ID NO: 1. De aquí en adelante, este péptido será denominado “péptido de la invención”. Thus, in one aspect, the present invention relates to a peptide comprising at least 80% identity with the SYYCSK sequence (SEQ ID NO: 2), preferably having a size of between 6 to 99 amino acids, and not is miticin-C with sequence SEQ ID NO: 1, preferably the peptide comprises at least 80% identity with the sequence SYYCSKFC (SEQ ID NO: 3), which preferably has a size between 6 to 99 amino acids, and that it is not miticin-C with sequence SEQ ID NO: 1. Hereinafter, this peptide will be called "peptide of the invention".
El término“péptido”, como se usa en el presente documento, se refiere a una molécula formada por la unión, en un orden definido, de alfa-aminoácidos mediante un enlace peptídico. Se entenderá que los términos "enlace peptídico", "péptido", "polipéptido" y proteína son conocidos por los expertos en la materia. De aquí en adelante, "péptido" y "polipéptido" se utilizarán indistintamente. The term "peptide", as used herein, refers to a molecule formed by the binding, in a defined order, of alpha-amino acids via a peptide bond. It will be understood that the terms "peptide bond", "peptide", "polypeptide" and protein are known to those skilled in the art. Hereinafter, "peptide" and "polypeptide" will be used interchangeably.
El péptido de la invención puede obtenerse por técnicas ampliamente conocidas en el estado de la técnica, tales como síntesis química, recombinación genética, expresión del polinucleótido que codifica el polipéptido de la invención, etc. Todas estas técnicas son práctica de rutina para el experto en la materia.
Adicionalmente, los extremos carboxilo y amino terminal del péptido de la invención pueden estar protegidos contra la proteólisis. Por ejemplo, el extremo amino terminal puede estar en forma de grupo acetilo (Ac) y/o el extremo carboxilo terminal puede estar en forma de grupo amida (Am). También cabe la posibilidad de llevar a cabo modificaciones internas de los péptidos para que sean resistentes a la proteólisis. Ejemplos de estas modificaciones internas incluyen, sin limitar a, modificaciones en las que al menos un puente peptídico -CONH- se modifica y se reemplaza por un enlace reducido (CH2NH), un enlace retroinverso (NHCO), un enlace oximetileno (CH2-O), un enlace tiometileno (CH2-S), un enlace cetometileno (CO-CH2), un enlace hidroxietileno (CHOH-CH2), un enlace (N-N), un enlace E-alceno o un enlace -CH=CH Los péptidos también pueden estabilizarse por cruzamiento intramolecular, por ejemplo, mediante la modificación al menos de dos residuos de aminoácidos con cadenas laterales de oleofina, preferiblemente, cadenas alquenilo C3-C8, preferiblemente, cadenas pentel-2-il, seguidas de un entrecruzamiento de las cadenas tal como se describe en la tecnología denominada“staple” (Walensky et al., 2004, Science 205: 1466-1470). Todos estos péptidos modificados de forma química para resistir a la proteólisis, también están contemplados dentro de la presente invención. Modificaciones adicionales al péptido de la invención comprenden la unión covalente a una molécula de polietilenglicol (PEG) por su extremo carboxilo terminal o a un residuo de lisina, con la finalidad de disminuir su eliminación urinaria y la dosis terapéutica, y de incrementar la vida media del péptido en el plasma sanguíneo. La vida media del péptido también puede incrementarse mediante la inclusión del péptido en un material polimérico biodegradable y biocompatible para formar microesferas que son empleadas como un sistema de administración de fármacos. Polímeros y copolímeros incluyen, sin limitar a, poli (D, L-láctido-co-glicólico) o PLGA. Las técnicas y procedimientos de cómo fabricar microesferas o nanocápsulas lipídicas para su empleo en la administración de fármacos son ampliamente conocidas por el experto en la materia. The peptide of the invention can be obtained by techniques widely known in the state of the art, such as chemical synthesis, genetic recombination, expression of the polynucleotide that encodes the polypeptide of the invention, etc. All of these techniques are routine practice for the person skilled in the art. Additionally, the carboxyl and amino terminal ends of the peptide of the invention can be protected against proteolysis. For example, the amino terminal end may be in the form of an acetyl group (Ac) and / or the carboxyl terminal end may be in the form of an amide group (Am). It is also possible to carry out internal modifications of the peptides so that they are resistant to proteolysis. Examples of these internal modifications include, but are not limited to, modifications in which at least one peptide bridge -CONH- is modified and replaced by a reduced bond (CH 2 NH), a retroverse bond (NHCO), an oxymethylene bond (CH 2- O), a thiomethylene bond (CH 2 -S), a ketomethylene bond (CO-CH 2 ), a hydroxyethylene bond (CHOH-CH 2 ), a bond (NN), an E-alkenne bond or a bond - CH = CH Peptides can also be stabilized by intramolecular crossing, for example, by modifying at least two amino acid residues with olefin side chains, preferably C 3 -C 8 alkenyl chains, preferably pentel-2-yl chains, followed by chain crosslinking as described in so-called "staple" technology (Walensky et al., 2004, Science 205: 1466-1470). All of these peptides chemically modified to resist proteolysis are also contemplated within the present invention. Additional modifications to the peptide of the invention include covalent attachment to a polyethylene glycol (PEG) molecule by its carboxyl terminus or to a lysine residue, in order to decrease its urinary elimination and therapeutic dose, and to increase the half-life of the peptide in blood plasma. The half-life of the peptide can also be increased by including the peptide in a biodegradable and biocompatible polymeric material to form microspheres that are used as a drug delivery system. Polymers and copolymers include, without limitation, poly (D, L-lactide-co-glycolic) or PLGA. The techniques and procedures of how to manufacture lipid microspheres or nanocapsules for use in drug administration are widely known to the person skilled in the art.
El péptido de la invención comprende al menos un 80% de identidad con la secuencia SEQ ID NO: 2, preferiblemente al menos un 80% de identidad con la secuencia SEQ ID NO: 3. En la presente invención, se entiende por“identidad” o “identidad de secuencia” al grado de similitud entre dos secuencias de nucleótidos o aminoácidos obtenido mediante el alineamiento de las dos secuencias. Dependiendo del número de
residuos comunes entre las secuencias alineadas, se obtendrá un grado de identidad expresado en tanto por ciento. El grado de identidad entre dos secuencias de aminoácidos puede determinarse por métodos convencionales, por ejemplo, mediante algoritmos estándar de alineamiento de secuencias conocidos en el estado de la técnica, como por ejemplo BLAST. Los programas BLAST, por ejemplo, BLASTN, BLASTX, and TBLASTX, BLASTR and TBLASTN, son de dominio público en la página web de The National Center for Biotechonology Information (NCBI). En una realización particular, el péptido de la invención comprende una identidad de, al menos, 81 , 82, 83, 84, 85, 86, 87, 88, 89, 90, 91 , 92, 93, 94, 95, 96, 97, 98 ó 99% con la secuencia SEQ ID NO: 2 o la SEQ ID NO: 3. En otra realización todavía más particular, el péptido de la invención comprende una identidad de secuencia del 100% con la secuencia SEQ ID NO: 2 o de la SEQ ID NO: 3. Como entiende el experto en la materia, todos los péptidos que presentan una identidad de, al menos, un 80% con la secuencia SEQ ID NO: 2 o de la SEQ ID NO: 3, y que presentan la misma función que el péptido SEQ ID NO: 2 o de la SEQ ID NO: 3, es decir, tienen capacidad de potenciar la regeneración tisular y la reparación del daño tisular, son variantes funcionalmente equivalentes del péptido de la invención. Ensayos para identificar péptidos funcionalmente equivalentes al péptido de la invención se pueden encontrar en el Ejemplo de la presente descripción. The peptide of the invention comprises at least 80% identity with the sequence SEQ ID NO: 2, preferably at least 80% identity with the sequence SEQ ID NO: 3. In the present invention, "identity" is understood or "sequence identity" to the degree of similarity between two nucleotide or amino acid sequences obtained by aligning the two sequences. Depending on the number of common residues between the aligned sequences, a degree of identity expressed as a percentage will be obtained. The degree of identity between two amino acid sequences can be determined by conventional methods, for example, by standard sequence alignment algorithms known in the state of the art, such as BLAST. BLAST programs, eg BLASTN, BLASTX, and TBLASTX, BLASTR and TBLASTN, are in the public domain on the website of The National Center for Biotechonology Information (NCBI). In a particular embodiment, the peptide of the invention comprises an identity of at least 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% with the sequence SEQ ID NO: 2 or SEQ ID NO: 3. In another still more particular embodiment, the peptide of the invention comprises a sequence identity of 100% with the sequence SEQ ID NO: 2 or from SEQ ID NO: 3. As understood by the person skilled in the art, all peptides that have an identity of at least 80% with the sequence SEQ ID NO: 2 or SEQ ID NO: 3, and which have the same function as SEQ ID NO: 2 or SEQ ID NO: 3, that is, they have the capacity to enhance tissue regeneration and tissue damage repair, they are functionally equivalent variants of the peptide of the invention. Assays to identify peptides functionally equivalent to the peptide of the invention can be found in the Example of the present description.
Así, en una realización particular, el péptido de la invención se refiere a un péptido que comprende la secuencia SEQ ID NO: 2, preferiblemente la SEQ ID NO: 3, que puede presentar un tamaño de entre 6 a 99 aminoácidos, y que no es miticina-C con la secuencia SEQ ID NO: 1. Thus, in a particular embodiment, the peptide of the invention refers to a peptide comprising the sequence SEQ ID NO: 2, preferably SEQ ID NO: 3, which can be between 6 and 99 amino acids in size, and which does not it is miticin-C with the sequence SEQ ID NO: 1.
Otra característica del péptido de la invención es que presenta un tamaño de entre 6 y 99 aminoácidos, preferiblemente entre 6 y 50, más preferiblemente entre 6 y 40. En una realización más particular, presenta un tamaño de entre 6 y 25 aminoácidos, y en otra realización todavía más particular, de entre 6 y 20 aminoácidos o de entre 6 y 15 aminoácidos. En otra realización aún más particular, el péptido de la invención presenta un tamaño de 6, 7, 8, 9, 10, 11, 12, 13, 14 o 15 aminoácidos. Another characteristic of the peptide of the invention is that it has a size of between 6 and 99 amino acids, preferably between 6 and 50, more preferably between 6 and 40. In a more particular embodiment, it has a size of between 6 and 25 amino acids, and in another still more particular embodiment, between 6 and 20 amino acids or between 6 and 15 amino acids. In another even more particular embodiment, the peptide of the invention has a size of 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids.
En otra realización particular, el péptido de la invención se refiere a un péptido que comprende la secuencia QSVACRSYYCSK (SEQ ID NO: 4), VACRSYYCSKFC (SEQ ID NO: 5), CRSYYCSKFCGS (SEQ ID NO: 6) o SYYCSKFCGSAG (SEQ ID NO: 7). En otra realización todavía más particular, el péptido de la invención se refiere a un
péptido que consiste en la secuencia SYYCSK (SEQ ID NO: 2), SYYCSKFC (SEQ ID NO: 3), QSVACRSYYCSK (SEQ ID NO: 4), VACRSYYCSKFC (SEQ ID NO: 5), CRSYYCSKFCGS (SEQ ID NO: 6) o SYYCSKFCGSAG (SEQ ID NO: 7). Más preferiblemente el péptido consiste en la secuencia VACRSYYCSKFC (SEQ ID NO: 5), CRSYYCSKFCGS (SEQ ID NO: 6) o SYYCSKFCGSAG (SEQ ID NO: 7). Cómo se ha comentado anteriormente, los péptidos de la invención pueden estar protegidos contra la proteólisis, particularmente el péptido de la invención se refiere a un péptido que comprende la secuencia SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 o SEQ ID NO: 12. In another particular embodiment, the peptide of the invention refers to a peptide comprising the sequence QSVACRSYYCSK (SEQ ID NO: 4), VACRSYYCSKFC (SEQ ID NO: 5), CRSYYCSKFCGS (SEQ ID NO: 6) or SYYCSKFCGSAG (SEQ ID NO: 7). In a still more particular embodiment, the peptide of the invention refers to a peptide consisting of the sequence SYYCSK (SEQ ID NO: 2), SYYCSKFC (SEQ ID NO: 3), QSVACRSYYCSK (SEQ ID NO: 4), VACRSYYCSKFC (SEQ ID NO: 5), CRSYYCSKFCGS (SEQ ID NO: 6) or SYYCSKFCGSAG (SEQ ID NO: 7). More preferably the peptide consists of the sequence VACRSYYCSKFC (SEQ ID NO: 5), CRSYYCSKFCGS (SEQ ID NO: 6), or SYYCSKFCGSAG (SEQ ID NO: 7). As discussed above, the peptides of the invention may be protected against proteolysis, particularly the peptide of the invention refers to a peptide comprising the sequence SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 , SEQ ID NO: 11 or SEQ ID NO: 12.
El péptido de la invención puede estar unido a otras secuencias de aminoácidos para dar lugar a una proteína de fusión. Por lo tanto, en otro aspecto, la presente invención se refiere a una proteína de fusión que comprende el péptido de la invención, de aquí en adelante,“proteína de fusión de la invención”. The peptide of the invention can be linked to other amino acid sequences to give rise to a fusion protein. Therefore, in another aspect, the present invention relates to a fusion protein comprising the peptide of the invention, hereinafter "fusion protein of the invention".
El término“proteína de fusión”, tal como se usa en el presente documento, se refiere a una cadena polipeptídica diseñada artificialmente que comprende dos o más secuencias de aminoácidos de diferentes orígenes, naturales y/o artificiales. La proteína de fusión, por definición, nunca se encuentra en la naturaleza como tal. The term "fusion protein", as used herein, refers to an artificially designed polypeptide chain comprising two or more amino acid sequences of different origins, natural and / or artificial. Fusion protein, by definition, is never found in nature as such.
La proteína de fusión de la invención se puede obtener mediante cualquier técnica adecuada que permita obtener péptidos en una sola cadena de polinucleótido. Dichas técnicas incluyen técnicas recombinantes, donde se introduce una construcción génica que codifica la proteína de fusión en un vector adecuado para la expresión en un sistema de expresión adecuado, y técnicas de ligación de proteínas que involucran la formación de un enlace peptídico entre dos polipéptidos, como la ligación química nativa o ligación de proteínas expresadas. The fusion protein of the invention can be obtained by any suitable technique that allows obtaining peptides in a single polynucleotide chain. Such techniques include recombinant techniques, where a gene construct encoding the fusion protein is introduced into a suitable vector for expression in a suitable expression system, and protein ligation techniques that involve the formation of a peptide bond between two polypeptides, such as native chemical ligation or expressed protein ligation.
La proteína de fusión de la invención puede comprender adicionalmente un dominio peptídico señal N-terminal, que permite el procesamiento, por ejemplo, secreción extracelular, en una célula hospedadora adecuada. Preferiblemente, el dominio peptídico señal N-terminal comprende una proteasa, por ejemplo, un sitio de escisión por peptidasa señal, y por tanto puede retirarse después de o durante la expresión para obtener la proteína madura. The fusion protein of the invention may further comprise an N-terminal signal peptide domain, which enables processing, eg, extracellular secretion, in a suitable host cell. Preferably, the N-terminal signal peptide domain comprises a protease, eg, a signal peptidase cleavage site, and therefore can be removed after or during expression to obtain the mature protein.
Adicionalmente, la proteína de fusión puede comprender un dominio de
reconocimiento/purificación, por ejemplo, un dominio de marca Estrep y/o un dominio poli-His, que pueden estar localizados en el extremo N-terminal o en el extremo C- terminal. Asimismo, la proteína de fusión de la invención puede comprender adicionalmente un elemento flexible C-terminal, que tiene una longitud de, por ejemplo, 1-50, preferiblemente 10-30 aminoácidos que pueden incluir y/o conectarse a un dominio de reconocimiento/purificación como se describe en este documento. Additionally, the fusion protein may comprise a domain of recognition / purification, eg, an Estrep brand domain and / or a poly-His domain, which may be located at the N-terminus or the C-terminus. Also, the fusion protein of the invention may further comprise a flexible C-terminal element, having a length of, for example, 1-50, preferably 10-30 amino acids that can include and / or connect to a recognition domain / purification as described in this document.
El péptido de la invención puede ir unido a otras secuencias de aminoácidos a través de un espaciador (linker), el cual, puede ser flexible. The peptide of the invention can be linked to other amino acid sequences through a linker, which can be flexible.
Tanto el péptido como la proteína de la invención pueden estar contenidos en una nanopartícula para su mejor administración, conservación, etc. Así, en otro aspecto, la presente invención se refiere a una nanopartícula que comprende el péptido o la proteína de fusión de la invención. Both the peptide and the protein of the invention can be contained in a nanoparticle for better administration, conservation, etc. Thus, in another aspect, the present invention relates to a nanoparticle comprising the peptide or fusion protein of the invention.
El término "nanopartícula", como se usa en el presente documento, se refiere a cualquier material que tenga dimensiones en el rango de entre 1 y 1.000 nm. En algunas realizaciones, las nanopartículas tienen dimensiones en el rango de 2-200 nm, preferiblemente en el rango de 2-150 nm, e incluso más preferiblemente en el rango de 2-100 nm. Las nanopartículas pueden contribuir a preservar la integridad del péptido o de la proteína de fusión en los fluidos biológicos hasta que alcance el órgano objetivo. Por último, las nanopartículas también pueden modificarse para dirigir la nanopartícula a un órgano de interés, mediante la adición de ligandos sin comprometer la capacidad de las nanopartículas para entregar sus cargas útiles de péptidos. Se contempla que esto permitirá el suministro a células, tejidos y órganos específicos. La especificidad de direccionamiento de los sistemas de administración basados en ligandos se basa en la distribución de los receptores de ligandos en diferentes tipos de células. El ligando de direccionamiento puede estar asociado de forma no covalente o covalente con una nanopartícula, y puede conjugarse con las nanopartículas mediante una variedad de métodos. The term "nanoparticle", as used herein, refers to any material having dimensions in the range of from 1 to 1,000 nm. In some embodiments, the nanoparticles have dimensions in the range of 2-200 nm, preferably in the range of 2-150 nm, and even more preferably in the range of 2-100 nm. Nanoparticles can help preserve the integrity of the peptide or fusion protein in biological fluids until it reaches the target organ. Finally, nanoparticles can also be modified to target the nanoparticle to an organ of interest, by adding ligands without compromising the ability of the nanoparticles to deliver their peptide payloads. This is contemplated to allow delivery to specific cells, tissues, and organs. The targeting specificity of ligand-based delivery systems is based on the distribution of ligand receptors in different cell types. The targeting ligand can be non-covalently or covalently associated with a nanoparticle, and can be conjugated to the nanoparticles by a variety of methods.
Las nanopartículas adecuadas que pueden usarse en el contexto de la presente invención incluyen materiales a nanoescala como una nanopartícula basada en lípidos, una nanopartícula superparamagnética, una nanohélice, un nanocristal semiconductor, un punto cuántico, una nanopartícula basada en polímero, una nanopartícula basada en silicona, una nanopartícula a base de sílice, una
nanopartícula a base de metal, un fullereno y un nanotubo. Suitable nanoparticles that can be used in the context of the present invention include nanoscale materials such as a lipid based nanoparticle, a superparamagnetic nanoparticle, a nano helix, a semiconductor nanocrystal, a quantum dot, a polymer based nanoparticle, a silicone based nanoparticle , a silica-based nanoparticle, a metal-based nanoparticle, a fullerene and a nanotube.
Como entiende el experto en la materia, el péptido de la invención o la proteína de la invención también puede estar contenido dentro de una partícula. Por lo tanto, en otro aspecto, la invención se refiere a una partícula similar a virus que comprende el péptido o la proteína de fusión. As understood by the person skilled in the art, the peptide of the invention or the protein of the invention can also be contained within a particle. Therefore, in another aspect, the invention relates to a virus-like particle comprising the peptide or the fusion protein.
El término "partícula similar a un virus", también denominado "VLP", se refiere a partículas no infecciosas que se parecen a los virus que no contienen ningún material genético viral. Las VLP son el resultado de la expresión de proteínas estructurales virales, como las proteínas de la cápside y su autoensamblaje. The term "virus-like particle", also called "VLP", refers to non-infectious virus-like particles that do not contain any viral genetic material. VLPs are the result of the expression of viral structural proteins, such as capsid proteins and their self-assembly.
En una realización particular, la VLP puede comprender, o alternativamente consistir en, proteínas estructurales de Parvovirus, Rotavirus; proteínas estructurales del virus de Norwalk; proteínas estructurales del alfavirus; proteínas estructurales del virus de la fiebre aftosa; proteínas estructurales del virus del sarampión, proteínas estructurales del virus Sindbis, proteínas estructurales de las proteínas estructurales del retrovirus del virus de la Hepatitis B (por ejemplo, un HBcAg); proteínas estructurales del virus del mosaico del tabaco; proteínas estructurales del virus FlockHouse; proteínas estructurales del virus del papiloma humano; proteínas estructurales del virus del polioma; proteínas estructurales de bacteriófagos, proteínas estructurales de fagos de ARN. In a particular embodiment, the VLP may comprise, or alternatively consist of, structural proteins of Parvovirus, Rotavirus; Norwalk virus structural proteins; alphavirus structural proteins; foot-and-mouth disease virus structural proteins; measles virus structural proteins, Sindbis virus structural proteins, structural proteins of Hepatitis B virus retrovirus structural proteins (eg, an HBcAg); structural proteins of the tobacco mosaic virus; structural proteins of the FlockHouse virus; structural proteins of human papillomavirus; polyoma virus structural proteins; Bacteriophage structural proteins, RNA phage structural proteins.
En una realización particular, el péptido o la proteína de fusión de la invención se acopla o se une a la cápside de la partícula similar a virus. La unión del péptido o proteína de fusión a la cápside puede ser por un enlace covalente o no covalente. In a particular embodiment, the peptide or fusion protein of the invention couples or binds to the capsid of the virus-like particle. The binding of the peptide or fusion protein to the capsid can be by a covalent or non-covalent bond.
El péptido de la invención puede obtenerse por técnicas ampliamente conocidas en el estado de la técnica, como la expresión en una célula del poiinucleótido que codifica el polipéptido de la invención, o la proteína de la invención, y su posterior aislamiento. Por lo tanto, en otro aspecto, la invención se refiere a un poiinucleótido, de aquí en adelante“poiinucleótido de la invención”, que codifica el péptido de la invención o la proteína de fusión de la invención. The peptide of the invention can be obtained by techniques widely known in the state of the art, such as the expression in a cell of the poiinucleotide that encodes the polypeptide of the invention, or the protein of the invention, and its subsequent isolation. Therefore, in another aspect, the invention relates to a poiinucleotide, hereinafter "poiinucleotide of the invention", which encodes the peptide of the invention or the fusion protein of the invention.
Los términos "poiinucleótido", "ácido nucleico" y "molécula de ácido nucleico" se usan indistintamente para referirse a formas poliméricas de nucleótidos de cualquier
longitud. Los polinucleótidos pueden contener desoxirribonucleótidos, ribonucleótidos y/o sus análogos. Los nucleótidos pueden tener cualquier estructura tridimensional y pueden realizar cualquier función, conocida o desconocida. El término "polinucleótido" incluye, por ejemplo, moléculas monocatenarias, bicatenarias y de triple hélice, un gen o fragmento de gen, exones, intrones, ARNm, ARNt, ARNr, ribozimas, ADNc, polinucleótidos recombinantes, polinucleótidos ramificados, plásmidos, vectores, ADN aislado de cualquier secuencia, ARN aislado de cualquier secuencia, sondas de ácido nucleico y cebadores. Además de una molécula de ácido nucleico nativa, una molécula de ácido nucleico de la presente invención también puede comprender moléculas de ácido nucleico modificadas. Como se usa en este documento, ARNm se refiere a un ARN que puede traducirse en una célula. The terms "poiinucleotide", "nucleic acid" and "nucleic acid molecule" are used interchangeably to refer to polymeric forms of nucleotides of any length. The polynucleotides can contain deoxyribonucleotides, ribonucleotides and / or their analogs. Nucleotides can have any three-dimensional structure and can perform any function, known or unknown. The term "polynucleotide" includes, for example, single-stranded, double-stranded, and triple helix molecules, a gene or gene fragment, exons, introns, mRNAs, tRNAs, rRNAs, ribozymes, cDNAs, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, DNA isolated from any sequence, RNA isolated from any sequence, nucleic acid probes and primers. In addition to a native nucleic acid molecule, a nucleic acid molecule of the present invention may also comprise modified nucleic acid molecules. As used herein, mRNA refers to an RNA that can be translated into a cell.
En una realización preferida, el polinucleótido de la invención es un ARNm. El ARNm puede sintetizarse químicamente, puede obtenerse mediante transcripción in vitro o puede sintetizarse in vivo en la célula diana. Las secuencias de nucleótidos que forman el ácido nucleico que codifica el conjugado o la proteína de fusión de la invención están en el mismo marco de lectura correcto para la expresión de los mismos. El polinucleótido que codifica el péptido o la proteína de fusión de la invención puede tener diversas modificaciones efectuadas en la región codificante en la medida que no cambien la secuencia de aminoácidos, del péptido o de la proteína de fusión, debido a la degeneración de los codones, o tomando en consideración los codones preferidos por el organismo en el que se van a expresar y pueden introducirse diversas modificaciones o alteraciones incluso en regiones distintas de la región codificante, en tanto que no tengan influencia sobre la expresión del gen. In a preferred embodiment, the polynucleotide of the invention is an mRNA. The mRNA can be chemically synthesized, can be obtained by in vitro transcription, or can be synthesized in vivo in the target cell. The nucleotide sequences that make up the nucleic acid encoding the conjugate or fusion protein of the invention are in the same correct reading frame for expression thereof. The polynucleotide encoding the peptide or fusion protein of the invention may have various modifications made to the coding region as long as the amino acid, peptide or fusion protein sequence does not change, due to degeneration of the codons. , or taking into consideration the codons preferred by the organism in which they are to be expressed and various modifications or alterations can be introduced even in different regions of the coding region, as long as they do not influence the expression of the gene.
Como entiende el experto en la materia, el polinucleótido que codifica el péptido de la invención o la proteína de fusión de la invención, pueden estar incluidos dentro de una construcción génica o dentro de un vector de expresión. En general, un vector de expresión comprende, además del polinucleótido que codifica el péptido de la invención o la proteína de fusión de la invención, un promotor que dirige su transcripción (por ejemplo, pT7, plac, ptrc, ptac, pBAD, ret, etc.), al que está operativamente enlazado, y otras secuencias necesarias o apropiadas que controlan y regulan dicha transcripción y, en su caso, la traducción del producto de interés, por ejemplo, señales de inicio y terminación de transcripción (tlt2, etc.), señal de
poliadenilación, origen de replicación, secuencias de unión a ribosomas (RBS), secuencias codificantes de reguladores transcripcionales, potenciadores (enhancers), silenciadores transcripcionales (silencers), represores, etc. Ejemplos de vectores de expresión apropiados pueden seleccionarse de acuerdo con las condiciones y necesidades de cada caso concreto entre plásmidos de expresión, vectores virales (ADN o ARN), cósmidos, cromosomas artificiales, etc. que pueden contener, además, marcadores utilizables para seleccionar las células transfectadas o transformadas con el gen o genes de interés. La elección del vector dependerá de la célula huésped y del tipo de uso que se quiera realizar. Por ejemplo, dicho vector puede ser un vector viral (adenovirus, virus asociados a los adenovirus así como retrovirus y, en particular, lentivirus) o no viral (pcDNA3, pHCMV/Zeo, pCR3.1 , pEFI/His, pIND/GS, pRc/HCMV2, pSV40/Zeo2, pTRACER-HCMV, pUB6/V5-His, pVAXI, pZeoSV2, pCI, pSVL and pKSV-10, pBPV-1 , pML2d y pTDTI). Dichos vectores pueden ser administrados directamente al sujeto por métodos convencionales. Alternativamente, dichos vectores pueden ser utilizados para transformar, transfectar o infectar células, por ejemplo, células de mamíferos, ex vivo, y, posteriormente implantarlas en el cuerpo animal para obtener el efecto terapéutico deseado. Para su administración al sujeto receptor dichas células se formularán en un medio adecuado que no afecte adversamente a la viabilidad de dichas células. La obtención de dicho vector puede realizarse por métodos convencionales conocidos por los técnicos en la materia al igual que para la transformación de microorganismos y células eucariotas se pueden utilizar diferentes métodos ampliamente conocidos. As understood by the person skilled in the art, the polynucleotide that encodes the peptide of the invention or the fusion protein of the invention, can be included within a gene construct or within an expression vector. In general, an expression vector comprises, in addition to the polynucleotide encoding the peptide of the invention or the fusion protein of the invention, a promoter that directs its transcription (for example, pT7, plac, ptrc, ptac, pBAD, ret, etc.), to which it is operatively linked, and other necessary or appropriate sequences that control and regulate said transcription and, where appropriate, the translation of the product of interest, for example, transcription start and end signals (tlt2, etc.). ), signal of polyadenylation, origin of replication, ribosome binding sequences (RBS), coding sequences for transcriptional regulators, enhancers (enhancers), transcriptional silencers (silencers), repressors, etc. Examples of appropriate expression vectors can be selected according to the conditions and needs of each specific case among expression plasmids, viral vectors (DNA or RNA), cosmids, artificial chromosomes, etc. they may also contain markers usable for selecting cells transfected or transformed with the gene or genes of interest. The choice of vector will depend on the host cell and the type of use to be made. For example, said vector can be a viral vector (adenovirus, adenovirus-associated virus as well as retrovirus and, in particular, lentivirus) or non-viral (pcDNA3, pHCMV / Zeo, pCR3.1, pEFI / His, pIND / GS, pRc / HCMV2, pSV40 / Zeo2, pTRACER-HCMV, pUB6 / V5-His, pVAXI, pZeoSV2, pCI, pSVL and pKSV-10, pBPV-1, pML2d and pTDTI). Said vectors can be administered directly to the subject by conventional methods. Alternatively, said vectors can be used to transform, transfect or infect cells, for example, mammalian cells, ex vivo, and subsequently implant them in the animal body to obtain the desired therapeutic effect. For administration to the recipient subject, said cells will be formulated in a suitable medium that does not adversely affect the viability of said cells. Obtaining said vector can be carried out by conventional methods known to those skilled in the art, as well as by using different widely known methods for the transformation of microorganisms and eukaryotic cells.
En otro aspecto, la invención se refiere a una construcción génica, de aquí en adelante “construcción génica de la invención”, que comprende el polinucleótido de la invención. In another aspect, the invention relates to a gene construct, hereinafter "gene construct of the invention", comprising the polynucleotide of the invention.
Preferiblemente, la construcción génica de la invención comprende el polinucleótido de la invención operativamente unido a secuencias reguladoras de la expresión del polinucleótido de la invención. En principio, cualquier promotor puede ser utilizado en las construcciones génicas de la presente invención, siempre que dicho promotor sea compatible con las células en las que se desea expresar el polinucleótido. Preferably, the gene construct of the invention comprises the polynucleotide of the invention operatively linked to expression regulatory sequences of the polynucleotide of the invention. In principle, any promoter can be used in the gene constructs of the present invention, as long as said promoter is compatible with the cells in which it is desired to express the polynucleotide.
Un promotor, o región promotora, es una secuencia de nucleótidos que controla la transcripción de un gen determinado (secuencias nucleotídicas). En la presente invención se refiere a una secuencia de nucleótidos que controla la transcripción del polinucleótido de la invención. Las secuencias promotoras pueden ser unidireccionales
o bidireccionales. Un promotor unidireccional es aquel que controla la transcripción de un gen o de más genes que se sitúan en tándem con el primero.“En tándem” se refiere a que el extremo 3’ del primer gen va seguido, bien consecutivamente o separados por una determinada secuencia nucleotídica, por el extremo 5’ del segundo gen. Un promotor bidireccional se refiere a la región promotora que controla la transcripción en dos direcciones opuestas, es decir, que un promotor bidireccional dirige la transcripción de dos genes situados de manera divergente, es decir en sentido opuesto, estando el extremo 5’ de ambas secuencias nucleotídicas más cercano entre sí que el extremo 3’. En la presente invención se utilizan los términos “promotor” y “región promotora” indistintamente. Además, los promotores en la presente invención pueden ser constitutivos o inducibles. El término“¡nducible”, tal y como se emplea en la presente descripción, se refiere a la posibilidad de que el promotor tenga un elemento de control que permita activar o desactivar (reprimir) la transcripción del gen que regula, en presencia de un factor externo al promotor. A promoter, or promoter region, is a nucleotide sequence that controls the transcription of a given gene (nucleotide sequences). In the present invention it refers to a nucleotide sequence that controls the transcription of the polynucleotide of the invention. Promoter sequences can be unidirectional or bidirectional. A unidirectional promoter is one that controls the transcription of one gene or more genes that are in tandem with the first one. "Tandem" refers to the 3 'end of the first gene being followed, either consecutively or separated by a certain nucleotide sequence, at the 5 'end of the second gene. A bidirectional promoter refers to the promoter region that controls transcription in two opposite directions, that is, that a bidirectional promoter directs the transcription of two genes located divergently, that is, in the opposite direction, the 5 'end of both sequences being nucleotide closer to each other than the 3 'end. In the present invention the terms "promoter" and "promoter region" are used interchangeably. Furthermore, the promoters in the present invention can be either constitutive or inducible. The term "inducible", as used in the present description, refers to the possibility that the promoter has a control element that allows to activate or deactivate (repress) the transcription of the gene that it regulates, in the presence of a external factor to the promoter.
Adicionalmente, la construcción génica de la invención puede contener marcadores o etiquetas que permiten el aislamiento del péptido de la invención una vez que es sintetizado en la célula. Por otro lado, el polinucleótido o la construcción génica de la invención pueden estar formando parte de un vector. Así, en otro aspecto, la invención se relaciona con un vector, de aquí en adelante“vector de la invención”, que comprende el polinucleótido o la construcción génica de la invención. El término "vector", como se usa en el presente documento, se refiere a una secuencia de ácido nucleico que comprende las secuencias necesarias de modo que después de transcribir y traducir dichas secuencias en una célula se genera un polipéptido codificado por el ácido nucleico de la invención. Dicha secuencia está operativamente vinculada a segmentos adicionales que proporcionan su replicación autónoma en una célula huésped de interés. Preferiblemente, el vector es un vector de expresión, que se define como un vector que, además de las regiones de la replicación autónoma en una célula huésped, contiene regiones operativamente unidas al ácido nucleico de la invención y que son capaces de mejorar la expresión de los productos del ácido nucleico según la invención. Los vectores de la invención se pueden obtener por medio de técnicas ampliamente conocidas en el estado de la técnica.
El experto en la materia apreciará que no existe limitación en cuanto al tipo de vector que puede ser utilizado, ya que dicho vector puede ser un vector de clonaje adecuado para la propagación o un vector de expresión. Así, vectores adecuados de acuerdo a la presente invención incluyen, sin limitar a, (i) vectores de expresión en procariotas tales como pUC18, pUC19, Bluescript y sus derivados, mp18, mp19, pBR322, pMB9, Col El, pCRI, RP4, fagos y vectores "shuttle" tales como pSA3 and pAT28, (ii) vectores de expresión en levaduras tales como vectores del tipo de plásmidos de 2 mieras, plásmidos de integración, vectores YEP, plásmidos centroméricos y similares, (iii) vectores de expresión en células de insectos tales como los vectores de la serie pAC y de la serie pVL, (¡v) vectores de expresión en plantas tales como vectores de la serie pIBI, pEarleyGate, pAVA, pCAMBIA, pGSA, pGWB, pMDC, pMY, pORE y similares y (v) vectores de expresión en células eucariotas superiores bien basados en vectores virales, entre los que se incluyen, sin limitar a, adenovirus, virus asociados a los adenovirus así como retrovirus y lentivirus, así como vectores no virales entre los que se incluyen, sin limitar a, pSilencer 4.1-CMV (Ambion), pcDNA3, pcDNA3.1/hygpHCMV/Zeo, pCR3.1, pEFVHis, pIND/GS, pRc/HCMV2, pSV40/Ze02, pTRACER HCMV, pUB6N5-His, pVAXI, pZeoSV2, pCI, pSVL and pKSV-10, pBPV-1, pML2d y pTDTI. Additionally, the gene construct of the invention may contain labels or tags that allow the isolation of the peptide of the invention once it is synthesized in the cell. On the other hand, the polynucleotide or the gene construct of the invention may be part of a vector. Thus, in another aspect, the invention relates to a vector, hereinafter "vector of the invention", comprising the polynucleotide or the gene construct of the invention. The term "vector", as used herein, refers to a nucleic acid sequence that comprises the necessary sequences so that upon transcription and translation of those sequences into a cell, a polypeptide encoded by the nucleic acid of the invention. Said sequence is operatively linked to additional segments that provide its autonomous replication in a host cell of interest. Preferably, the vector is an expression vector, which is defined as a vector that, in addition to the regions of autonomous replication in a host cell, contains regions operatively linked to the nucleic acid of the invention and that are capable of enhancing the expression of the nucleic acid products according to the invention. The vectors of the invention can be obtained by means of techniques widely known in the state of the art. The person skilled in the art will appreciate that there is no limitation as to the type of vector that can be used, since said vector can be a cloning vector suitable for propagation or an expression vector. Thus, suitable vectors according to the present invention include, without limitation, (i) prokaryotic expression vectors such as pUC18, pUC19, Bluescript and its derivatives, mp18, mp19, pBR322, pMB9, Col El, pCRI, RP4, phages and shuttle vectors such as pSA3 and pAT28, (ii) yeast expression vectors such as 2-micron plasmid type vectors, integration plasmids, YEP vectors, centromeric plasmids and the like, (iii) expression vectors in insect cells such as pAC series and pVL series vectors, (¡v) plant expression vectors such as pIBI series vectors, pEarleyGate, pAVA, pCAMBIA, pGSA, pGWB, pMDC, pMY, pORE and Similar and (v) superior eukaryotic cell expression vectors well based on viral vectors, including, but not limited to, adenoviruses, adenovirus-associated viruses as well as retroviruses and lentiviruses, as well as non-viral vectors including include, without limitation, pSilencer 4.1-CMV (Ambion), pcDNA3, pcDNA3.1 / hygpHCMV / Zeo, pCR3.1, pEFVHis, pIND / GS, pRc / HCMV2, pSV40 / Ze02, pTRACER HCMV, pUB6N5-His, pVAXI, pZeoSV2, pCI, pSVL pKSV-10, pBPV-1, pML2d and pTDTI.
El vector de la invención puede ser utilizado para transformar, transfectar o infectar células susceptibles de ser transformadas, transfectadas o infectadas por dicho vector. The vector of the invention can be used to transform, transfect or infect cells capable of being transformed, transfected or infected by said vector.
Dichas células pueden ser procariotas o eucariotas. A modo de ejemplo, el vector donde se introduce dicha secuencia de ADN puede ser un plásmido o un vector que, cuando se introduce en una célula hospedadora, se integra en el genoma de dicha célula y se replica junto con el cromosoma/s en el/los que se ha integrado. La obtención de dicho vector puede realizarse por métodos convencionales conocidos por los técnicos en la materia. Said cells can be prokaryotes or eukaryotes. By way of example, the vector into which said DNA sequence is introduced can be a plasmid or a vector that, when introduced into a host cell, is integrated into the genome of said cell and replicates together with the chromosome / s in the / those that have been integrated. Obtaining said vector can be carried out by conventional methods known to those skilled in the art.
Por lo tanto, en otro aspecto, la invención se refiere a una célula, de aquí en adelante “célula de la invención”, que comprende un péptido, una proteína de fusión, un polinucleótido, una construcción génica o un vector según la presente invención, para lo cual dicha célula ha podido ser transformada, transfectada o infectada con la construcción o el vector proporcionados por esta invención. Células transformadas, transfectadas o infectadas pueden ser obtenidas por métodos convencionales conocidos por los expertos en la materia, que incluyen, sin limitarse a, electroporación,
fusión de protoplastos, coprecipitación con fosfato de calcio (CaPO4) y precipitación con cloruro de calcio (CaCl2). Therefore, in another aspect, the invention relates to a cell, hereinafter "cell of the invention", comprising a peptide, a fusion protein, a polynucleotide, a gene construct, or a vector according to the present invention , for which said cell has been able to be transformed, transfected or infected with the construct or vector provided by this invention. Transformed, transfected or infected cells can be obtained by conventional methods known to those skilled in the art, including, without limitation, electroporation, protoplast fusion, co-precipitation with calcium phosphate (CaPO 4 ) and precipitation with calcium chloride (CaCl 2 ).
En una realización particular, dicha célula hospedadora es una célula animal, preferentemente una célula de mamífero y más preferentemente una célula humana, transfectada o infectada con un vector apropiado. In a particular embodiment, said host cell is an animal cell, preferably a mammalian cell and more preferably a human cell, transfected or infected with an appropriate vector.
Células huésped adecuadas para la expresión del polipéptido de la invención incluyen, sin limitar a, células de mamíferos, células de plantas, células de insectos, células de hongos y células bacterianas. Células de mamíferos adecuadas para en la presente invención incluyen líneas celulares epiteliales (porcinas, humanas, etc.), líneas celulares de osteosarcoma (humanas, etc.), líneas celulares de neuroblastoma (humanas, etc.), carcinomas epiteliales (humanos, etc.), células gliales (murinas, humanas, etc.), líneas celulares hepáticas (de mono, etc.), células CHO (ChineseHamsterOvary), células COS, células BHK, células HeLa, 911, AT1080, A549, 293 o PER.C6, células ECCs humana 5 NTERA-2, células D3 de la línea de mESCs, células troncales embrionarias humanas tales como HS293 y BGV01, SHEF1, SHEF2 y HS181, células NIH3T3, 293T, REH Y MCF-7 y células hMSCs (human mesenchymalstemcells), y células GliNS2 (células madre de glioma). Suitable host cells for expression of the polypeptide of the invention include, but are not limited to, mammalian cells, plant cells, insect cells, fungal cells, and bacterial cells. Mammalian cells suitable for in the present invention include epithelial cell lines (porcine, human, etc.), osteosarcoma cell lines (human, etc.), neuroblastoma cell lines (human, etc.), epithelial carcinomas (human, etc.). .), glial cells (murine, human, etc.), liver cell lines (monkey, etc.), CHO cells (ChineseHamsterOvary), COS cells, BHK cells, HeLa cells, 911, AT1080, A549, 293 or PER. C6, human ECCs 5 NTERA-2 cells, mESC line D3 cells, human embryonic stem cells such as HS293 and BGV01, SHEF1, SHEF2 and HS181, NIH3T3, 293T, REH and MCF-7 cells and hMSCs cells (human mesenchymalstemcells ), and GliNS2 cells (glioma stem cells).
En otro aspecto, la invención se refiere a una composición, preferiblemente una composición farmacéutica o cosmética, que comprende una cantidad terapéuticamente o cosméticamente eficaz del péptido, proteína de fusión, nanopartícula, partícula similar a virus, polinucleótido, construcción génica, vector o célula de la invención, y opcionalmente un excipiente o vehículo farmacéuticamente o cosméticamente aceptable. In another aspect, the invention relates to a composition, preferably a pharmaceutical or cosmetic composition, comprising a therapeutically or cosmetically effective amount of the peptide, fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector or cell of the invention, and optionally a pharmaceutically or cosmetically acceptable excipient or vehicle.
El péptido, la proteína de fusión, la nanopartícula, la partícula similar a un virus, el polinucleótido, la construcción génica, el vector y la célula de la invención se han definido previamente. The peptide, fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector, and cell of the invention have been previously defined.
Como se usa en la presente invención, la expresión "composición farmacéutica" se refiere a una formulación que se ha adaptado para administrar una dosis predeterminada de uno o varios agentes terapéuticos útiles a una célula, un grupo de células, un órgano, un tejido o un animal en el que existe daño o herida y requiere regeneración tisular y/o celular.
Como se usa en la presente invención, la expresión "composición cosmética” se refiere a una formulación que se ha adaptado para administrar una dosis predeterminada de uno o varios agentes cosméticos útiles a una célula, un grupo de células, un órgano, un tejido o un animal en el que existe daño estético o herida y requiere regeneración tisular y/o celular. As used in the present invention, the term "pharmaceutical composition" refers to a formulation that has been adapted to administer a predetermined dose of one or more useful therapeutic agents to a cell, a group of cells, an organ, a tissue or an animal in which there is damage or injury and requires tissue and / or cell regeneration. As used in the present invention, the term "cosmetic composition" refers to a formulation that has been adapted to administer a predetermined dose of one or more useful cosmetic agents to a cell, a group of cells, an organ, a tissue or an animal in which there is aesthetic damage or injury and requires tissue and / or cell regeneration.
La expresión "cantidad terapéuticamente o cosméticamente eficaz", como se usa en este documento, se entiende como una cantidad capaz de proporcionar un efecto terapéutico o cosmético, y que puede ser determinada por el experto en la materia por los medios comúnmente utilizados. La cantidad de péptido, proteína de fusión, nanopartícula, partícula similar a un virus, polinucleótido, construcción génica, vector o célula de la invención que puede incluirse en las composiciones farmacéuticas o cosméticas según la invención variará dependiendo del sujeto y del modo particular de la administración. The term "therapeutically or cosmetically effective amount", as used herein, is understood as an amount capable of providing a therapeutic or cosmetic effect, and which can be determined by the person skilled in the art by commonly used means. The amount of the peptide, fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector or cell of the invention that can be included in the pharmaceutical or cosmetic compositions according to the invention will vary depending on the subject and in the particular way of the administration.
La dosis adecuada del principio o principios activos dentro de la composición farmacéutica o cosmética dependerá del tipo de daño tisular a tratar, la gravedad y el curso de la enfermedad o daño, si la composición se administra con fines cosméticos, preventivos o terapéuticos, terapia previa, historia clínica del paciente y la respuesta al péptido o polipéptido, y la discreción del médico tratante. La cantidad de péptido, proteína de fusión, nanopartícula, partícula similar a un virus, polinucleótido, construcción génica, vector o célula de la invención se administra adecuadamente al paciente o sujeto en un momento o durante una serie de tratamientos. Dependiendo del tipo y la gravedad de la enfermedad o daño, un nivel de dosis apropiado generalmente será de aproximadamente 0,1 a aproximadamente 10 mg / kg; más preferiblemente de aproximadamente 0,5 a aproximadamente 5 mg / kg, incluso más preferiblemente de aproximadamente 0,75 a aproximadamente 2,5 mg / kg, aún más preferiblemente de aproximadamente 1 mg / kg, que puede administrarse en dosis únicas o múltiples. Los compuestos pueden administrarse en un régimen de 1 a varias veces por día o por dos, tres, cuatro, cinco, seis o siete días, preferiblemente una vez cada dos días. La composición farmacéutica o cosmética se puede administrar durante al menos 1 , 2, 3, 4, 5, 6, 7, 14, 21 , 28 o más días, preferiblemente durante 14 días. La composición farmacéutica o cosmética se puede administrar preferiblemente una vez cada dos días durante 14 días.
Las composiciones farmacéuticas de la invención también contienen uno o varios excipientes farmacéuticamente aceptables adicionales. Por "excipiente farmacéuticamente aceptable" se entiende una sustancia terapéuticamente inactiva que se utiliza para incorporar el ingrediente activo y que es aceptable para el paciente desde un punto de vista farmacológico/toxicológico y para el químico farmacéutico que lo fabrica desde un punto físico/químico con respecto a la composición, formulación, estabilidad, aceptación del paciente y biodisponibilidad. El excipiente o vehículo también incluye cualquier sustancia que sirva para mejorar el suministro y la eficacia del principio activo dentro de la composición farmacéutica. Los ejemplos de vehículos farmacéuticamente aceptables incluyen uno o más de la lista que comprende: agua, solución salina, solución salina tamponada con fosfato, dextrosa, glicerol, etanol y similares, así como combinaciones de los mismos. En muchos casos, será preferible incluir agentes ¡sotónicos, por ejemplo, azúcares, polialcoholes tales como manitol, sorbitol o cloruro de sodio en la composición. Los vehículos farmacéuticamente aceptables pueden comprender además cantidades menores de sustancias auxiliares, tales como agentes humectantes o emulsionantes, conservantes o tampones, que mejoran la vida útil o la eficacia de la proteína de fusión o de las composiciones que forman parte de las composiciones farmacéuticas. Ejemplos de vehículos adecuados son bien conocidos en la literatura. Ejemplos de vehículos sin limitación son una serie de sacáridos tales como lactosa, dextrosa, sacarosa, sorbitol, manitol, xilitol, eritritol y maltitol; una serie de almidones como almidón de maíz, almidón de trigo, almidón de arroz y almidón de patata; una serie de celulosa tal como celulosa, metil celulosa, carboximetil celulosa sódica e hidroxipropilmetil celulosa; y una serie de relleno como la gelatina y la polivinilpirrolidona. En algunos casos, se puede agregar un desintegrante como polivinilpirrolidona reticulada, agar, ácido algínico o alginato de sodio. The appropriate dose of the active ingredient (s) within the pharmaceutical or cosmetic composition will depend on the type of tissue damage to be treated, the severity and course of the disease or damage, whether the composition is administered for cosmetic, preventive or therapeutic purposes, prior therapy , patient's medical history and response to the peptide or polypeptide, and the discretion of the treating physician. The amount of the peptide, fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector, or cell of the invention is suitably administered to the patient or subject at one time or during a series of treatments. Depending on the type and severity of the disease or damage, an appropriate dose level will generally be from about 0.1 to about 10 mg / kg; more preferably from about 0.5 to about 5 mg / kg, even more preferably from about 0.75 to about 2.5 mg / kg, even more preferably about 1 mg / kg, which can be administered in single or multiple doses. The compounds can be administered on a regimen of 1 to several times per day or for two, three, four, five, six or seven days, preferably once every other day. The pharmaceutical or cosmetic composition can be administered for at least 1, 2, 3, 4, 5, 6, 7, 14, 21, 28 or more days, preferably for 14 days. The pharmaceutical or cosmetic composition can preferably be administered once every other day for 14 days. The pharmaceutical compositions of the invention also contain one or more additional pharmaceutically acceptable excipients. By "pharmaceutically acceptable excipient" is meant a therapeutically inactive substance that is used to incorporate the active ingredient and that is acceptable to the patient from a pharmacological / toxicological point of view and to the pharmaceutical chemist who manufactures it from a physical / chemical point of view. regarding composition, formulation, stability, patient acceptance and bioavailability. The excipient or vehicle also includes any substance that serves to improve the supply and efficacy of the active ingredient within the pharmaceutical composition. Examples of pharmaceutically acceptable carriers include one or more of the list comprising: water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, and the like, as well as combinations thereof. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances, such as wetting or emulsifying agents, preservatives, or buffers, that improve the shelf life or efficacy of the fusion protein or of the compositions that are part of the pharmaceutical compositions. Examples of suitable vehicles are well known in the literature. Examples of vehicles without limitation are a series of saccharides such as lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, and maltitol; a series of starches such as corn starch, wheat starch, rice starch and potato starch; a series of cellulose such as cellulose, methyl cellulose, sodium carboxymethyl cellulose and hydroxypropylmethyl cellulose; and a series of fillers such as gelatin and polyvinylpyrrolidone. In some cases, a disintegrant such as cross-linked polyvinylpyrrolidone, agar, alginic acid, or sodium alginate can be added.
La composición cosmética además puede comprender adyuvantes, excipientes y otros aditivos habituales en el campo cosmético y dermatológico, tales como por ejemplo y sin sentido limitativo, estabilizantes, conservantes, antioxidantes, disolventes, perfumes, agentes quelantes, absorbentes de olor, filtros químicos o minerales, pigmentos minerales, solventes orgánicos, siliconas, espesantes, suavizantes, emulsionantes, agentes antiespumantes, hidratantes, fragancias, tensioactivos, polímeros aniónicos, catiónicos, no iónicos o anfóteros o sus mezclas, agentes secuestrantes, propulsores, agentes acidificantes o basificantes, tintes, colorantes, pigmentos o nanopigmentos, o cualquier otro ingrediente normalmente usado en
productos y composiciones cosméticas. The cosmetic composition may further comprise adjuvants, excipients and other usual additives in the cosmetic and dermatological field, such as, for example and without limitation, stabilizers, preservatives, antioxidants, solvents, perfumes, chelating agents, odor absorbers, chemical or mineral filters. , mineral pigments, organic solvents, silicones, thickeners, softeners, emulsifiers, antifoaming agents, moisturizers, fragrances, surfactants, anionic, cationic, nonionic or amphoteric polymers or their mixtures, sequestering agents, propellants, acidifying or basifying agents, dyes, colorants , pigments or nanopigments, or any other ingredient normally used in cosmetic products and compositions.
La composición de la invención puede comprender, además, cualquier sustancia que pueda administrarse a una herida, lesión de tejido o sitio de inflamación. Por ejemplo, la composición divulgada puede comprender además una o más clases de antibióticos (por ejemplo aminoglucósidos, cefalosporinas, cloramfenicol, clindamicina, eritromicinas, fluoroquinolonas, macrolidos, azolidos, metronidazol, penicilinas, tetraciclinas, trimetoprima-sulfametoxazol, vancomicina), esteroides (por ejemplo andranos (por ejemplo testosterona), colestanos (por ejemplo colesterol), ácidos cólicos (por ejemplo ácido col ico), corticosteroides (por ejemplo dexametasona), estraenos (por ejemplo estradiol), pregnanos (por ejemplo progesterona), analgésicos narcóticos y no narcóticos (por ejemplo morfina, codema, heroma, hidromorfona, levorfanol, meperidina, metadona, oxicodona, propoxifeno, fentanilo, metadona, naloxona, buprenorfina, butorfanol, nalbufina, pentazocina), quimioterapia (por ejemplo fármacos anticancengenos tales como, pero sin limitarse a, altretamina, asparaginasa, bleomicina, busulfano, carboplatino, carmustina, clorambucilo, cisplatino, cladribina, ciclofosfamida, citarabina, dacarbazina, dietilestilbesterol, etinilestradiol, etoposido, floxuridina, fludarabina, fluorouracilo, flutamida, goserelina, hidroxiurea, idarubicina, ifosfamida, leuprolida, levamisol, lomustina, mecloretamina, medroxiprogesterona, megestrol, melfalan, mercaptopurina, metotrexato, mitomicina, mitotano, mitoxantrona, paclitaxel, pentostatina, pipobroman, plicamicina, prednisona, procarbazina, estreptozocina, tamoxifeno, teniposido, vinblastina, vincristina), agentes antiinflamatorios (por ejemplo alclofenaco; alclometasona dipropionato; algestona acetonida; alfa amilasa; amcinafal; amcinafida; amfenaco sodico; clorhidrato de amiprilosa; anakinra; anirolaco; anitrazafeno; apazona; balsalazida disodica; bendazaco; benoxaprofeno; clorhidrato de bencidamina; bromelamas; broperamol; budesonida; carprofeno; cicloprofeno; cintazona; cliprofeno; propionato de clobetasol; butirato de clobetasona; clopiraco; propionato de cloti casona; acetato de cormetasona; cortodoxona; decanoato; deflazacort; delatestrilo; depo-testosterona; desonida; desoximetasona; dipropionato de dexametasona; diclofenaco potásico; diclofenaco sodico; diacetato de diflorasona; diflumidona sódica; diflunisal; difluprednato; diftalona; dimetilsulfoxido; drocinonida; endrisona; enlimomab; enolicam sodico; epirizol; etodolaco; etofenamato; felbinaco; fenamol; fenbufeno; fenclofenaco; fencloraco; fendosal; fenpipalona; fentiazaco; flazalona; fluazacort; ácido flufenamico; flumizol; acetato de flunisolida; flunixina; flunixina meglumina; fluocortibutilo; acetato de fluorometolona; flucuazona; flurbiprofeno; fluretofeno; propionato de fluticasona;
furaprofeno; furobufeno; halcinonida; propionato de halobetasol; acetato de halopredona; ibufenaco; ibuprofeno; ibuprofeno aluminio; ibuprofeno piconol; iionidap; indometacina; indometacina sódica; indoprofeno; indoxol; intrazol; acetato de isoflupredona; isoxepaco; isoxicam; ketoprofeno; clorhidrato de lofemizol; lomoxicam; etabonato de loteprednol; meclofenamato sodico; ácido meclofenamico; dibutirato de meclorisona; ácido mefenamico; mesalamina; meseclazona; mesterolona; metandrostenolona; metenolona; acetato de metenolona; suleptanato de metilprednisolona; momiflumato; nabumetona; nandrolona; naproxeno; naproxeno sodico; naproxol; nimazona; olsalazina sódica; orgotema; orpanoxina; oxandrolona; oxaprozina; oxifenbutazona; oximetolona; clorhidrato de paranilina; polisulfato de pentosano sodico; glicerato de fenbutazona sodico; pirfenidona; piroxicam; cinamato de piroxicam; piroxicam olamina; pirprofeno; prednazato; prifelona; acido prodolico; provuazona; proxazol; citrato de proxazol; rimexolona; romazarit; salcolex; salnacedina; salsalato; cloruro de sanguinario; seclazona; sermetacina; estanozolol; sudoxicam; sulindaco; suprofeno; talmetacina; talniflumato; talosalato; tebufelona; tenidap; tenidap sodico; tenoxicam; tesicam; tesimida; testosterona; combinaciones de testosterona; tetridamina; tiopinaco; tixocortol pivalato; tolmetina; tolmetina sódica; triclonida; triflumidato; zidometacina; zomepiraco sodico), o agentes antihistammicos (por ejemplo etanolaminas (como difenhidramina carbinoxamina), etilendiamina (como tripelenamina pirilamina), alquilamina (como clorfeniramina, dexclorfeniramina, bromfeniramina, triprolidina), otras antihistaminas como astemizol, loratadina, fexofenadina, brofeniramina, clemastina, acetaminofeno, pseudoefedrina, triprolidina). The composition of the invention may further comprise any substance that can be administered to a wound, tissue injury, or site of inflammation. For example, the disclosed composition may further comprise one or more classes of antibiotics (eg aminoglycosides, cephalosporins, chloramphenicol, clindamycin, erythromycin, fluoroquinolones, macrolides, azolides, metronidazole, penicillins, tetracyclines, trimethoprim-sulfamethoxazole, vancomins) for example andrans (for example testosterone), cholestanes (for example cholesterol), colic acids (for example col ico acid), corticosteroids (for example dexamethasone), estranes (for example estradiol), pregnanes (for example progesterone), narcotic analgesics and no narcotics (eg morphine, codema, heroma, hydromorphone, levorphanol, meperidine, methadone, oxycodone, propoxyphene, fentanyl, methadone, naloxone, buprenorphine, butorphanol, nalbuphine, pentazocine), chemotherapy (eg anti-cancer drugs such as, but , altretamine, asparaginase, bleomycin, busulfan, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, cyclophosphamide, cytarabine, dacarbazine, diethylstilbesterol, ethinyl estradiol, etoposide, floxuridine, fludarabine, fluorouracil, flutamide, goserelin, hydroxyurea, idarubicin, meloprine, leuprine, mexepine, mecloretin, mechoretin, mechoretin mitoxantrone, paclitaxel, pentostatin, pipobroman, plicamycin, prednisone, procarbazine, streptozocin, tamoxifen, teniposide, vinblastine, vincristine), anti-inflammatory agents (eg alclofenac; alclomethasone dipropionate; algestone acetonide; alpha amylase; amcinafal; amcinafide; sodium amfenac; amiprilose hydrochloride; anakinra; anirolaco; anitrazaphene; apazon balsalazide disodium; bendazaco; benoxaprofen; benzydamine hydrochloride; jokes broperamol; budesonide; carprofen; cycloprofen; tape cliprofen; clobetasol propionate; chlobetasone butyrate; clopyraco; cloti casona propionate; cormetasone acetate; Cortodoxone; decanoate; deflazacort; delatestrile; depo-testosterone; disonide deoxymethasone; dexamethasone dipropionate; diclofenac potassium; diclofenac sodium; diflorasone diacetate; diflumidone sodium; diflunisal; difluprednate; diphtalone; dimethyl sulfoxide; drocinonide; endrisone; enlimomab; enolicam sodium; epirizole; etodolac; ethofenamate; felbinaco; fenamol; fenbufen; fenclofenac; phenchloracus; fendosal; fenpipalone; fentiazaco; flazalone; fluazacort; flufenamic acid; flumizole; flunisolide acetate; flunixin; flunixin meglumine; fluocortibutyl; fluorometolone acetate; flucuazone; flurbiprofen; fluretophen; fluticasone propionate; furaprofen; furobufen; halcinonide; halobetasol propionate; halopredone acetate; ibufenaco; ibuprofen; aluminum ibuprofen; ibuprofen piconol; iionidap; indomethacin; indomethacin sodium; indoprofen; indoxol; intrazole; isoflupredone acetate; isoxepaque; isoxicam; ketoprofen; lofemizole hydrochloride; lomoxicam; loteprednol etabonate; sodium meclofenamate; meclofenamic acid; mechlorisone dibutyrate; mefenamic acid; mesalamine; meseclazone; mesterolone; methandrostenolone; methenolone; methenolone acetate; methylprednisolone suptanate; momiflumate; nabumetone; nandrolone; naproxen; sodium naproxen; naproxol; nimazone; olsalazine sodium; orgotem; orpanoxine; oxandrolone; oxaprozine; oxyphenbutazone; oxymetholone; paraniline hydrochloride; sodium pentosan polysulfate; sodium fenbutazone glycerate; pirfenidone; piroxicam; piroxicam cinnamate; piroxicam olamine; pirprofen; prednazate; priphelon; prodolic acid; provuazone; proxazole; proxazole citrate; rimexolone; romazarit; salcolex; salnacedine; salsalate; bloody chloride; seclazone; sermetacin; stanozolol; sudoxicam; sulindac; suprofen; talmetacin; talniflumate; talosalate; tebufelone; tenidap; sodic tenidap; tenoxicam; tesicam; tesimida; testosterone; testosterone combinations; tetridamine; thiopinac; thixocortol pivalate; tolmetin; tolmetin sodium; triclonide; triflumidate; zidomethacin; sodium zomepiracum), or antihistaminic agents (for example ethanolamines (such as diphenhydramine carbinoxamine), ethylenediamine (such as tripelenamine pyrilamine), alkylamine (such as chlorpheniramine, dexchlorpheniramine, brompheniramine, phenatadine, bromathenamine, phenatadine, bromatheramine, phenatadine, phenatadine, brompheniramine, phenatadine, phenatadine, bromatheramine, phenylephrine, other drugs, , pseudoephedrine, triprolidine).
Las composiciones farmacéuticas o cosméticas de la invención pueden administrarse por cualquier tipo de vía adecuada, tal como por vía oral, nasal, ocular, tópica, intradérmica, intracraneal o intravenosa. La vía de administración preferida de dichas composiciones farmacéuticas es la vía oral, nasal, ocular, tópica, intracraneal o intradérmica. The pharmaceutical or cosmetic compositions of the invention can be administered by any suitable type of route, such as orally, nasally, ocularly, topically, intradermally, intracranially, or intravenously. The preferred route of administration of such pharmaceutical compositions is the oral, nasal, ocular, topical, intracranial or intradermal route.
"Vía oral" se entiende como la composición farmacéutica incorporada en el organismo después de la deglución. "Oral route" is understood as the pharmaceutical composition incorporated into the body after swallowing.
Se entiende por "vía nasal" la administración de la composición farmacéutica insuflada por la nariz. By "nasal route" is meant the administration of the pharmaceutical composition blown into the nose.
"Vía ocular" se entiende como la administración tópica de la composición
farmacéutica por instilación directamente en el ojo. "Ocular route" is understood as the topical administration of the composition Pharmaceutical instillation directly into the eye.
La“vía tópica” se entiende como la aplicación en el exterior del cuerpo, como, por ejemplo, la piel, el cuero cabelludo y las uñas; y también la aplicación a mucosas tales como, sin limitación, mucosa bucal, nasal o rectal. The "topical route" is understood as the application on the outside of the body, such as, for example, the skin, the scalp and the nails; and also the application to mucosa such as, without limitation, oral, nasal or rectal mucosa.
"Vía intradérmica" se entiende como la administración de la composición farmacéutica mediante la inyección en la dermis. "Intradermally" is understood as the administration of the pharmaceutical composition by injection into the dermis.
"Vía intracraneal" se entiende como la administración de la composición farmacéutica dentro del cráneo. "Intracranial route" is understood as the administration of the pharmaceutical composition into the skull.
"Vía intravenosa" se entiende como la administración de la composición farmacéutica mediante la inyección en el flujo sanguíneo. "Intravenous route" is understood as the administration of the pharmaceutical composition by injection into the blood stream.
Preferiblemente, la composición cosmética de la presente invención, puede presentarse, por ejemplo y sin sentido limitativo, en forma de una disolución acuosa, hidroalcohólica u oleosa, una emulsión de aceite en agua o de agua en aceite, o múltiple, de un gel acuoso u oleoso, de un producto anhidro líquido, de una dispersión de aceite en una fase acuosa con la ayuda de esferoides (como por ejemplo nanoesferas, nanocápsulas y vesículas lipídicas), emulsiones de silicona en agua, microemulsiones, pastas, leches, bálsamos, espumas, lociones, cremas, jabones, soluciones hidroalcóholicas, soluciones hidroglicólicas, linimentos, sueros, serums, films de polisacáridos, ungüentos, ungüentos grasos, mousses, pomadas, geles, geles crema, geles de espuma, emulsión-geles y soluciones. Preferably, the cosmetic composition of the present invention may be presented, for example and without limitation, in the form of an aqueous, hydroalcoholic or oily solution, an oil-in-water or water-in-oil emulsion, or multiple, of an aqueous gel or oily, from an anhydrous liquid product, from an oil dispersion in an aqueous phase with the help of spheroids (such as nanospheres, nanocapsules and lipid vesicles), silicone emulsions in water, microemulsions, pastes, milks, balms, foams , lotions, creams, soaps, hydroalcoholic solutions, hydro-glycolic solutions, liniments, serums, serums, polysaccharide films, ointments, fatty ointments, mousses, ointments, gels, cream gels, foam gels, emulsion-gels and solutions.
En la presente invención también se contemplan materiales que comprenden las composiciones divulgadas en el presente documento (por ejemplo, péptidos, proteínas de fusión, ácidos nucleicos, vectores, células, polinucleótidos, etc.). Por ejemplo, se divulgan materiales usados para tratar heridas, en los que los materiales están recubiertos con el péptido, proteína de fusión, nanopartícula, la partícula similar a un virus, polinucleótido, vector, célula o composición de la invención. Ejemplos ilustrativos, no limitativos, de materiales usados para tratar heridas incluyen vendajes, cinta quirúrgica, suturas, grapas o injertos (por ejemplo, injertos de piel). Materials comprising the compositions disclosed herein are also contemplated by the present invention (eg, peptides, fusion proteins, nucleic acids, vectors, cells, polynucleotides, etc.). For example, materials used to treat wounds are disclosed, in which the materials are coated with the peptide, fusion protein, nanoparticle, the virus-like particle, polynucleotide, vector, cell, or composition of the invention. Illustrative, non-limiting examples of materials used to treat wounds include bandages, surgical tape, sutures, staples, or grafts (eg, skin grafts).
Por ejemplo, el material (vendaje, cinta quirúrgica, sutura, grapa, injerto) puede remojarse en el péptido divulgado a una concentración adecuada. El material puede
secarse entonces y sellarse en un recipiente estéril. El péptido también puede incorporarse en un sistema de hidrogel reticulable, tal como el poli(ácido láctico-co- glicólico) (PLGA) o poliuretano, que puede entonces diseñarse como materiales para tratar heridas (por ejemplo, vendaje, cinta quirúrgica, sutura, grapa, injerto). Por tanto, se divulgan materiales compuestos de hidrogel-péptido. For example, the material (bandage, surgical tape, suture, staple, graft) can be soaked in the disclosed peptide at a suitable concentration. The material can Then dry and seal in a sterile container. The peptide can also be incorporated into a crosslinkable hydrogel system, such as poly (lactic-co-glycolic acid) (PLGA) or polyurethane, which can then be designed as materials to treat wounds (eg, bandage, surgical tape, suture, staple, graft). Thus, hydrogel-peptide composites are disclosed.
También se divulgan implantes médicos recubiertos con el péptido de la invención antes de su implantación en un sujeto. Por ejemplo, un problema común en tales cirugías de implante es la formación de una cápsula de contracción alrededor del implante a partir de la formación de tejido cicatricial que conduce a un endurecimiento indebido, contracción y finalmente deformación del tejido de interés. El uso de los presentes poiipéptidos en o sobre el implante puede reducir o evitar esta deformación. Ejemplos no limitativos de implantes médicos incluyen: prótesis de extremidades, implantes de mama, implantes de pene, implantes testiculares, ojos artificiales, implantes faciales, articulaciones artificiales, prótesis de válvulas cardiacas, prótesis vasculares, prótesis dentales, prótesis faciales, válvula de disco inclinado, válvula de bola enjaulada, prótesis de oído, prótesis de nariz, marcapasos, implantes cocleares y sustitutos de la piel (por ejemplo, heteroinjerto porcino/piel de cerdo, BIOBRANE, queratinocitos cultivados). Medical implants coated with the peptide of the invention are also disclosed prior to implantation in a subject. For example, a common problem in such implant surgeries is the formation of a contraction capsule around the implant from the formation of scar tissue leading to undue hardening, contraction, and ultimately deformation of the tissue of interest. The use of the present polypeptides in or on the implant can reduce or prevent this deformation. Non-limiting examples of medical implants include: limb prostheses, breast implants, penile implants, testicular implants, artificial eyes, facial implants, artificial joints, heart valve prostheses, vascular prostheses, dental prostheses, facial prostheses, inclined disc valve , caged ball valve, hearing aid, nose prosthesis, pacemaker, cochlear implants, and skin substitutes (eg, pig / pig skin heterograft, BIOBRANE, cultured keratinocytes).
El péptido según la invención se recubre sobre un implante médico o material de tratamiento de heridas. Por tanto, otro aspecto de la invención se refiere a un material o implante que comprende el péptido, la proteína de fusión, la nanopartícula, la partícula similar a un virus, el polinucleótido, la construcción génica, el vector, la célula o la composición descritos en la presente invención. The peptide according to the invention is coated on a medical implant or wound treatment material. Therefore, another aspect of the invention relates to a material or implant comprising the peptide, the fusion protein, the nanoparticle, the virus-like particle, the polynucleotide, the gene construct, the vector, the cell or the composition. described in the present invention.
Otro aspecto de la presente invención se refiere al péptido, a la proteína de fusión, la nanopartícula, la partícula similar a un virus, el polinucleótido, la construcción génica, el vector, la célula, la composición, el material o el implante de la presente invención para su uso como medicamento. Alternativamente, este aspecto de la invención se refiere al uso del péptido, a la proteína de fusión, la nanopartícula, la partícula similar a un virus, el polinucleótido, la construcción génica, el vector, la célula, la composición, el material o el implante para la fabricación de un medicamento. Another aspect of the present invention relates to the peptide, the fusion protein, the nanoparticle, the virus-like particle, the polynucleotide, the gene construct, the vector, the cell, the composition, the material or the implant of the present invention for use as a medicine. Alternatively, this aspect of the invention relates to the use of the peptide, the fusion protein, the nanoparticle, the virus-like particle, the polynucleotide, the gene construct, the vector, the cell, the composition, the material or the implant for the manufacture of a medicine.
La presente invención además proporciona un método de promoción de la cicatrización de heridas tras la lesión tisular en un sujeto, que comprende administrar
al sujeto una o más de las composiciones de la presente invención (por ejemplo, péptidos, polinucléotidos o vectores) en un vehículo farmacéuticamente aceptable. Además se divulga un método de tratamiento de un sujeto con lesión tisular, que comprende administrar al sujeto una o más de las composiciones divulgadas en el presente documento (por ejemplo, péptidos, polinucléotidos o vectores) en un vehículo farmacéuticamente aceptable. The present invention further provides a method of promoting wound healing after tissue injury in a subject, comprising administering to the subject one or more of the compositions of the present invention (eg, peptides, polynucleotides or vectors) in a pharmaceutically acceptable vehicle. Further disclosed is a method of treating a subject with tissue injury, comprising administering to the subject one or more of the compositions disclosed herein (eg, peptides, polynucleotides, or vectors) in a pharmaceutically acceptable vehicle.
“Promover,”“promoción” y“que promueve” se refieren a un aumento en una actividad, respuesta, estado, enfermedad u otro parámetro biológico. Esto puede incluir pero no se limita al inicio de la actividad, respuesta, estado o enfermedad. Esto puede incluir también, por ejemplo, un aumento del 10% en la actividad, respuesta, estado o enfermedad en comparación con el nivel nativo o de control. Por tanto, el aumento puede ser del 10, el 20, el 30, el 40, el 50, el 60, el 70, el 80, el 90, el 100%, o cualquier cantidad de aumento entre medias en comparación con los niveles nativos o de control. "Promote," "promotion" and "that promotes" refer to an increase in an activity, response, status, disease, or other biological parameter. This may include but is not limited to the onset of activity, response, status, or disease. This may also include, for example, a 10% increase in activity, response, status, or disease compared to the native or control level. So the increase can be 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of increase in between compared to levels native or control.
Por“tratar” o“tratamiento” se entiende un método de reducción de los efectos de una enfermedad o estado. Tratamiento puede referirse también a un método de reducción de la causa subyacente de la enfermedad o estado en sí, más que solo los síntomas. El tratamiento puede ser cualquier reducción de los niveles nativos y puede ser pero no se limita a la supresión completa de la enfermedad, estado o los síntomas de la enfermedad o estado. Por ejemplo, un método divulgado para promover la cicatrización de heridas se considera un tratamiento si hay una reducción del 10% en uno o más síntomas de la enfermedad en un sujeto con la enfermedad en comparación con niveles nativos en el mismo sujeto o sujetos de control. Por tanto, la reducción puede ser del 10, el 20, el 30, el 40, el 50, el 60, el 70, el 80, el 90, el 100%, o cualquier cantidad de reducción entre medias en comparación con niveles nativos o de control. By "treating" or "treating" is meant a method of reducing the effects of a disease or condition. Treatment may also refer to a method of reducing the underlying cause of the disease or condition itself, rather than just the symptoms. Treatment may be any reduction in native levels and may be but is not limited to complete suppression of the disease, condition or symptoms of the disease or condition. For example, a disclosed method of promoting wound healing is considered a treatment if there is a 10% reduction in one or more symptoms of the disease in a subject with the disease compared to native levels in the same subject or control subjects. . Therefore, the reduction can be 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of reduction in between compared to native levels or control.
Tal como se usa en el presente documento, “sujeto” incluye, pero no se limita a, animales o plantas. El sujeto puede ser un vertebrado, más específicamente un mamífero (por ejemplo, un humano, caballo, cerdo, conejo, perro, oveja, cabra, primate no humano, vaca, gato, cobaya o roedor), un pez, un pájaro o un reptil o un anfibio. El sujeto puede ser un invertebrado, más específicamente un artrópodo (por ejemplo, insectos y crustáceos). El término no indica una edad o sexo particular. Por tanto, se pretende que se cubran sujetos adultos y recién nacidos, así como fetos,
tanto machos como hembras. As used herein, "subject" includes, but is not limited to, animals or plants. The subject may be a vertebrate, more specifically a mammal (eg, a human, horse, pig, rabbit, dog, sheep, goat, non-human primate, cow, cat, guinea pig, or rodent), a fish, a bird, or a reptile or amphibian. The subject may be an invertebrate, more specifically an arthropod (eg, insects and crustaceans). The term does not indicate a particular age or sex. Therefore, it is intended that adult and newborn subjects, as well as fetuses, be covered, both males and females.
Otro aspecto de la presente invención se refiere a la proteína de fusión, la nanopartícula, la partícula similar a un virus, el polinucleótido, la construcción génica, el vector, la célula, la composición, el material o el implante de la presente invención para su uso en la regeneración celular y/o tisular, en particular para su uso en el tratamiento de una herida, preferiblemente la herida es seleccionada del grupo que consiste en una herida de la piel, una úlcera de decúbito y/o una herida externa o interna. Another aspect of the present invention relates to the fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector, cell, composition, material, or implant of the present invention for its use in cellular and / or tissue regeneration, in particular for use in the treatment of a wound, preferably the wound is selected from the group consisting of a skin wound, a pressure ulcer and / or an external wound or internal.
Otro aspecto de la presente invención se refiere al uso cosmético a la proteína de fusión, la nanopartícula, la partícula similar a un virus, el polinucleótido, la construcción génica, el vector, la célula, la composición, el material o el implante de la presente invención como agente cicatrizante y/o reparador de la piel, preferiblemente, el uso sería en tratamientos dermocosméticos como agente cicatrizante y reparador de la piel o en composiciones dermocosméticas de aplicación tópica. Another aspect of the present invention relates to cosmetic use of the fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector, cell, composition, material, or implant of the The present invention as a healing and / or skin repairing agent, preferably, the use would be in dermocosmetic treatments as a healing and skin repairing agent or in topically applied dermocosmetic compositions.
Otro aspecto de la invención se refiere a un péptido que comprende la secuencia SEQ ID NO: 2, para su uso en la regeneración celular, en particular para su uso en el tratamiento de una herida, preferiblemente la herida es seleccionada del grupo que consiste en una herida de la piel, una úlcera de decúbito y/o una herida externa o interna. Más preferiblemente el péptido comprende la secuencia SEQ ID NO: 1 , SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 o SEQ ID NO: 7. En una realización más preferida el péptido consiste en la secuencia SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 o SEQ ID NO: 7, más preferible el péptido consiste en la secuencia SEQ ID NO: 1 , SEQ ID NO: 5, SEQ ID NO: 6 o SEQ ID NO: 7. Another aspect of the invention relates to a peptide comprising the sequence SEQ ID NO: 2, for use in cell regeneration, in particular for use in treating a wound, preferably the wound is selected from the group consisting of a skin wound, a pressure ulcer, and / or an external or internal wound. More preferably the peptide comprises the sequence SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 or SEQ ID NO: 7. In a more preferred embodiment the peptide It consists of the sequence SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, or SEQ ID NO: 7, most preferably the peptide It consists of the sequence SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 6 or SEQ ID NO: 7.
En la presente invención, el término“regeneración” se refiere al proceso por el que se recupera la estructura y la función de órganos o partes del cuerpo dañados. El proceso de regeneración puede ocurrir en múltiples estados, niveles de la organización biológica y la habilidad de los diferentes organismos para regenerar partes fallantes es altamente variable. La regeneración puede darse a nivel celular (regeneración celular), de tejido (regeneración tisular), de órgano, estructura e incluso del cuerpo entero. Los ejemplos no limitantes de heridas son:
- una herida de quemadura, que es la lesión que resulta de la exposición al calor, electricidad, radiación (por ejemplo, quemaduras solares y cirugía con láser), o productos químicos cáusticos, In the present invention, the term "regeneration" refers to the process by which the structure and function of damaged organs or body parts are recovered. The regeneration process can occur at multiple states, levels of biological organization, and the ability of different organisms to regenerate missing parts is highly variable. Regeneration can take place at the cellular (cellular regeneration), tissue (tissue regeneration), organ, structure and even whole body levels. Non-limiting examples of injuries are: - a burn wound, which is the injury resulting from exposure to heat, electricity, radiation (for example, sunburn and laser surgery), or caustic chemicals,
- úlceras, - ulcers,
- heridas en la diabetes mellitus, que generalmente son lesiones en los pies debido al entumecimiento provocado por daños en nervios (neuropatía diabética) y un menor flujo sanguíneo hacia las piernas y los pies. La lesión más grave es una úlcera en el pie. Las úlceras diabéticas en pies tienen un riesgo muy alto de ser infectadas, y a veces no se pueden curar. Las úlceras en pies que no se han curado son una causa frecuente de amputación en personas con diabetes, - wounds in diabetes mellitus, which are generally foot injuries due to numbness caused by nerve damage (diabetic neuropathy) and decreased blood flow to the legs and feet. The most serious injury is a foot ulcer. Diabetic foot ulcers have a very high risk of being infected, and sometimes cannot be cured. Unhealed foot ulcers are a common cause of amputation in people with diabetes,
- heridas de decúbito, es decir, lesiones provocadas por una presión no mitigada sobre cualquier parte del cuerpo, en especial de porciones sobre áreas óseas o cartilaginosas, decubitus wounds, that is, injuries caused by unmitigated pressure on any part of the body, especially portions on bony or cartilaginous areas,
- heridas debidas a una fuerza externa que daña al tejido, - wounds due to an external force that damages the tissue,
- heridas en la piel debido al envejecimiento o al entorno. Esto incluye, por ejemplo, grietas, piel seca, aspereza de la piel y similares. - skin wounds due to aging or the environment. This includes, for example, cracks, dry skin, roughness of the skin, and the like.
Las heridas pueden ser una herida interna, una herida oral, una herida cutánea, una herida externa, una úlcera y/o una úlcera de decúbito, daño al ojo, una herida en el ojo, por ejemplo, conjuntiva. Otras afecciones que pueden tratarse con los péptidos según la divulgación incluyen úlceras orales, lesiones aftosas orales, glosodinia, lengua ardiente, psoriasis, eccema y pérdida de pelo. The wounds can be an internal wound, an oral wound, a skin wound, an external wound, an ulcer and / or a pressure ulcer, damage to the eye, an eye injury, for example, conjunctiva. Other conditions that can be treated with the peptides according to the disclosure include oral ulcers, oral aphthous lesions, glossodynia, burning tongue, psoriasis, eczema, and hair loss.
Estos tipos de daños y lesiones cutáneos son conocidos por los expertos en la materia. Una herida interna es una herida presente en el cuerpo, por ejemplo, debido a una incisión quirúrgica. Una herida oral es una herida presente en la cavidad oral. Una herida cutánea es una herida presente en la piel. Una herida externa debe entenderse como una herida que es visible y accesible desde fuera del cuerpo. Una úlcera es una lesión en la superficie de la piel o una superficie mucosa. Una úlcera de decúbito es una herida o úlcera provocada por presión prolongada en la piel y tejidos cuando se está en una posición durante un periodo de tiempo largo, tal como tumbado en cama.
Las áreas óseas del cuerpo son los sitios más frecuentemente afectados, que se vuelven isquémicos bajo presión sostenida y constante. El envejecimiento de la piel es el cambio en la apariencia de la piel debido al tiempo o exposición al ambiente o el estado de salud de un individuo. La celulitis es la definición usada en cosmética en relación con una apariencia flácida u ondulada de la piel (piel de naranja en holandés). These types of skin damage and injuries are known to those skilled in the art. An internal wound is a wound present in the body, for example, due to a surgical incision. An oral wound is a wound present in the oral cavity. A skin wound is a wound on the skin. An external wound should be understood as a wound that is visible and accessible from outside the body. An ulcer is an injury to the skin surface or a mucous surface. A pressure ulcer is a wound or ulcer caused by prolonged pressure on the skin and tissues when in a position for a long period of time, such as lying in bed. The bony areas of the body are the most frequently affected sites, which become ischemic under sustained and constant pressure. Skin aging is the change in the appearance of the skin due to time or exposure to the environment or the state of health of an individual. Cellulite is the definition used in cosmetics in relation to a flabby or wavy appearance of the skin (orange peel in Dutch).
En una realización particular de la invención, el péptido de la invención se usa para el tratamiento de una herida cutánea. Las heridas cutáneas pueden ser heridas en la epidermis o la dermis de la piel. Hay varios tipos de heridas en las que la piel o el tejido pueden necesitar reparación: abrasiones, laceraciones, incisiones, perforaciones y avulsiones y quemaduras. El uso de un péptido de acuerdo con la invención puede mejorar el estado de salud general de la piel. En otra realización particular de la invención, el método se usa para el tratamiento de una herida oral. Las heridas orales son heridas en cualquier parte de la cavidad oral en la que la mucosa oral está dañada. En otra realización particular de la invención, el péptido de la invención se usa para el tratamiento de una herida interna. Las heridas internas son heridas en las que se dañan capas celulares de origen endodérmico o mesodérmico. Son ejemplo heridas en arterias o venas, peritoneo o pericardio. Dentro de la presente invención, también se contempla el uso terapéutico o cosmético de todas aquellas realizaciones que, directa o indirectamente, comprenden el péptido que comprende la secuencia SEQ ID NO: 2, para el tratamiento de una herida cutánea tal como se ha definido previamente en la presente descripción. Ejemplos de dichas realizaciones se refieren a la proteína de fusión, la nanopartícula, la partícula similar a un virus, el polinucleótido, la construcción génica, el vector, la célula, la composición, el material o el implante que comprende el péptido que comprende la secuencia SEQ ID NO: 2. Todos estos términos también han sido definidos previamente en la presente descripción. A lo largo de la descripción y las reivindicaciones la palabra "comprende" y sus variantes no pretenden excluir otras características técnicas, aditivos, componentes o pasos. Para los expertos en la materia, otros objetos, ventajas y características de la invención se desprenderán en parte de la descripción y en parte de la práctica de la invención. Los siguientes ejemplos y figuras se proporcionan a modo de ilustración, y no se pretende que sean limitativos de la presente invención.
BREVE DESCRIPCIÓN DE LAS FIGURAS In a particular embodiment of the invention, the peptide of the invention is used for the treatment of a skin wound. Skin wounds can be wounds to the epidermis or dermis of the skin. There are several types of wounds in which the skin or tissue may need repair: abrasions, lacerations, incisions, perforations, and avulsions and burns. The use of a peptide according to the invention can improve the general health of the skin. In another particular embodiment of the invention, the method is used for the treatment of an oral wound. Oral wounds are wounds in any part of the oral cavity in which the oral mucosa is damaged. In another particular embodiment of the invention, the peptide of the invention is used for the treatment of an internal wound. Internal wounds are wounds in which cell layers of endodermal or mesodermal origin are damaged. Examples are wounds in arteries or veins, peritoneum or pericardium. Within the present invention, the therapeutic or cosmetic use of all those embodiments that, directly or indirectly, comprise the peptide comprising the sequence SEQ ID NO: 2, for the treatment of a skin wound as previously defined, is also contemplated. in the present description. Examples of such embodiments relate to the fusion protein, nanoparticle, virus-like particle, polynucleotide, gene construct, vector, cell, composition, material or implant comprising the peptide comprising the sequence SEQ ID NO: 2. All of these terms have also been previously defined in the present description. Throughout the description and claims, the word "comprises" and its variants are not intended to exclude other technical characteristics, additives, components or steps. For those skilled in the art, other objects, advantages, and features of the invention will emerge in part from the description and in part from the practice of the invention. The following examples and figures are provided by way of illustration, and are not intended to be limiting of the present invention. BRIEF DESCRIPTION OF THE FIGURES
Figura 1 (A y B) Efecto del péptido entero de la miticina C en la cicatrización de la herida en células HaCat. Figure 1 (A and B) Effect of the entire peptide of miticin C on wound healing in HaCat cells.
Figura 2. (A) Aspecto de la cola de larvas de pez cebra con la cola intacta. (B) Pez después de seccionar un trozo de cola. (C) Evolución en el tiempo de la regeneración tisular de la cola. (D) Comparación de la regeneración tisular en peces tratados y no tratados con miticina después de 4 días. Figure 2. (A) Appearance of the tail of zebrafish larvae with the tail intact. (B) Fish after sectioning off a piece of tail. (C) Evolution over time of tail tissue regeneration. (D) Comparison of tissue regeneration in fish treated and not treated with miticin after 4 days.
Figura 3. Evolución de la cicatrización de la herida en células HaCat tratadas con los péptidos de la miticina-C. Figure 3. Evolution of wound healing in HaCat cells treated with miticin-C peptides.
Figura 4. Efecto del péptido completo de la miticina en la proliferación de células de queratinocitos humanos (HaCat). Figure 4. Effect of the complete peptide of miticin on the proliferation of human keratinocyte cells (HaCat).
Figura 5. Efecto de los péptidos en la viabilidad celular de células HaCat. Figure 5. Effect of peptides on cell viability of HaCat cells.
Figura 6. Comparación de la regeneración en peces tratados y no tratados con los péptidos de miticina-C después de 4 días. Figure 6. Comparison of regeneration in fish treated and untreated with miticin-C peptides after 4 days.
EJEMPLOS EXAMPLES
A continuación, se ilustrará la invención mediante unos ensayos realizados por los inventores, que pone de manifiesto la efectividad del producto de la invención. Next, the invention will be illustrated by tests carried out by the inventors, which shows the effectiveness of the product of the invention.
Ejemplo 1 : Péptidos y su síntesis Example 1: Peptides and their synthesis
La cadena madura de la miticina-C (Myt-C), compuesta por 40 aminoácidos con la secuencia QSVACRSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR (SEQ ID NO: 1) se tomó como modelo para la síntesis de 14 dodecapéptidos con un desplazamiento de secuencia de dos residuos de amino ácidos y amidados en el carboxilo terminal y acetilados en el amino. La cadena completa y los péptidos así diseñados fueron sintetizados y purificados mediante cromatografía líquida de alta resolución (HPLC) en el servicio de Proteómica del Centro Nacional de Biotecnología del CSIC con una pureza >95%. Sus secuencias fueron verificadas mediante espectrometría de masas.
Las posibles trazas de de ácido trifluoroacético (TFA) del proceso de síntesis, se eliminara con tres ciclos de congelación-liofilización usando como disolvente HCI 10 mM. El contenido del vial (3 mg de cada péptido) fue disuelto en 1 mL de medio de cultivo acuoso DMEM sin suero suplementado con gentamicina y un cóctel de inhibidores de proteasas comercial (Protease Inhibitor Tablets, Thermo Scientific, Ref. 88265) quedando una concentración final de la solución madre de 3 mg/mL (676,8 mM) que se conservó a -80°C antes de su uso. The mature miticin-C (Myt-C) chain, consisting of 40 amino acids with the sequence QSVACRSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR (SEQ ID NO: 1), was taken as a model for the synthesis of 14 dodecapeptides with a sequence shift of two amino acid residues and amidated at the terminal carboxyl and acetylated at the amino. The complete chain and the peptides thus designed were synthesized and purified by high-performance liquid chromatography (HPLC) at the Proteomics service of the National Center for Biotechnology of the CSIC with a purity of> 95%. Its sequences were verified by mass spectrometry. Possible traces of trifluoroacetic acid (TFA) from the synthesis process, will be removed with three freeze-lyophilization cycles using 10 mM HCI as solvent. The content of the vial (3 mg of each peptide) was dissolved in 1 mL of serum-free DMEM aqueous culture medium supplemented with gentamicin and a cocktail of commercial protease inhibitors (Protease Inhibitor Tablets, Thermo Scientific, Ref. 88265) leaving a concentration Final 3 mg / mL (676.8 mM) stock solution which was stored at -80 ° C before use.
Tabla 1: Péptidos sintéticos diseñados a partir de la secuencia de la miticina-C con su peso molecular (P.M.). Ejemplo 2: Determinación de la citotoxicidad de la Miticina C in vitro. Table 1: Synthetic peptides designed from the miticin-C sequence with its molecular weight (MW). Example 2: Determination of the cytotoxicity of Miticin C in vitro.
La determinación de la citotoxicidad in vitro de la cadena madura de miticina C (SEQ ID NO: 1) y de sus fragmentos (Tabla 1) se evaluó en la línea HaCat de queratinocitos humanos, mediante el ensayo de MTT en el intervalo de concentración 0-40 mM (Figuras 4 y 5). Tal como se observa en las Figuras 4 y 5, el tratamiento con los péptidos no afectó a la viabilidad de las células HaCat. The determination of the in vitro cytotoxicity of the mature chain of miticin C (SEQ ID NO: 1) and its fragments (Table 1) was evaluated in the HaCat line of human keratinocytes, by means of the MTT test in the concentration range 0 -40 mM (Figures 4 and 5). As seen in Figures 4 and 5, treatment with the peptides did not affect the viability of HaCat cells.
Ejemplo 3: Determinación de la actividad de reparación de heridas de la Miticina C in vitro. Example 3: Determination of Mythicin C wound repair activity in vitro.
La determinación de la actividad de reparación de heridas in vitro, se llevó a cabo empleando monocapas de la línea HaCat de queratinocitos humanos-. The determination of the wound repair activity in vitro was carried out using monolayers of the HaCat line of human keratinocytes.
Se realizó una“herida" que se fotografió a distintos tiempos para determinar el grado de cierre de la misma, en presencia y en ausencia de péptidos de miticina C. En primer lugar, se confirmó la capacidad del péptido de la miticina C (SEQ ID NO: 1) de estimular la cicatrización de una herida en queratinocitos in vitro (Figura 1). Las células tratadas con una concentración de 5 mM mostraron una cicatrización de la herida más rápida que las células control. A las 48 h el cierre de la herida era significativamente mayor en las células tratadas y a 72 h la herida estaba totalmente reparada a diferencia de las células control. A “wound” was made and photographed at different times to determine the degree of its closure, in the presence and absence of miticin C peptides. First, the capacity of the miticin C peptide was confirmed (SEQ ID NO: 1) to stimulate wound healing in keratinocytes in vitro (Figure 1). Cells treated with a concentration of 5 mM showed faster wound healing than control cells. At 48 h the closure of the wound was significantly higher in the treated cells and at 72 h the wound was totally repaired unlike the control cells.
Este ensayo se volvió a repetir con los péptidos solapantes basados en la cadena madura de la miticina C de la tabla 1. Tal como se observa en la Figura 3, los péptidos P1, P2a, P2b, P3 y P4 inducían una proliferación celular. Cuando a las células se les originó una herida, se observó una cicatrización significativamente mayor en aquellas que habían sido tratadas con los péptidos P1, P2a, P2b, P3 y P4. A las 48 h del tratamiento se observa, tal como se muestra en la Figura 3, que los péptidos P1 , P2a, P2b, P3 y P4, a diferencia del control, presentan menor porcentaje de apertura de la herida y, por tanto, presentan una mayor cicatrización de la herida y reparación del daño. A las 72 horas, los péptidos P2b, P3 y P4 habían conseguido cerrar
completamente la herida (Figura 3). Los péptidos P6, P7 y P9 debido a problemas en el proceso de síntesis presentaron una escasa solubilidad, y no se tuvieron en cuenta en los ensayos. Ejemplo 4: Determinación de la actividad de reparación de heridas de la Miticina C in vivo. This assay was repeated again with the overlapping peptides based on the mature miticin C chain in Table 1. As seen in Figure 3, the P1, P2a, P2b, P3 and P4 peptides induced cell proliferation. When cells were wounded, significantly more healing was observed in those that had been treated with peptides P1, P2a, P2b, P3, and P4. 48 hours after treatment, it is observed, as shown in Figure 3, that the peptides P1, P2a, P2b, P3 and P4, unlike the control, show a lower percentage of wound opening and, therefore, have increased wound healing and damage repair. At 72 hours, the peptides P2b, P3 and P4 had managed to close completely wound (Figure 3). The P6, P7 and P9 peptides due to problems in the synthesis process showed poor solubility, and were not taken into account in the tests. Example 4: Determination of miticin C wound repair activity in vivo.
Una vez realizados los experimentos en la línea HaCat de queratinocitos humanos, se diseñó un ensayo in vivo empleando larvas de pez cebra ( Danio reñio). Se emplearon larvas de 3 días post-fertilización y se les realizó un corte de la cola. Posteriormente, se estudió la regeneración tisular en larvas tratadas con los péptidos de la Tabla 1 de la miticina C y en las larvas no tratadas con miticina C, mediante fotografías bajo la lupa y análisis de imagen usando el programa imageJ. En las Figuras 2 y 6 se muestran los resultados que muestran una regeneración tisular significativamente mayor de la cola en aquellas larvas tratadas con el péptido completo de la miticina C y con los péptidos P2a, P2b, P3 y P4 solapantes del péptido maduro de la miticina C. Se evaluó la presencia de neutrófilos en la zona de la herida empleando para esto la línea de peces transgénicos Tg(Mpx:GFP)i114, que tienen los neutrófilos marcados con GFP. De esta forma se determinó la capacidad de la miticina C en la resolución de la inflamación asociada a la herida.
After the experiments on the HaCat line of human keratinocytes, an in vivo test was designed using zebrafish (Danio reñio) larvae. Larvae 3 days post-fertilization were used and a tail cut was performed. Subsequently, tissue regeneration was studied in larvae treated with the peptides of Table 1 of miticin C and in the larvae not treated with miticin C, by means of photographs under the magnifying glass and image analysis using the imageJ program. Figures 2 and 6 show the results showing a significantly higher tissue regeneration of the tail in those larvae treated with the complete miticin C peptide and with the overlapping peptides P2a, P2b, P3 and P4 of the mature miticin peptide. C. The presence of neutrophils in the wound area was evaluated using for this the line of transgenic fish Tg (Mpx: GFP) i114, which have neutrophils labeled with GFP. In this way, the ability of miticin C in the resolution of inflammation associated with the wound was determined.
Claims
1. Un péptido que comprende la secuencia SEQ ID NO: 2 y que no es miticina-C con secuencia SEQ ID NO: 1. 1. A peptide comprising sequence SEQ ID NO: 2 and which is not miticin-C with sequence SEQ ID NO: 1.
2. El péptido según la reivindicación 1, donde el péptido presenta un tamaño de entre 6 y 40 aminoácidos. 2. The peptide according to claim 1, wherein the peptide is between 6 and 40 amino acids in size.
3. El péptido según cualquiera de las reivindicaciones 1 o 2, que comprende la secuencia SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 o SEQ ID NO: 7. 3. The peptide according to any of claims 1 or 2, comprising the sequence SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 or SEQ ID NO: 7.
4. El péptido según la reivindicación 1 , que consiste en la secuencia SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 o SEQ ID NO: 7. 4. The peptide according to claim 1, consisting of the sequence SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 or SEQ ID NO: 7.
5. El péptido según la reivindicación 4, que consiste en la secuencia SEQ ID NO: 5, SEQ ID NO: 6 o SEQ ID NO: 7 5. The peptide according to claim 4, consisting of the sequence SEQ ID NO: 5, SEQ ID NO: 6 or SEQ ID NO: 7
6. Una proteína de fusión que comprende el péptido según cualquiera de las reivindicaciones de 1 a 5. 6. A fusion protein comprising the peptide according to any of claims 1 to 5.
7. Una nanopartícula que comprende el péptido según cualquiera de las reivindicaciones 1 a 5, o la proteína de fusión según la reivindicación 6. 7. A nanoparticle comprising the peptide according to any of claims 1 to 5, or the fusion protein according to claim 6.
8. Una partícula similar a un virus que comprende el péptido según cualquiera de las reivindicaciones 1 a 5, o la proteína de fusión según la reivindicación 6. 8. A virus-like particle comprising the peptide according to any of claims 1 to 5, or the fusion protein according to claim 6.
9. Un polinucleótido que codifica el péptido según cualquiera de las reivindicaciones 1 a 5, o la proteína de fusión según la reivindicación 6. 9. A polynucleotide encoding the peptide according to any of claims 1 to 5, or the fusion protein according to claim 6.
10. Una construcción génica que comprende el polinucleótido según la reivindicación10. A gene construct comprising the polynucleotide according to claim
9. 9.
11. Un vector que comprende el polinucleótido según la reivindicación 9 o la construcción génica según la reivindicación 10. 11. A vector comprising the polynucleotide according to claim 9 or the gene construct according to claim 10.
12. Una célula que comprende el péptido según cualquiera de las reivindicaciones 1 a
5, la proteína de fusión según reivindicación 6, el polinucleótido según reivindicación 9, la construcción génica según reivindicación 10, o el vector según la reivindicación 11. 12. A cell comprising the peptide according to any of claims 1 to 5, the fusion protein according to claim 6, the polynucleotide according to claim 9, the gene construct according to claim 10, or the vector according to claim 11.
13. Una composición que comprende el péptido según cualquiera de las reivindicaciones 1 a 5, la proteína de fusión según reivindicación 6, la nanopartícula según reivindicación 7, la partícula similar a un virus según reivindicación 8, el polinucleótido según reivindicación 9, la construcción génica según reivindicación 10, el vector según la reivindicación 11, o la célula según reivindicación 12. 13. A composition comprising the peptide according to any of claims 1 to 5, the fusion protein according to claim 6, the nanoparticle according to claim 7, the virus-like particle according to claim 8, the polynucleotide according to claim 9, the gene construct according to claim 10, the vector according to claim 11, or the cell according to claim 12.
14. La composición según la reivindicación 13, en donde la composición es una composición farmacéutica o composición cosmética. 14. The composition according to claim 13, wherein the composition is a pharmaceutical composition or cosmetic composition.
15. La composición según la reivindicación 14, que comprende, además, un excipiente o vehículo farmacéuticamente o cosméticamente aceptable. 15. The composition according to claim 14, further comprising a pharmaceutically or cosmetically acceptable carrier or excipient.
16. Material o implante que comprende el péptido según cualquiera de las reivindicaciones 1 a 5, la proteína de fusión según reivindicación 6, la nanopartícula según reivindicación 7, la partícula similar a un virus según reivindicación 8, el polinucleótido según reivindicación 9, la construcción génica según reivindicación 10, el vector según la reivindicación 11, la célula según reivindicación 12 o la composición según cualquier de las reivindicaciones 13 a 15. 16. Material or implant comprising the peptide according to any of claims 1 to 5, the fusion protein according to claim 6, the nanoparticle according to claim 7, the virus-like particle according to claim 8, the polynucleotide according to claim 9, the construction gene according to claim 10, the vector according to claim 11, the cell according to claim 12 or the composition according to any of claims 13 to 15.
17. Una proteína de fusión según reivindicación 6, una nanopartícula según reivindicación 7, una partícula similar a un virus según reivindicación 8, un polinucleótido según reivindicación 9, una construcción génica según reivindicación 10, un vector según la reivindicación 11 , una célula según reivindicación 12, una composición según cualquiera de las reivindicaciones 13 a 15 o un material según la reivindicación 16, para su uso como medicamento. 17. A fusion protein according to claim 6, a nanoparticle according to claim 7, a virus-like particle according to claim 8, a polynucleotide according to claim 9, a gene construct according to claim 10, a vector according to claim 11, a cell according to claim 12, a composition according to any of claims 13 to 15 or a material according to claim 16, for use as a medicine.
18. Una proteína de fusión según reivindicación 6, una nanopartícula según reivindicación 7, una partícula similar a un virus según reivindicación 8, un polinucleótido según reivindicación 9, una construcción génica según reivindicación 10, un vector según la reivindicación 11 , una célula según reivindicación 12, una composición según cualquiera de las reivindicaciones 13 a 15 o un material según la reivindicación 16, para su uso en el tratamiento de heridas, preferiblemente la
herida es seleccionada del grupo que consiste en una herida de la piel, una úlcera de decúbito y/o una herida externa o interna. 18. A fusion protein according to claim 6, a nanoparticle according to claim 7, a virus-like particle according to claim 8, a polynucleotide according to claim 9, a gene construct according to claim 10, a vector according to claim 11, a cell according to claim 12, a composition according to any one of claims 13 to 15 or a material according to claim 16, for use in the treatment of wounds, preferably the wound is selected from the group consisting of a skin wound, a pressure ulcer, and / or an external or internal wound.
19. Uso cosmético de una proteína de fusión según reivindicación 6, una nanopartícula según reivindicación 7, una partícula similar a un virus según reivindicación 8, un polinucleótido según reivindicación 9, una construcción génica según reivindicación 10, un vector según la reivindicación 11, una célula según reivindicación 12, una composición según cualquiera de las reivindicaciones 13 a 15 o un material según la reivindicación 16, como agente cicatrizante y/o reparador de la piel. 19. Cosmetic use of a fusion protein according to claim 6, a nanoparticle according to claim 7, a virus-like particle according to claim 8, a polynucleotide according to claim 9, a gene construct according to claim 10, a vector according to claim 11, a cell according to claim 12, a composition according to any of claims 13 to 15 or a material according to claim 16, as a healing and / or skin repairing agent.
20. Péptido que comprende la secuencia SEQ ID NO: 2, para su uso en el tratamiento de una herida, preferiblemente la herida es seleccionada del grupo que consiste en una herida de la piel, una úlcera de decúbito y/o una herida externa o interna. 20. Peptide comprising the sequence SEQ ID NO: 2, for use in treating a wound, preferably the wound is selected from the group consisting of a skin wound, a pressure ulcer and / or an external wound or internal.
21. Péptido para su uso según la reivindicación 20, que comprende la secuencia SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 o SEQ ID NO: 7. 21. Peptide for use according to claim 20, comprising the sequence SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 or SEQ ID NO: 7.
22. Péptido para su uso según reivindicación 21, que consiste en la secuencia SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, o SEQ ID NO:22. Peptide for use according to claim 21, consisting of the sequence SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, or SEQ ID NO:
7. 7.
23. Uso cosmético del péptido que comprende la secuencia SEQ ID NO: 2 como agente cicatrizante y/o reparador de la piel. 23. Cosmetic use of the peptide comprising the sequence SEQ ID NO: 2 as a healing and / or skin repairing agent.
24. Uso según la reivindicación 23, donde el péptido comprende la secuencia SEQ ID24. Use according to claim 23, wherein the peptide comprises the sequence SEQ ID
NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 o SEQ ID NO: 7. NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 or SEQ ID NO: 7.
25. Uso según reivindicación 24, donde el péptido consiste en la secuencia SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, o SEQ ID NO:25. Use according to claim 24, wherein the peptide consists of the sequence SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, or SEQ ID NO:
7.
7.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
ESP201831154 | 2018-11-28 | ||
ES201831154A ES2763349B2 (en) | 2018-11-28 | 2018-11-28 | Myticin peptide and its use in cell regeneration |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2020109642A1 true WO2020109642A1 (en) | 2020-06-04 |
Family
ID=70780006
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/ES2019/070815 WO2020109642A1 (en) | 2018-11-28 | 2019-11-28 | Myticin peptide and its use in cell regeneration |
Country Status (2)
Country | Link |
---|---|
ES (1) | ES2763349B2 (en) |
WO (1) | WO2020109642A1 (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
FR2796072A1 (en) * | 1999-07-08 | 2001-01-12 | Centre Nat Rech Scient | MOLLUSC ANTI-MICROBIAL PEPTIDES |
ES2334083A1 (en) * | 2007-11-28 | 2010-03-04 | Consejo Superior De Investigaciones Cientificas | Method for the identification of antibacterial and antiviral polypeptides obtained from mytilus edulis (Machine-translation by Google Translate, not legally binding) |
-
2018
- 2018-11-28 ES ES201831154A patent/ES2763349B2/en active Active
-
2019
- 2019-11-28 WO PCT/ES2019/070815 patent/WO2020109642A1/en active Application Filing
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
FR2796072A1 (en) * | 1999-07-08 | 2001-01-12 | Centre Nat Rech Scient | MOLLUSC ANTI-MICROBIAL PEPTIDES |
ES2334083A1 (en) * | 2007-11-28 | 2010-03-04 | Consejo Superior De Investigaciones Cientificas | Method for the identification of antibacterial and antiviral polypeptides obtained from mytilus edulis (Machine-translation by Google Translate, not legally binding) |
Also Published As
Publication number | Publication date |
---|---|
ES2763349A1 (en) | 2020-05-28 |
ES2763349B2 (en) | 2021-12-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
ES2620363T3 (en) | Compositions and methods to promote wound healing and tissue regeneration | |
ES2281529T3 (en) | EFFECTIVE PEPTIDES IN THE TREATMENT OF TUMORS AND OTHER CONDITIONS THAT REQUIRE THE ELIMINATION OR DESTRUCTION OF CELLS. | |
ES2269775T3 (en) | EFFECTIVE PEPTIDES IN THE TREATMENT OF TUMORS AND OTHER AFFECTIONS THAT REQUIRE THE ELIMINATION OR DESTRUCTION OF CELLS. | |
ES2876358T3 (en) | Combination compositions for the treatment of disorders that require elimination or destruction of unwanted cell proliferations | |
EP3582754B1 (en) | Composition and methods for preventing radiation injury and promoting tissue regeneration | |
JP2023071909A (en) | Compositions and methods for inhibiting activity of lar family phosphatases | |
ES2872730T3 (en) | Nx-1207 for use in methods to reduce the need for surgery in patients suffering from benign prostatic hyperplasia | |
JP6266811B2 (en) | Immunotherapy for neovascular diseases | |
CN101426808A (en) | Novel protein transduction domains and uses therefor | |
BRPI0613127A2 (en) | use of an agent that has tgf-b3 activity | |
TWI474831B (en) | Use of immunomodulatory protein in promotion of wound healing or treatment of tissue injury | |
US20150273014A1 (en) | Use of peptides for promoting wound healing | |
CA2710822C (en) | Use of histatin derived peptides for promoting wound healing | |
ES2304401T3 (en) | TREATMENT METHODS THAT USE WISP POLYPEPTIDES. | |
Park et al. | Thermo-sensitive assembly of the biomaterial REP reduces hematoma volume following collagenase-induced intracerebral hemorrhage in rats | |
ES2763349B2 (en) | Myticin peptide and its use in cell regeneration | |
WO2021187478A1 (en) | Composition containing self-assembling peptide | |
ES2363676T3 (en) | PEPTIDES AND POLIPEPTIDES OF IMPROVED STABILITY USEFUL FOR THE REGENERATION OF THE NERVOUS SYSTEM. | |
ES2743426T3 (en) | Protein to induce the growth of blood vessels and uses of this | |
RU2772456C2 (en) | Compositions and methods for preventing radiation damage and stimulating tissue regeneration | |
JP6953537B2 (en) | A peptide derived from fibronectin with improved biological activity and reduced susceptibility to neutrophil elastase degradation | |
AU2022326548A1 (en) | Self-assembling amphiphilic peptide hydrogels for treatment of nerve injury | |
WO2022189659A1 (en) | Trem-1 inhibitors for the treatment of marfan syndrome | |
Yeboah et al. | Therapeutic Delivery of Stromal Cell-Derived Factor-1 for Injury Repair | |
WO2017075661A1 (en) | Methods and compositions for treating cns injury |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19888877 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 19888877 Country of ref document: EP Kind code of ref document: A1 |