WO2020109526A2 - Oxyntomodulin peptide analog formulations - Google Patents

Oxyntomodulin peptide analog formulations Download PDF

Info

Publication number
WO2020109526A2
WO2020109526A2 PCT/EP2019/083022 EP2019083022W WO2020109526A2 WO 2020109526 A2 WO2020109526 A2 WO 2020109526A2 EP 2019083022 W EP2019083022 W EP 2019083022W WO 2020109526 A2 WO2020109526 A2 WO 2020109526A2
Authority
WO
WIPO (PCT)
Prior art keywords
formulation
glp
receptor agonist
glucagon receptor
formula
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2019/083022
Other languages
English (en)
French (fr)
Other versions
WO2020109526A8 (en
WO2020109526A3 (en
Inventor
Bruce Peter CONNOP
Dorothy Melissa Lynn SPENCER
Jagatraj SINGH
Donald Edmund KERKOW
Pawel Dominik BUCZEK
Cale Michael HALBLEIB
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Opko Ireland Global Holdings Ltd
Original Assignee
Opko Ireland Global Holdings Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2019387342A priority Critical patent/AU2019387342B2/en
Priority to EA202191511A priority patent/EA202191511A1/ru
Priority to CA3120794A priority patent/CA3120794C/en
Priority to CN202510607757.5A priority patent/CN120514662A/zh
Priority to MX2021006259A priority patent/MX2021006259A/es
Priority to JP2021531335A priority patent/JP7798569B2/ja
Priority to CN201980089205.2A priority patent/CN113365606A/zh
Priority to EP19820673.2A priority patent/EP3886807A2/en
Priority to KR1020217020458A priority patent/KR20210135476A/ko
Application filed by Opko Ireland Global Holdings Ltd filed Critical Opko Ireland Global Holdings Ltd
Publication of WO2020109526A2 publication Critical patent/WO2020109526A2/en
Publication of WO2020109526A3 publication Critical patent/WO2020109526A3/en
Priority to MX2025015078A priority patent/MX2025015078A/es
Priority to PH12021551243A priority patent/PH12021551243A1/en
Priority to IL283553A priority patent/IL283553A/en
Anticipated expiration legal-status Critical
Publication of WO2020109526A8 publication Critical patent/WO2020109526A8/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/08Solutions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61JCONTAINERS SPECIALLY ADAPTED FOR MEDICAL OR PHARMACEUTICAL PURPOSES; DEVICES OR METHODS SPECIALLY ADAPTED FOR BRINGING PHARMACEUTICAL PRODUCTS INTO PARTICULAR PHYSICAL OR ADMINISTERING FORMS; DEVICES FOR ADMINISTERING FOOD OR MEDICINES ORALLY; BABY COMFORTERS; DEVICES FOR RECEIVING SPITTLE
    • A61J1/00Containers specially adapted for medical or pharmaceutical purposes
    • A61J1/05Containers specially adapted for medical or pharmaceutical purposes for collecting, storing or administering blood, plasma or medical fluids ; Infusion or perfusion containers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/10Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/14Esters of carboxylic acids, e.g. fatty acid monoglycerides, medium-chain triglycerides, parabens or PEG fatty acid esters
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/16Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
    • A61K47/18Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
    • A61K47/183Amino acids, e.g. glycine, EDTA or aspartame
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/02General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length in solution
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/605Glucagons

Definitions

  • the present invention relates to GLP-1 and/or glucagon receptor agonists (for example, oxyntomodulin peptide analogs), pharmaceutically acceptable salts thereof, formulations comprising the same, and uses thereof for treating diabetes, obesity, and associated diseases or disorders.
  • GLP-1 and/or glucagon receptor agonists for example, oxyntomodulin peptide analogs
  • pharmaceutically acceptable salts thereof for example, oxyntomodulin peptide analogs
  • Type 2 diabetes mellitus is a progressive disease characterized by insulin resistance and loss of b-cell function and progressive loss of b-cell insulin secretion. Obesity is a major contributor to the progression of insulin resistance in T2DM. Correlations between adiposity and insulin resistance have been reported in both adults and children.
  • Oxyntomodulin is a 37 amino acid peptide hormone that is released with an additional hormone [glucagon-Like peptide 1 (GLP-1)] from the L-cells of the small intestine.
  • GLP-1 glucagon-Like peptide 1
  • OXM reduces body weight in obese patients as a result of enhanced satiety and increased energy expenditure (Wynne et al, Curr Opin Investig Drugs 2010; 11 :1151-1157).
  • the satiety-inducing effects of OXM are believed to be mediated through the activation of the GLP-1 R antagonist exendin (Baggio et al, Gastroenterol 2004: 127: 546-558), (Sowden at al Am J Physiol. Reg, Integr comp.
  • Oxyntomodulin improves glucose tolerance and stimulates insulin secretion in mice (Maida et al, Endocrinol 2008; 149:5670-5678).
  • the oxyntomodulin peptide analog for example, PEGylated derivatives, are found useful in treating type 2 diabetes and related disorders. These PEGylated derivatives are long acting analogs which bind to and activate both the glucagon like peptide- 1 receptor (GLP-1 R) and the glucagon receptor (GcgR). There is a need for such derivatives to be chemically and physically stable in a liquid formulation for both quality/safety /delivery purposes and for shelf-life purposes.
  • the present invention provides a stable GLP-1 and/or Glucagon receptor agonist liquid formulation comprising a pharmaceutically effective amount of a GLP-1 and/or glucagon receptor agonist, or a pharmaceutically acceptable salt thereof, and an aqueous buffer solution, wherein the formulation has a pH value of from about 3.5 to about 8.0, and wherein the GLP-1 and/or Glucagon receptor agonist is native oxyntomodulin, an oxyntomodulin peptide analog, or an active fragment thereof.
  • the GLP-1 and/or Glucagon receptor agonist is a PEGylated oxyntomodulin peptide analog.
  • the GLP-1 and/or glucagon receptor agonist comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or the GLP-1 and/or glucagon receptor agonist is represented by a structure of Formula 3, Formula 4, or Formula 5,
  • L is a linking group
  • OXM* is native OXM, an OXM peptide analog, or an active fragment thereof,
  • PEG is a branched or linear polyethylene glycol polymer
  • Y is -OH, OR, NR2, or an amino acid, wherein said amino acid is optionally substituted with an L-PEG, and wherein said amino acid is optionally amidated, and
  • R is H or a Ci-C4alkyl group, and wherein Formula 5 is represented by the following structure
  • the GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence:
  • Xaa 38 is Cys, Cys-PEG, or is absent, and
  • Xaa 39 is Cys, Cys-PEG, or is absent,
  • the GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence:
  • Xaa 38 is Cys, Cys-PEG, or is absent, and
  • Xaa 39 is Cys, Cys-PEG, or is absent,
  • the present invention further provides a stable PEGylated-oxyntomodulin liquid formulation comprising a PEGylated oxyntomodulin peptide analog, or a pharmaceutically acceptable salt thereof, and an aqueous buffer solution, wherein said formulation is substantially free of a destabilizing substance and having a pH value of from about 3.5 to about 8.0, wherein said PEGylated oxyntomodulin peptide analog comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or is represented by a structure of Formula 3, Formula 4, or Formula 5.
  • the present invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising a GLP-1 and/or Glucagon receptor agonist, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient selected from the group consisting of methionine, sorbitol, and a buffer solution, wherein the GLP-1 and/or Glucagon receptor agonist comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or is represented by a compound of formula 3, 4, or 5.
  • the present invention provides a formulation comprising 70 mg/mL of a PEGylated oxyntomodulin peptide analog of Formula 3 in a 10 mM acetate buffer solution with a pH value of about 4.5.
  • the present invention provides a method of treating a patient having type 2 diabetes, obesity or any associated medical disorder, disease or condition treated or treatable by a GLP-1 and/or glucagon receptor agonist comprising administering to the patient a pharmaceutically effective amount of a liquid dosage form of a GLP-1 and/or glucagon receptor agonist formulation of the invention.
  • the diseases and conditions include but are not limited to patients having glucose related metabolic diseases or disorders or obesity related diseases and disorders. Diseases such as fatty liver disease or cardiovascular diseases and disorders may be mitigated or positively affected by the treatment regimens contemplated hereunder.
  • Patients treated or treatable hereunder with the formulation of the invention receive a stable liquid dosage form comprising the active ingredient.
  • Such liquid dosage forms may be administered at any suitable dosing interval.
  • such patients are treated once weekly with a stable PEGylated oxyntomodulin formulation at any suitable dose or dosage range.
  • the present invention provides a method of lowering HbAlc in a patient in need thereof comprising administering to the patient a pharmaceutically effective amount of a liquid dosage form of a GLP-1 and/or Glucagon receptor agonist formulation of the invention.
  • the present invention provides a method of treating a type 2 diabetic patient comprising administering to the patient a pharmaceutically effective amount of a GLP-1 and/or Glucagon receptor agonist formulation of the invention by once-a-week subcutaneous administration wherein the effective weekly dose of the GLP-1 and/or Glucagon receptor agonist ranges from about 10 to about 150 mgs/week.
  • the present invention provides a pre-filled syringe having a stable GLP-
  • the present invention provides a multidose container comprising a stable liquid formulation of the invention.
  • the present invention provides a method of treating a patient having a disease or condition selected from the group consisting of obesity, metabolic disease, type 1 or
  • any other condition selected from improper glucose metabolism, impaired glucose tolerance, and impaired fasting glucose comprising administering to the patient a pharmaceutically effective amount of a GLP-1 and/or Glucagon receptor agonist formulation of the invention by subcutaneous administration wherein the effective weekly dose of the GLP-1 and/or Glucagon receptor agonist ranges from about 10 to about 150 mgs/week.
  • the present invention further provides a method of treating, suppressing, inhibiting, or reducing the incidence of type II diabetes, obesity or obesity associated metabolic disorder, weight loss, glucose intolerance, hyperinsulinemia, insulin resistance, high blood pressure, fatty liver disease, diabetic nephropathy, diabetic neuropathy, diabetic retinopathy, cardiovascular disease, atherosclerosis, cerebrovascular conditions, Alzheimer’s disease, and/or stroke in a patient in need thereof, comprising administering to the patient a GLP-1 and/or glucagon receptor agonist formulation of the invention.
  • the present invention provides a pharmaceutically acceptable salt of a GLP-1 and/or Glucagon receptor agonist, wherein said GLP-1 and/or Glucagon receptor agonist comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or is represented by a compound of formula 3, 4, or 5.
  • the present invention provides an acetate salt of a GLP-1 and/or Glucagon receptor agonist, wherein said GLP-1 and/or Glucagon receptor agonist comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or is represented by a compound of formula 3, 4, or 5.
  • the GLP-1 and/or Glucagon receptor agonist is represented by a compound of Lormula 3.
  • the present invention provides a hydrochloride salt of a GLP-1 and/or Glucagon receptor agonist, wherein said GLP-1 and/or Glucagon receptor agonist comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or is represented by a compound of formula 3, 4, or 5.
  • the GLP-1 and/or Glucagon receptor agonist is represented by a compound of Lormula 3.
  • the present invention provides a GLP-1 and/or Glucagon receptor agonist formulation comprising an acetate salt of a GLP-1 and/or Glucagon receptor agonist as described herein and an aqueous buffer solution, wherein the formulation has a pH range of from about 3.5 to about 8.0 and one or more additional pharmaceutically acceptable excipients.
  • the present invention provides a method of administering the formulation of the invention, wherein the method comprises a first administration period at a first once-weekly (QW) dose of a PEGylated oxyntomodulin peptide analog, followed by a second administration period at a second once-weekly (QW) dose, prior to administration of the pharmaceutically effective amount of a QW stable liquid dosage formulation, wherein the second QW dose is greater than the first QW dose.
  • QW once-weekly
  • QW a PEGylated oxyntomodulin peptide analog
  • the present invention further provides a process of preparing an acetate salt of a PEGylated oxyntomodulin peptide analog, comprising
  • OXM oxyntomodulin
  • step (b) adding the OXM peptide analog solution to a stirred solution of PEG to produce a reaction mixture containing a crude PEGylated oxyntomodulin peptide analog product, wherein the solution of PEG is formed by dissolving PEG in the same buffered solution as the one to dissolve the OXM peptide analog of step (a);
  • Figure 1 depicts a flow diagram for preparation of an acetate salt of Formula 3.
  • Figure 2 depicts the deconvoluted mass spectrum of Formula 3 obtained by LC/MS analysis with post-column neutralization by DEMA.
  • Figure 3 depicts the sequence ions detected in the CID-MS/MS spectrum of the peptide intermediate ([M+5H] 5+ m/z 902.0).
  • Figure 4 depicts the sequence ions detected in the ECD-MS/MS spectrum of the peptide intermediate ([M+5H] 5+ m/z 902.0).
  • Figure 5 depicts the LC-UV chromatogram from the LC/MS analysis of the thermolytic digest of Formula 3.
  • Figure 6 depicts SEC-HPLC results obtained for F38 sample (formulated with 25 mM cysteine) stored at 5 ⁇ 3°C for 4 weeks and at 40 ⁇ 2°C for weeks.
  • Figure 7 depicts RP-HPLC results obtained for F38 sample stored at 5+3 °C for 4 weeks and at 40 ⁇ 2°C for weeks.
  • Figure 8 depicts a 3D surface plot for % back main peak impurities at different methionine concentration and pH; with 0 mM Arginine and 0 mM Sorbitol.
  • Figure 9 depicts a 3D surface plot for % back main peak impurities at different methionine concentration and pH; with 125 mM Arginine and 0 mM Sorbitol.
  • Figure 10 depicts a 3D surface plot for % total Aggregate impurities at different methionine concentration and pH; with 0 mM Arginine and 0 mM Sorbitol.
  • Figure 11 depicts a 3D surface plot for % total aggregate impurities at different methionine concentration and pH; with 125 mM Arginine and 0 mM Sorbitol.
  • the present invention provides a stable GLP-1 and/or Glucagon receptor agonist liquid formulation comprising a pharmaceutically effective amount of a GLP-1 and/or glucagon receptor agonist, or a pharmaceutically acceptable salt thereof, and an aqueous buffer solution, wherein the formulation has a pH value of from about 3.5 to about 8.0.
  • the present invention further provides a stable GLP-1 and/or Glucagon receptor agonist liquid formulation comprising a pharmaceutically effective amount of a GLP-1 and/or glucagon receptor agonist, or a pharmaceutically acceptable salt thereof, and an aqueous buffer solution, wherein the formulation has a pH value of from about 3.5 to about 8.0, wherein the GLP-1 and/or Glucagon receptor agonist is native oxyntomodulin, an oxyntomodulin peptide analog or an active fragment thereof.
  • the GLP-1 and/or Glucagon receptor agonist is a PEGylated oxyntomodulin peptide analog.
  • the“activity” or“active” as used herein means having agonist activity at the GLP-1 receptor and/or the glucagon receptor.
  • the GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence:
  • Xaa 38 is Cys, Cys-PEG, or is absent, and
  • Xaa 39 is Cys, Cys-PEG, or is absent,
  • the NPb group of Ala 3 7 is PEGylated and has an optional linker.
  • Cys-PEG refers to the attachment of one or more poly (ethylene glycol) (PEG) molecules to a Cysteine residue directly or through a linking group.
  • PEG poly (ethylene glycol)
  • the GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence:
  • Xaa 38 is Cys, Cys-PEG, or is absent, and
  • Xaa 39 is Cys, Cys-PEG, or is absent,
  • Xaa38 is Cys-PEG and Xaa39 is absent.
  • Xaa38 is Cys and Xaa39 is Cys-PEG.
  • Xaa38 is Cys-PEG and Xaa39 is Cys.
  • Xaa38 is Cys-PEG and Xaa39 is Cys-PEG.
  • both Xaa38 and Xaa39 are absent and the NPh group of Ala37 is PEGylated.
  • the NPh group of Ala37 is PEGylated optionally through a linker.
  • the GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence
  • Cys residue at position 38 is optionally PEGylated
  • Cys residue at position 39 is optionally PEGylated
  • the carboxyl group of the Cys at position 39 is optionally ami dated.
  • the GLP-1 and/or Glucagon receptor agonist e.g., PEGylated oxyntomodulin peptide analog
  • the GLP-1 and/or Glucagon receptor agonist is PEGylated at the 38 and/or 39 position of SEQ ID NO: 1 or SEQ ID NO: 2, wherein the PEG molecule is covalently linked to the thiol group of the Cys residue directly or via a linking group attached to the PEG molecule.
  • the PEG molecule is linear or branched.
  • the PEG molecule has a molecular weight of about 20-40 kDa, for example, about 20 kDa, or about 30 kDa, or about 40 kDa.
  • GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence:
  • the carboxyl group of the PEGylated Cys at position 39 is ami dated.
  • the GLP-1 and/or Glucagon receptor agonist is the compound of formula 4:
  • L is a linking group
  • OXM* is native OXM, an OXM peptide analog, or an active fragment thereof,
  • PEG is a branched or linear polyethylene glycol polymer
  • Y is -OH, OR, NR2, or an amino acid, wherein said amino acid is optionally substituted with an L-PEG, and wherein said amino acid is optionally amidated, and
  • R is a Ci-C4alkyl group.
  • amino acid is cysteine substituted with a L-PEG group and wherein the linking group L is attached to the S atom on the cysteine.
  • the GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence:
  • the N3 ⁇ 4 group of Ala37 is PEGylated. In one embodiment, the N3 ⁇ 4 group of Ala37 is optionally PEGylated through a linker. [0054] In one embodiment, the GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence:
  • Xaa 38 is Cys, Cys-PEG, or is absent, and
  • Xaa 3 9 is Cys, Cys-PEG, or is absent,
  • the NPb group of Ala37 is PEGylated and has an optional linker.
  • the GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence:
  • Xaa 38 is Cys, Cys-PEG, or is absent, and
  • Xaa 3 9 is Cys, Cys-PEG, or is absent,
  • Xaa 38 is Cys-PEG and Xaa 3 9 is absent. In one embodiment, Xaa 38 is Cys and Xaa 3 9 is Cys-PEG. In another embodiment, Xaa 38 is Cys-PEG and Xaa 3 9 is Cys. In one embodiment, Xaa 38 is Cys-PEG and Xaa 3 9 is Cys-PEG. In certain embodiment, both Xaa 38 and Xaa 3 9 are absent and the NPb group of Ala 37 is PEGylated. In one embodiment, the NPb group of Ala 3 7 is PEGylated optionally through a linker.
  • PEG is a branched, linear, or multi-armed polyethylene glycol polymer.
  • the PEG molecule in the oxyntomodulin peptide analog has a molecular weight of 20-40 kDa, for example, about 20 kDa, or about 30 kDa, or about 40 kDa.
  • the GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence:
  • Cys residue at position 38 is optionally PEGylated
  • Cys residue at position 39 is optionally PEGylated
  • the carboxyl group of the Cys at position 39 is optionally ami dated.
  • the GLP-1 and/or Glucagon receptor agonist e.g., PEGylated oxyntomodulin peptide analog
  • PEGylated oxyntomodulin peptide analog is PEGylated at the 38 and/or 39 position of SEQ ID NOS: 6 or 7 and wherein the PEG molecule is covalently linked to the thiol group of the Cys residue or is linked directly or via a linking group attached to the PEG molecule.
  • PEG is a branched, linear, or multi-armed polyethylene glycol polymer.
  • the PEG molecule in the oxyntomodulin peptide analog has a molecular weight of 20-40 kDa, for example, about 20 kDa, or about 30 kDa, or about 40 kDa.
  • the oxyntomodulin peptide analogue of SEQ ID NO: 6 or 7 is PEGylated on either the Cys at position 38 or the Cys at position 39 or both with a 20 kDa PEG molecule covalently linked to the thiol group of the Cys residue at these positions.
  • the oxyntomodulin peptide analogue is PEGylated on the Cys residues at both position 38 and position 39 with a 20 kDa PEG molecule covalently linked to each thiol group of the Cys residues at these positions.
  • the Cys residue at position 39 may be absent from SEQ ID NO: 6 or 7, leaving a single site for PEGylation at position 38.
  • the GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence:
  • carboxyl group of the Cys at position 39 is optionally ami dated.
  • the carboxyl group of the PEGylated Cys at position 39 is ami dated.
  • the GLP-1 and/or Glucagon receptor agonist comprises the amino acid sequence:
  • the NPh group of Ala37 is PEGylated. In one embodiment, the NPh group of Ala37 is PEGylated optionally through a linker.
  • the GLP-1 and/or Glucagon receptor agonist e.g., PEGylated oxyntomodulin peptide analog
  • the GLP-1 and/or Glucagon receptor agonist is PEGylated on either the Cys at position 38 or the Cys at position 39 or both with a PEG molecule, e.g., 20 kDa PEG, 30 kDa PEG, or 40 kDa PEG, covalently linked to the thiol group of the Cys residue at these positions.
  • the oxyntomodulin peptide analogue is PEGylated on the Cys residues at both position 38 and position 39 with a PEG molecule, e.g., 20 kDa PEG, 30 kDa PEG, or 40 kDa PEG, covalently linked to each thiol group of the Cys residues at these positions.
  • a PEG molecule e.g., 20 kDa PEG, 30 kDa PEG, or 40 kDa PEG, covalently linked to each thiol group of the Cys residues at these positions.
  • the Cys residue at position 39 may be absent, leaving a single site for PEGylation at position 38.
  • the PEG in the GLP-1 and/or Glucagon receptor agonist e.g., PEGylated oxyntomodulin peptide analog
  • the PEG is attached to the oxyntomodulin 38 and/or 39 Cys groups using mPEG-20kDa maleimide (Formula 1) or an mPEG-20 kDa iodoacetamide (Formula 2) wherein n is 10 to 2500, or n is 350- 600, or n is 425-475.
  • linkers or linking groups may also be utilized to covalently bind the OXM or analog thereof to a PEG moiety.
  • an activated PEG molecule can directly react with the OXM analog having at least one reactive cysteine at position 38 and/or 39 to form a PEGylated OXM analog utilized as the active pharmaceutical ingredient (API) in the stable, liquid formulation of the present invention.
  • the PEG is attached to the oxyntomodulin 38 and 39 Cys groups using both mPEG-20 kDa iodoacetamide and wherein the carboxyl group of the PEGylated Cys at position 39 is amidated.
  • the PEG is attached to the oxyntomodulin 38 and 39 Cys groups using either an mPEG-20 kDa maleimide or an mPEG-20 kDa iodoacetamide and wherein the carboxyl group of the PEGylated Cys at position 39 is amidated.
  • the PEG is attached to the oxyntomodulin 38 Cys group using an mPEG-20 kDa maleimide and to the oxyntomodulin 39 Cys group using an mPEG-20 kDa iodoacetamide.
  • the PEG is attached to the oxyntomodulin 38 Cys group using an mPEG-20 kDa iodoacetamide and to the oxyntomodulin 39 Cys group using an mPEG-20 kDa maleimide.
  • the PEG is attached to the oxyntomodulin 38 and 39 Cys groups of SEQ ID NO: 1 using both mPEG-20 kDa maleimide and wherein the carboxyl group of the PEGylated Cys at position 39 is amidated (Formula 3).
  • Formula 3 contains the standard letter amino acid code designations with the exception of the specific chemical structures shown embedded in the formula or as otherwise shown (i.e., Fiis).
  • the compound of Formula 3 is in the form of a pharmaceutically acceptable salt.
  • the compound of formula 3 is in the form of an acetate salt.
  • the PEG is attached to the oxyntomodulin 38 and 39 Cys groups of SEQ ID NO: 6 using both mPEG-20 kDa maleimide and wherein the carboxyl group of the PEGylated Cys at position 39 is ami dated (Formula 5).
  • the compound of Formula 5 is in the form of a pharmaceutically acceptable salt. In other embodiment, the compound of Formula 5 is in the form of an acetate salt.
  • oxyntomodulin variants/analogs and/or activators of both the GLP-1 receptor and glucagon receptor having at least one cysteine residue at position 38 may also be utilized in the present invention.
  • Suitable analogs having dual activity are described in Santoprete et al. J. Pept. Sci. 2011; 17:270-280.
  • substitution at position 2 at the N-terminus with D-Ser or Aib or D-Ala provides DPP-IV resistant analogs while retaining GLP-1 R/GcgR dual agonist properties.
  • Aib at position 2 provides enhanced potency and selectivity at the GLP-1 receptor and is therefore preferred (Aib is 2-amino isobutyric acid).
  • Other embodiments include active OXM (HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA) (SEQ ID NO: 4) with the Cys residues at position 38 or positions 38 and 39 with further modification(s) to the PEGylated derivatives as described herein.
  • active OXM HQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
  • the formulation of the invention has a pFi value of from about 4.0 to about 7.0. In one embodiment, the pFi value is from about 4.5 to about 6.5. In one embodiment, the pFi value is from about 4.0 to about 5.5. In one embodiment, the pFi is about 4.5.
  • a suitable buffer solution e.g., an acetate buffer solution
  • a pFi of approximately 0.5 pFi units below the target range, for example, about 4.0 to 7.0
  • the desired excipients i.e ., methionine (stabilizer), sorbitol (tonicity adjusting agent)
  • the pFi is adjusted to the preferred target pFi range after the addition of a GLP-1 and/or Glucagon receptor agonist.
  • a GLP-1 and/or Glucagon receptor agonist such as an oxyntomodulin peptide analog as described herein is added to the formulation buffer and then adjusted with a weak acid or base to decrease or increase the pFi to within the target range.
  • the inventors have found that a lower pFi within the range of from about 4.0 to about 7.0 actually improves the stability of the liquid formulation with a pFi of about 4.5 being preferred. Additionally, the inventors have found that certain excipients routinely used in such parenteral formulations actually destabilize the API (active pharmaceutical ingredient, e.g., the GLP-1 and/or Glucagon receptor agonist as described herein) in preliminary buffer solutions, causing formation of impurities (e.g ., cysteine) as determined by HPLC. The inventors have also found that certain reagents such as methionine and/or arginine improves the stability of the liquid formulation.
  • active pharmaceutical ingredient e.g., the GLP-1 and/or Glucagon receptor agonist as described herein
  • impurities e.g ., cysteine
  • certain reagents such as methionine and/or arginine improves the stability of the liquid formulation.
  • the preferred formulation is sodium chloride free or substantially free of sodium chloride or other tonicity adjusting agent that leads to degradation of the API in buffered aqueous solutions such as citrate, histidine or acetate buffer solutions.
  • the percentage of impurities by HPLC analysis is preferably less than 6.0 percent by area. This impurity profile is also dependent, to some degree, upon pH of the solution. Higher pH ranges of between 5.3 to 6.6 led to a higher percentage of total impurities (6.1-7.3 or 7.0-9.3 for samples stored at room temperature for 6 days versus samples stored at 40 degrees Centigrade for 6 days) in sodium chloride containing samples.
  • a less stabilizing amount of tonicity agent such as sodium chloride is defined as > about 10-100 mM sodium chloride. This concentration can vary depending upon the particular excipients in the formulation and the pH of the solution.
  • a destabilizing amount of cysteine is defined as >25 mM cysteine.
  • the formulation of the invention is substantially free of a destabilizing substance.
  • the destabilizing substance is cysteine.
  • the amount of cysteine is less than 25 mM. In one embodiment, the amount of cysteine is less than 10 mM.
  • the formulation is substantially free of sodium chloride. In one embodiment, the amount of sodium chloride is less than 100 mM. In one embodiment, the amount of sodium chloride is less than 25 mM.
  • the term "substantially free” as used herein shall be understood to mean relatively little to no amount of any substance in an aqueous buffered formulation of the invention which leads to degradation of the active pharmaceutical ingredient to a percentage of greater than about five percent (5%) based upon high performance liquid chromatography (“HPLC”) measured at standard testing conditions.
  • HPLC high performance liquid chromatography
  • the present invention further encompasses the formulations with additional pharmaceutically acceptable (“Generally recognized as safe reagents“GRAS”) excipients such as surfactants or tonicity agents or other pharmaceutically acceptable additives. These can include, for example, methionine, arginine, sorbitol, sucrose, non-ionic surfactants (Poloxamers and polysorbates) or similar excipients.
  • the formulation is 70 mg/mL PEGylated oxyntomodulin peptide of Formula 3 (OPK88003) in a 10 mM acetate buffer solution, pH 4.5 with methionine (30-35 mM) and sorbitol to adjust tonicity.
  • the present invention provides a stable GLP-1 and/or Glucagon receptor agonist liquid formulation comprising a GLP-1 and/or Glucagon receptor agonist (e.g., PEGylated oxyntomodulin peptide analog), or a pharmaceutically acceptable salt thereof, and an aqueous buffer solution, wherein said formulation is substantially free of destabilizing substance and having a pH range of from about 3.5 to about 8.0.
  • a GLP-1 and/or Glucagon receptor agonist e.g., PEGylated oxyntomodulin peptide analog
  • GLP-1 and/or Glucagon receptor agonist comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or is represented by a structure of Formula 3, Formula 4, or Formula 5,
  • L is a linking group
  • OXM* is native OXM, an OXM peptide analog, or an active fragment thereof,
  • PEG is a branched or linear polyethylene glycol polymer
  • Y is -OH, OR, NR2, or an amino acid, wherein said amino acid is optionally substituted with an L-PEG, and wherein said amino acid is optionally amidated,
  • R is H or a Ci-C4alkyl group, and wherein Formula 5 is represented by the following structure
  • the PEGylated oxyntomodulin peptide analog is represented by a structure of Formula 3, Formula 4, or Formula 5.
  • the PEGylated oxyntomodulin peptide analog is represented by a structure of Formula 3.
  • Y in Formula 4 is cysteine substituted with a F-PEG group and wherein the linking group F is attached to the cysteine through the S atom on the cysteine.
  • the GFP-1 and/or Glucagon receptor agonist is in the form of a pharmaceutically acceptable salt. In one embodiment, the GFP-1 and/or Glucagon receptor agonist is in the form of an acetate salt.
  • the formulation of the invention contains about 10.0% or less of total impurities and less than about 5% of any single individual impurity measured by RP-HPFC. In one embodiment, the formulation of the invention contains about 10.0% or less of total impurities and less than about 5% of any single individual impurity measured by size exclusion chromatography.
  • the formulation of the invention is substantially free of a destabilizing substance.
  • the destabilizing substance is cysteine.
  • the amount of cysteine is less than 25 mM. In one embodiment, the amount of cysteine is less than 10 mM.
  • the formulation is substantially free of sodium chloride. In one embodiment, the amount of sodium chloride is less than 100 mM. In one embodiment, the amount of sodium chloride is less than 25 mM.
  • the formulation of the invention comprises a tonicity agent.
  • the tonicity agent comprises sorbitol.
  • Other tonicity agents can include sucrose, mannitol or other tonicity modifying agents.
  • the formulation of the invention further comprises one or more preservatives of from about 0.001% (w/v) to about 1% (w/v) based on the total volume of the liquid formulation.
  • the preservative is from about 0.001% (w/v) to about 0.5% (w/v), or from about 0.001% (w/v) to about 0.1% (w/v), or from about 0.001% (w/v) to about 0.05% (w/v), or from about 0.001% (w/v) to about 0.01% (w/v).
  • the preservative is m-cresol, phenol, and/or benzyl alcohol. In certain embodiment, the preservative is m-cresol. In another embodiment, the preservative is phenol or benzyl alcohol.
  • the GFP-1 and/or Glucagon receptor agonist e.g., PEGylated oxyntomodulin peptide analog
  • a suitable vial at a concentration range of from about 5 mg/mL to about 150 mg/mL.
  • the GLP-1 and/or Glucagon receptor agonist, or a pharmaceutically acceptable salt thereof is present in a suitable vial at a concentration range of from about 20 mg/mL to about 150 mg/mL.
  • the GLP-1 and/or Glucagon receptor agonist, or a pharmaceutically acceptable salt thereof is present in a suitable vial at a concentration range of from about 50 mg/mL to about 120 mg/mL. In one embodiment, in the formulation of the invention, the GLP-1 and/or Glucagon receptor agonist, or a pharmaceutically acceptable salt thereof, is present in a suitable vial at a concentration of about 70 mg/mL. In one embodiment, the suitable vial is a single use vial.
  • the buffer solution in the formulation of the invention is selected from the group consisting of an acetate buffer solution, a citrate buffer solution, and a histidine buffer solution.
  • the buffer solution is an acetate buffer solution.
  • the buffer solution is a citrate buffer solution.
  • the buffer solution is a histidine buffer solution.
  • the pH range in the formulation of the invention is from about 4.0 to about 7.0, or from about 4.0 to about 6.5, or from about 4.0 to about 6.0, or from about 4.0 to about 5.5, or from about 4.0 to about 5.0, or from about 4.5 to about 6.5 or from about 4.5 to about 6.0, or from about 4.5 to about 5.5.
  • the pH value of the formulation of the invention is about 4.5.
  • the formulation comprises 70 mg/mL of a PEGylated oxyntomodulin peptide analog of Formula 3 in a 10 mM acetate buffer solution, wherein the formulation has a pH value of about 4.5.
  • the formulation of the invention further comprises one or more additional pharmaceutically acceptable excipients as known in the art.
  • the additional pharmaceutically acceptable excipient is methionine, a derivative of methionine, arginine, or a derivative of arginine.
  • the formulation of the invention has an osmolality of no more than 500 mOsm/kg. In one embodiment, the formulation of the invention has a viscosity of from about 10 to about 60 cP. In one embodiment, the formulation of the invention has a syringeability of Break Loose Force of less than 10 N and Glide Force of less than 30 N. In one embodiment, the formulation of the invention causes no or little injection site reaction, e.g., irritation.
  • the formulation of the invention is stable for at least 5 times of freeze/thaw cycles. In another embodiment the formulation of the invention is stable at least for 48 hours at 30°C/65% RFI and for 12 months at 5°C.
  • the present invention further provides a pharmaceutical composition
  • a pharmaceutical composition comprising a GLP-1 and/or Glucagon receptor agonist as described herein, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient selected from the group consisting of methionine, sorbitol, and a buffer solution.
  • GLP-1 and/or Glucagon receptor agonist is a PEGylated oxyntomodulin peptide analog.
  • the present invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising a PEGylated oxyntomodulin peptide analog selected from the group consisting of a PEGylated oxyntomodulin peptide analog of Formula 3, Formula 4, and Formula 5 or a PEGylated oxyntomodulin peptide analog comprising any one of SEQ ID NOS: 1-9 or an active fragment thereof, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient selected from the group consisting of methionine, sorbitol, and a buffer solution.
  • the present invention further provides a stable liquid formulation comprising a compound of formula 3 in an aqueous buffer solution substantially free of sodium chloride, wherein the formulation has a pFi range of from about 4.0 to about 7.0.
  • the formulation optionally comprises additional excipients selected from organic bases, tonicity agents and other excipients which do not destabilize or negatively affect the formulation.
  • arginine may also be used as a stabilizing amino acid.
  • the stable liquid formulation of the invention has a pFi range of from about 4.0 to about 5.0.
  • the stable liquid formulation of the invention has a pFi value of about 4.5.
  • the stable liquid formulation of the invention is administered to the patient from suitable containers (vials, pre-filled syringes, cartridges etc.) and at suitable dosages ranging from 20 mg to 80 mg twice a week or once a week or at longer dosage intervals.
  • suitable containers vials, pre-filled syringes, cartridges etc.
  • the dosage amounts may change depending upon the weight of the patient and the nature and severity of the disease condition or state and dose may be titrated from lower initial dose to higher dose.
  • the single dose vials generally contain a solution having 70 mg/mL of a GLP-1 and/or glucagon receptor agonist (e.g., PEGylated oxyntomodulin peptide analog). Different volumes administered at this concentration determine the actual amount of a GLP-1 and/or Glucagon receptor agonist delivered to the patient.
  • Multidose containers having the liquid formulation of the invention are also contemplated.
  • the present invention further provides the use of a stable liquid formulation of the invention for treatment of diabetes and/or obesity or metabolic disorders in a patient in need thereof.
  • the present invention provides a stable GLP-1 and/or Glucagon receptor agonist liquid formulation that efficaciously lowers HbAlc in patients having type 2 diabetes.
  • the present invention encompasses use of a stable GLP-1 and/or Glucagon receptor agonist liquid formulation that efficaciously lowers HbAlc in patients having type 2 diabetes, and further lowers body weight and/or changes fasting plasma glucose (FPG).
  • FPG fasting plasma glucose
  • the present invention further provides a method of treating type 2 diabetes, obesity or any associated medical disorder, disease or condition treated or treatable by a GLP-1 and/or glucagon receptor agonist in a patient in need thereof by administering to the patient a pharmaceutically effective amount of a GLP-1 and/or Glucagon receptor agonist liquid formulation of the invention.
  • the diseases and conditions include but are not limited to patients having glucose related metabolic diseases or disorders or obesity related diseases and disorders. Diseases such as fatty liver disease or cardiovascular diseases and disorders may be mitigated or positively affected by the treatment regimens contemplated hereunder.
  • the disease or condition includes, but is not limited to fatty liver disease or cardiovascular disease.
  • the fatty liver disease is non-alcohol fatty liver disease.
  • the liquid dosage form is administered twice a week or once a week or at longer dosage intervals. In one embodiment, the liquid dosage form is administered once a week.
  • the present invention provides a method of treating a patient having type 2 diabetes, comprising administering to the patient a pharmaceutically effective amount of a liquid dosage form of a GLP-1 and/or Glucagon receptor agonist formulation of the invention.
  • the liquid dosage form is administered twice a week or once a week or at longer dosage intervals.
  • the liquid dosage form is administered once a week.
  • the buffer solution of the formulation is an acetate buffer solution.
  • the solution further comprises methionine.
  • the GLP-1 and/or Glucagon receptor agonist is a PEGylated oxyntomodulin peptide analog.
  • the GLP-1 and/or Glucagon receptor agonist is represented by a compound of Formula 3. In another embodiment, the GLP-1 and/or Glucagon receptor agonist is represented by a compound of Formula 5. In one embodiment, the GLP-1 and/or Glucagon receptor agonist is in the form of an acetate salt.
  • the GLP-1 and/or Glucagon receptor agonist is in a suitable container or delivery device at a concentration range of from about 5 mg/mL to about 150 mg/mL.
  • the concentration is from about 20 mg/mL to about 150 mg/mL.
  • the concentration is from about 20 to about 120 mg/mL.
  • the concentration is from about 20 mg/mL to about 100 mg/mL.
  • the concentration is from about 30 mg/mL to about 100 mg/mL.
  • the concentration is from about 40 mg/mL to about 100 mg/mL.
  • the concentration is from about 40 mg/mL to about 80 mg/mL.
  • the liquid dosage form for the method of the invention is substantially free of sodium chloride. In one embodiment, the liquid dosage form for the method of the invention is substantially free of cysteine. In one embodiment, the pFi of the liquid dosage is between about 4.5 and about 6.5. In one embodiment, the dosage administered to the patient ranges from 20 to 150 mgs/week, or from 20 to 125 mgs/week, or from 20 to 100 mgs/week, or from 20 to 75 mgs/week, or from 20 to 50 mgs/week, or from 40 to 150 mgs/week, or from 50 to 150 mgs/week, or from 75 to 150 mgs/week, or from 100 to 150 mgs/week. In another embodiment, the dosage administered to the patient ranges from 0.5 to 1.5 mgs/kg/week, or from 0.5 to 1.0 mgs/kg/week, or from 1.0 to 1.5 mgs/kg/week.
  • the present invention provides a method of lowering FibAlc in a patient in need thereof comprising administering to the patient a pharmaceutically effective amount of a liquid dosage form of a GLP-1 and/or Glucagon receptor agonist formulation of the invention.
  • the liquid dosage form is administered twice a week or once a week or at longer dosage intervals.
  • the liquid dosage form is administered once a week.
  • the GLP-1 and/or Glucagon receptor agonist is represented by the compound of Formula 3.
  • the concentration of the GLP-1 and/or Glucagon receptor agonist in a suitable container is about 70 mg/mL.
  • the suitable container is a single use vial.
  • the FibAlc levels in the patient are lowered after 4, 8, 12, 22, 24, 30, or 34 weeks. In another embodiment, the FibAlc levels in the patient are lowered by between approximately 0.5% to 3% compared to a baseline level. In another embodiment, the HbAlc levels in the patient are lowered by between approximately 1.3% compared to a baseline level. In another embodiment, the mean absolute reduction in HbAlc levels in the patient is between approximately 0.01% to 0.50%. In another embodiment, the mean absolute reduction in HbAlc levels in the patient is approximately 0.09%.
  • the present invention provides a method of lowering weight in a patient in need thereof comprising administering to the patient a pharmaceutically effective amount of a GLP-1 and/or Glucagon receptor agonist formulation of the invention.
  • the GLP-1 and/or Glucagon receptor agonist is represented by a compound of Formula 3.
  • the formulation is administered twice a week or once a week or at longer dosage intervals. In one embodiment, the formulation is administered once a week.
  • the patient’s body weight is lowered after 4, 8, 12, 22, 24, 30, or 34 weeks. In another embodiment, the patient’s body weight is lowered by between approximately 1.8 kg to 8.8 kg compared to a baseline level. In another embodiment, the patient’s body weight is lowered by approximately 4.4 kg compared to a baseline level. In another embodiment, the patient’ s body weight is reduced by approximately between 2% to 10% compared to a baseline level. In another embodiment, the patient’ s body weight is reduced by approximately between 5% compared to a baseline level.
  • the present invention provides a method of lowering blood triglyceride in a patient in need thereof comprising administering to the patient a pharmaceutically effective amount of a GLP-1 and/or Glucagon receptor agonist formulation of the invention.
  • the GLP-1 and/or Glucagon receptor agonist is represented by a compound of Formula 3.
  • the formulation is administered twice a week or once a week or at longer dosage intervals. In one embodiment, the formulation is administered once a week.
  • the patient’s blood triglyceride is lowered after 4, 8, 12, 22, 24, 30, or 34 weeks. In another embodiment, the patient’s blood triglyceride is lowered by between approximately 30 mg/dL to 40 mg/dL compared to a baseline level. In another embodiment, the patient’ s blood triglyceride is lowered by approximately 31.2 mg/dL compared to a baseline level.
  • the present invention further provides a method of treating a type 2 diabetic patient comprising administering to the patient a pharmaceutically effective amount of a GLP-1 and/or Glucagon receptor agonist formulation of the invention by once-a-week subcutaneous administration wherein the effective weekly dose per patient of the GLP-1 and/or Glucagon receptor agonist ranges from about 10 to about 150 mgs/week.
  • the GLP-1 and/or Glucagon receptor agonist is represented by a compound of Formula 3.
  • the formulation is administered from a pre-filled syringe, a cartridge, pen, autoinjector or vial.
  • the pre-filled syringe, cartridge, autoinjector, pen or vial contains a solution having 70 mg/mL of the GLP-1 and/or Glucagon receptor agonist.
  • the present invention provides apre-filled syringe having a stable GLP-1 and/or Glucagon receptor agonist formulation of the invention.
  • the GLP-1 and/or Glucagon receptor agonist in the pre-filled syringe of the invention is represented by a compound of Formula 3.
  • the pre-filled syringe of the invention has a solution with a pH range of from about 3.5 to about 8.0, or from about 4.0 to about 7.0.
  • the formulation comprises an acetate buffer solution.
  • the pre filled syringe comprises a pharmaceutically acceptable excipient.
  • the pharmaceutically acceptable excipient comprises methionine.
  • the formulation in the pre-filled syringe is substantially free of sodium chloride.
  • the liquid dosage form for the method of the invention is substantially free of cysteine.
  • the amount of sodium chloride is less than 100 mM. In one embodiment, the amount of cysteine is less than 25 mM.
  • the present invention further provides a multidose container comprising a stable liquid formulation of the invention.
  • the present invention provides a method of treating a patient having a disease or condition selected from the group consisting of obesity, metabolic disease, type 1 or 2 diabetes, and any other condition selected from improper glucose metabolism, impaired glucose tolerance, and impaired fasting glucose, comprising administering to the patient a pharmaceutically effective amount of a liquid dosage form of a GLP-1 and/or Glucagon receptor agonist formulation of the invention.
  • the formulation is administered twice a week or once a week or at longer dosage intervals.
  • the formulation is administered once a week.
  • the present invention further provides a method of treating a patient having a disease or condition selected from the group consisting of obesity, metabolic disease, type 1 or 2 diabetes, and any other condition selected from improper glucose metabolism, impaired glucose tolerance, and impaired fasting glucose, comprising administering to the patient a pharmaceutically effective amount of a GLP-1 and/or Glucagon receptor agonist liquid formulation of the invention by subcutaneous administration wherein the effective dose per patient of the GLP-1 and/or Glucagon receptor agonist ranges from about 10 to about 150 mgs/week.
  • the GLP-1 and/or Glucagon receptor agonist is represented by a compound of Formula 3.
  • the GLP-1 and/or glucagon receptor agonist as described herein and the formulation comprising the same are useful for treating type 2 diabetes, obesity, or any associated medical disorder, disease or condition
  • the diseases and conditions include but are not limited to patients having glucose related metabolic diseases or disorders or obesity related diseases and disorders.
  • Diseases such as fatty liver disease or cardiovascular diseases and disorders may be mitigated or positively affected by the treatment regimens contemplated hereunder.
  • the present invention further provides a method of treating, suppressing, inhibiting, or reducing the incidence of type 2 diabetes, obesity or obesity associated metabolic disorder, weight loss, glucose intolerance, hyperinsulinemia, insulin resistance, high blood pressure, fatty liver disease (e.g., non-alcoholic steatohepatitis, or NASF1), diabetic nephropathy, diabetic neuropathy, diabetic retinopathy, cardiovascular disease, atherosclerosis, cerebrovascular conditions, Alzheimer’s disease, and/or stroke, comprising administering to a patient in need thereof a GLP-1 and/or glucagon receptor agonist the formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein.
  • fatty liver disease e.g., non-alcoholic steatohepatitis, or NASF1
  • a GLP-1 and/or glucagon receptor agonist the formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically
  • this invention provides a method of treating type 2 diabetes, comprising administering to a subject in need thereof a GLP-1 and/or glucagon receptor agonist formulation of the invention or the GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein.
  • the present invention provides a method of treating, suppressing, inhibiting, or reducing the incidence of obesity and/or an obesity-associated metabolic disorder, for example hypertension, diabetes mellitus, increased blood pressure, stroke, or heart disease, comprising administering to a patient in need thereof a GLP-1 and/or glucagon receptor agonist formulation of the invention or the GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein.
  • the obesity-associated metabolic disorder is hypertension.
  • the disorder is type 2 diabetes mellitus.
  • the disorder is increased blood pressure.
  • the disorder is stroke.
  • the disorder is heart disease.
  • this invention relates to a method of promoting, increasing or facilitating weight loss in a subject, comprising administering to a patient in need thereof a GLP-
  • glucagon receptor agonist formulation of the invention or the GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein.
  • Type 2 diabetes is characterized by insulin resistance and at some stage in pathogenesis of the disease, a relative deficiency of insulin secretion. Most individuals with type
  • 2 diabetes exhibit intra abdominal (visceral) obesity, fatty liver, which is closely related to the presence of insulin resistance.
  • the patient’s liver becomes insulin resistant and glycogen breakdown is uncontrolled and the result is increased and unphysiological glucose delivery to the bloodstream.
  • the liver generated cholesterol and VLDL particles are also uncontrolled.
  • hypertension, dyslipidemia (high triglyceride and low HDL- cholesterol levels; postprandial hyperlipemia), and elevated PAI-1 levels often are present in these individuals.
  • This clustering of abnormalities is referred to as the "insulin resistance syndrome", or the "metabolic syndrome” or obesity related disorders. Because of these abnormalities, patients with type 2 diabetes are at increased risk of developing macrovascular complications such as myocardial infarction and stroke.
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention or the GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein is useful for treating, suppressing, or inhibiting a disease or condition associated with type 2 diabetes or a disease or condition associated with type 2 diabetes.
  • this invention provides a method of treating, suppressing, or inhibiting fatty liver conditions, comprising administering to a subject in need thereof a GLP-1 and/or glucagon receptor agonist formulation of the invention or the GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein.
  • the fatty liver disease is non-alcoholic steatohepatitis (NASH).
  • this invention provides a method of treating glucose intolerance, comprising administering to a subject in need thereof a GLP-1 and/or glucagon receptor agonist formulation of the invention or the GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein.
  • Glucose intolerance is a pre-diabetic state in which the blood glucose is higher than normal but not high enough to warrant the diagnosis of diabetes.
  • this invention provides a method for treating, suppressing, or inhibiting hyperinsulinemia, comprising administering to a subject in need thereof a GLP-1 and/or glucagon receptor agonist formulation of the invention or the GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein.
  • Hyperinsulinemia is a sign of an underlying problem that is causing the pancreas to secrete excessive amounts of insulin. The most common cause of hyperinsulinemia is insulin resistance, a condition in which your body is resistant to the effects of insulin and the pancreas tries to compensate by making more insulin hyperinsulinemia is associated with type 2 diabetes.
  • this invention provides a method of treating atherosclerosis and its associated diseases, such as, for example, cardiovascular disorders, cerebrovascular disorders, peripheral vascular disorders, or intestinal vascular disorders in a subject, comprising administering to a subject in need thereof a GLP-1 and/or glucagon receptor agonist formulation of the invention or the GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein.
  • Atherosclerosis refers to a slow, complex disease that may begin with damage to the innermost layer of the artery. The causes of damage to the arterial wall may include: a) elevated levels of cholesterol in the blood; b) high blood pressure; c) tobacco smoke; or d) diabetes.
  • the methods of this invention may be useful in treating subjects with a family history of premature cardiovascular disease who have an increased risk of atherosclerosis.
  • this invention provides a method of treating Alzheimer’s disease, comprising administering to a subject in need thereof a GLP-1 and/or glucagon receptor agonist formulation of the invention or the GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein.
  • Alzheimer's disease is characterized by cognitive insufficiencies and behavioral changes that impact memory and learning abilities, daily functioning, and quality of life.
  • Hyperinsulinemia and insulin resistance known as pathophysiological features of the T2DM, have also been demonstrated to have significant impact on cognitive impairment. It is believed that GLP-1 affects neurological and cognitive functions, as well as its regulatory effect on glucose metabolism.
  • this invention provides a method of treating diabetic nephropathy.
  • Diabetic nephropathy is a complication of diabetes that evolves early, typically before clinical diagnosis of diabetes is made.
  • the earliest clinical evidence of nephropathy is the appearance of low but abnormal levels (>30 mg/day or 20 pg/min) of albumin in the urine (microalbuminuria), followed by albuminuria (>300 mg/24 h or 200 pg/min) that develops over a period of 10-15 years.
  • microalbuminuria albuminuria
  • albuminuria >300 mg/24 h or 200 pg/min
  • diabetic hypertension typically becomes manifest early on, by the time that patients develop microalbuminuria.
  • GFR glomerular filtration rate
  • ESRD end stage renal disease
  • this invention provides a method of treating diabetic neuropathy.
  • Diabetic neuropathy is a family of nerve disorders caused by diabetes. Diabetic neuropathies cause numbness and sometimes pain and weakness in the hands, arms, feet, and legs. Diabetic neuropathies are classified as peripheral, autonomic, proximal, and focal. Peripheral neuropathy causes pain or loss of feeling in the toes, feet, legs, hands, and arms. Autonomic neuropathy causes changes in digestion, bowel and bladder function, sexual response, and perspiration and can also affect the nerves that serve the heart and control blood pressure. Proximal neuropathy causes pain in the thighs, hips, or buttocks and leads to weakness in the legs. Focal neuropathy results in the sudden weakness of one nerve, or a group of nerves, causing muscle weakness or pain. Any nerve in the body may be affected.
  • this invention provides a method of treating diabetic retinopathy.
  • the effect of diabetes on the eye is called diabetic retinopathy.
  • Patients with diabetes are more likely to develop eye problems such as cataracts and glaucoma.
  • the affect of diabetic retinopathy on vision varies widely, depending on the stage of the disease. Some common symptoms of diabetic retinopathy are blurred vision (this is often linked to blood sugar levels), floaters and flashes and sudden loss of vision.
  • the present invention further provides combination treatments that include a formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein, and other drugs for the indications as described herein.
  • the patients in the method of the present invention may have other diseases and/or conditions.
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein can be administered in combination with one or more additional agents (e.g., therapeutic agents) used for the treatment of the diseases or conditions that are the same as or different from that in the method of the invention.
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein, can be administered simultaneously with, subsequently to, or prior to administration of the additional agent/agents in the method of the invention.
  • Obese patients and/or diabetic patients may have other diseases and conditions.
  • patients may have chronic kidney disease and are on kidney medications.
  • patients may be on diuretics.
  • patients may be hypertensive and on high blood pressure medications.
  • patients may be on diabetes medications that are not contraindicated.
  • patients may have cardiovascular conditions on heart medications.
  • patients may be vitamin D insufficient and on vitamin D analogs or supplements.
  • a GLP-1 and/or glucagon receptor agonist formulation of the invention or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein, can be administered with another therapeutic agent or agents in the method of the invention.
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein is administered in combination with an agent treating chronic kidney disease.
  • the agent treating the chronic kidney disease is a selective androgen receptor modulator (SARM).
  • the selective androgen receptor modulator is RAYALDEE (25(OH)D3) (for treating secondary hyperparathyroidism (SHPT) in stage 3, 4 chronic kidney disease (CKD) patients and others).
  • the agent treating the chronic kidney disease is erythropoietin or an analog thereof (e.g., darbepoetin (also known as Aranesp®)).
  • the agent is a steroid.
  • the agent is a diuretic, which includes, but is not limited to, organomercurial, ethacrynic acid, furosemide, bumetanide, piretanide, muzolimine, chlorothiazide and thiazide, phthalimidine, chlorthalidone, quinazolinone, quinethazone, xipamide, xanthine, aminophylline, carbonic anhydrase inhibitor, acetazol amide mannitol, potassium-sparing compound, aldosterone antagonist, pteridines, pyrazine, carboxamide-triamterene, and/or amiloride.
  • organomercurial ethacrynic acid
  • furosemide furosemide
  • bumetanide piretanide
  • muzolimine chlorothiazide and thiazide
  • phthalimidine chlorthalidone
  • quinazolinone quinethazone
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein is administered in combination with an agent treating cardiovascular conditions.
  • the agent treating the cardiovascular conditions is treating a congestive heart failure.
  • the agent treating congestive heart failure may be an angiotensin converting enzyme (ACE) inhibitor such as benazepril, captopril, lisinopril, moexipril, perindopril, quinapril, ramipril, or enalaprilat.
  • ACE angiotensin converting enzyme
  • the agent treating congestive heart failure is a beta-blocker such as acebutolol, atenolol, betaxolol hydrochloride, bisoprolol fumarate, carteolol hydrochloride, hydrochloride, esmolol hydrochloride, labetalol hydrochloride, levobunolol, metipranolol, nadolol, oxprenolol hydrochloride, pindolol, propranolol hydrochloride, sotalol hydrochloride, or timolol maleate.
  • the agent treating congestive heart failure is digoxin.
  • the agent treating the cardiovascular conditions is an anti- arrhythmic agent.
  • the anti-arrhythmic agent may be a sodium channel blocker, beta-adrenergic blocker, calcium channel blocker, or an agent that prolongs repolarization.
  • Sodium channel blockers include, but are not limited to, quinidine, procainamide, disopyramide, lidocaine, tocainide, mexiletine, encainide, or flecainide.
  • beta-adrenergic blockers include, but are not limited to, propranolol, acebutolol, esmolol, or sotalol.
  • the agents that prolong repolarization include, but are not limited to, sotalol or amiodarone.
  • Calcium channel blockers include, but are not limited to, verapamil, diltiazem, nifedipine, or mebefradil.
  • the anti-arrhythmic agent is adenosine or digoxin.
  • the agent treating the cardiovascular conditions may be a vasoactive agent or an inotrope.
  • Vasoactive agents or inotropes include, but are not limited to, digoxin, dopamine, dobutamine, hydralazine, prazosin, carvedilol, nitroprusside, nitroglycerin, captopril, lisinopril, nifedipine, amlodipine, diltiazem, hydrochlorothiazide, furosemide, spironolactone, AT-1 receptor antagonists (e.g., losartan, irbesartan, valsartan), ET receptor antagonists, dual ET/AII antagonist, neutral endopeptidase (NEP) inhibitors, vasopepsidase inhibitors (dual NEP- ACE inhibitors) (e.g., omapatrilat and gemopatrilat), or nitrates.
  • NEP neutral endopeptida
  • the agent treating the cardiovascular conditions is an anticoagulant agent, for example, coumarin derivative (e.g., warfarin) or an unfractionated heparin or low molecular weight heparin.
  • the agent treating the cardiovascular condition is a fibrinolytic agent such as streptokinase, urokinase,reteplase, anistreplase, prourokinase, reteplase, tenecteplase, lanoteplase, staphylokinase, vampire bat saliva, or alfimeprase.
  • the agent treating the cardiovascular condition is a hypercholesterolemic agent such as niacin-lovastatin, colestipol HC1, fluvastatin sodium, atorvastatin calcium, simvastatin, gemfibrozil, lovastatin, pravastatin sodium, cholestyramine, cholestyramine light, fenofibrate, colesevelam HC1, or ezetimibe.
  • a hypercholesterolemic agent such as niacin-lovastatin, colestipol HC1, fluvastatin sodium, atorvastatin calcium, simvastatin, gemfibrozil, lovastatin, pravastatin sodium, cholestyramine, cholestyramine light, fenofibrate, colesevelam HC1, or ezetimibe.
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein, is administered in combination with a diuretic.
  • the diuretic includes, but is not limited to, organomercurial, ethacrynic acid, furosemide, bumetanide, piretanide, muzolimine, chlorothiazide and thiazide, phthalimidine, chlorthalidone, clorexolone, quinazolinone, quinethazone, metolazone ilenzenesulphonamide, mefruside, chlorobenzamide, clopamidesalicylamide, xipamide, xanthine, aminophylline, carbonic anhydrase inhibitor, acetazolamide mannitol, potassium-sparing compound, aldosterone antagonist, spironolactone and canrenoate, pteridines, pyrazine, carboxamide-triamterene, or amiloride.
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein is administered in combination with an antidiabetic agent.
  • the antidiabetic agent is a sulfonylurea. Sulfonylureas include, but are not limited to, tolbutamide, acetohexamide, tolazamide, chlorpropamide, glipizide, glyburide, glimepiride, or gliclazide.
  • the antidiabetic agent is a meglitinide, for example, prandin or nateglinide.
  • the antidiabetic agent is a biguanide, for example, metformin.
  • the antidiabetic agent is a thiazolidinedione, for example, rosiglitazone, pioglitazone, or troglitazone.
  • the antidiabetic agent is an alpha glucosidase inhibitor, such as miglitol and acarbose.
  • the antidiabetic agent is PPARa/g ligand, dipeptidylpeptidase 4 (DPP-4) inhibitor, SGLT (sodium-dependent glucose transporter 1) inhibitor, glucagon modulators, glucocorticoid receptor (GR) antagonists, glucokinase activators (GK), glycogen phosphorylase inhibitors (GP), incretins (GLP-1 and GIP) or mimetics, triacylglyercol lipases inhibitors, insulin-like growth factor 1 (IGF-1) or analogs, insulin receptor (IR) modulators, PTP-1B phosphatase (or PTPN1) inhibitors, and/or modulators glycogen synthase kinase-3 (GSK3beta).
  • DPP-4 dipeptidylpeptidase 4
  • SGLT sodium-dependent glucose transporter 1
  • GR glucocorticoid receptor
  • GK glycogen phosphorylase inhibitors
  • GLP-1 and GIP glycogen phospho
  • the antidiabetic agent is insulin, for example, rapid-acting insulin, short-acting insulin, and/or intermediate-acting insulin. In one embodiment, the insulin is long-acting insulin. In one embodiment, the antidiabetic agents are inhibitors of fatty acid binding protein (aP2), glucagon-like peptide-1 (GLP-1), and dipeptidyl peptidase IV (DPP4) inhibitors.
  • aP2 fatty acid binding protein
  • GLP-1 glucagon-like peptide-1
  • DPP4 dipeptidyl peptidase IV
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein is administered in combination with one or more agents treating a metabolic disease, disorder or condition, which in some embodiments refers to metabolic syndrome.
  • such agents include, but are not limited to, pancreatic lipase inhibitors, such as for example, orlistat or cetilistat, insulin-sensitizers such as biguanides (metformin) or PPAR agonists, dual-acting PPAR agonists (muraglitazar, tesaglitazar, naveglitazar), PPAR-delta agonists, DPP- IV inhibitors (vildagliptin, sitagliptin), alpha glucosidase inhibitors (acarbose), glucagon-like peptide-1 analogues (exenatide, liraglutide), amylin analogues (pramlintide), statins (atorvastatin, simvastatin, rosuvastatin, pravastatin, fluvastatin, lovastatin, pitavastatin), cholesterol absorption inhibitors (ezetimibe), ACE inhibitors (ramipril, cap
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein is administered in combination with an anti-hypertensive agent.
  • An anti hypertensive agent is any agent which lowers blood pressure, including, not limited to, calcium channel blockers, angiotensin converting enzyme inhibitors (ACE inhibitors), angiotensin II receptor antagonists (A-II antagonists), diuretics, beta-adrenergic receptor blockers (b-blockers), vasodilators and alpha-adrenergic receptor blockers (a-blockers).
  • calcium channel blockers may include amlodipine, bepridil, clentiazem, diltiazem, fendiline, gallopamil, mibefradil, prenylamine, semotiadil, terodiline, verapamil, aranidipine, barnidipine, benidipine, cilnidipine, efonidipine, elgodipine, felodipine, and/or isradipine.
  • angiotensin Converting Enzyme Inhibitors may include, but are not limited to, alacepril, benazepril, captopril, lisinopril, quinapril, temocapril, and/or trandolapril.
  • Angiotensin-II receptor antagonists include, but are not limited to, candesartan, eprosartan, irbesartan, losartan, and/or valsartan.
  • b-Blockers may include, but are not limited to, alprenolol, bufuralol, epanolol, indenolol, nebivalol, practolol, sulfinalol, tilisolol, timolol, toliprolol, and/or xibenolol.
  • a-Blockers may include, but are not limited to, amosulalol, arotinolol, dapiprazole, fenspiride, indoramin, labetolol, prazosin, tamsulosin, tolazoline, and/or yohimbine.
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein is administered in with an agent treating a metabolic disease.
  • agents treating a metabolic disease include, but are not limited to, a vitamin, coenzyme Q10, glucosidase alfa, sodium bicarbonate, bisphosphonate, biotin, allopurinol, levodopa, diazepam, phenobarbital, haloperidol, folic acid, antioxidants, activators of cation channels, haptoglobin, and/or carnitine.
  • the agent treating a metabolic disease is a pancreatic lipase inhibitor such as orlistat or cetilistat, insulin-sensitizers such as biguanide, PPAR agonist, dual acting PPAR agonist such as muraglitazar, tesaglitazar, or naveglitazar, PPAR-delta agonist, DPP- IV inhibitor such as vildagliptin or sitagliptin, alpha glucosidase inhibitor such as acarbose, glucagon-like peptide- 1 analogue such as exenatide or liraglutide, amylin analogue such as pramlintide, statin such as atorvastatin, simvastatin, rosuvastatin, pravastatin, fluvastatin, lovastatin, or pitavastatin, cholesterol absorption inhibitor such as ezetimibe, ACE inhibitor such as ramipril, capto
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention, or a GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein is administered with a vitamin.
  • vitamins include, but are not limited to, vitamin D, vitamin E, vitamin K, vitamin B, vitamin C, or a combination thereof.
  • the term“administered in combination with” and“administered with” are used interchangeably.
  • the present invention provides a method of administrating the stable liquid formulation of the invention.
  • the method of the invention comprises a first administration period at a first once- weekly (QW) dose of a GLP-1 and/or Glucagon receptor agonist (e.g., a PEGylated oxyntomodulin peptide analog), followed by a second administration period at a second once-weekly (QW) dose, prior to administration of the pharmaceutically effective amount of a once-weekly (QW) stable liquid dosage formulation, wherein the second QW dose is greater than the first QW dose.
  • QW once- weekly
  • Glucagon receptor agonist e.g., a PEGylated oxyntomodulin peptide analog
  • the first QW dose is about 1 -20 mg QW. In one embodiment, the second QW dose is about 10-50 mg QW. In one embodiment, the first QW dose at the first administration period is about 20 mg QW, followed by a second administration period providing a second QW dose of 40 mg QW. In one embodiment, the first administration period is from 2 weeks to 6 weeks, or from 2 weeks to 5 weeks, or from 3 weeks to 5 weeks. In other embodiment, the first administration period is 4 weeks. In one embodiment, the second administration period is from 2 weeks to 6 weeks, or from 2 weeks to 5 weeks, or from 3 weeks to 5 weeks. In other embodiment, the second administration period is 4 weeks.
  • the formulation of the present invention is substantially free of any impurities.
  • the formulation of the present invention has about 10% or less of total impurities, or about 8.0 % or less of total impurities, or about 7.0 % or less of total impurities, or about 6.0% or less of total impurities, or about 5.0% or less of total impurities, or about 4.0% or less of total impurities, about 3% or less of total impurities, about 2% or less of total impurities, or about 1% or less of total impurities.
  • the formulation of the present invention has about 5.0% or less of any one impurity, about 4.0% or less of any one impurity, about 3.5% or less of any one impurity, about 3.0% or less of any one impurity, about 2.5% or less of any one impurity, about 2.0% or less of any one impurity, about 1.5% or less of any one impurity, about 1.0% or less of any one impurity, about 0.5% or less of any one impurity, about 0.25% or less of any one impurity, or about 0.1% or less of any one impurity.
  • the formulation of the invention is an OPK-88003 Injection that is supplied as a 1 mL (extractable volume) sterile solution packaged in a 2 mL clear flint glass vial.
  • the drug product (Formula 3) is a clear, colorless solution containing 70 mg/mL of OPK-88003 (label claim) and the inactive ingredients L-methionine, sorbitol and sodium acetate trihydrate at a pH of approximately 4.5.
  • the complete list of ingredients and quantitative formulation is shown below.
  • Sodium hydroxide solution IN and hydrochloric acid solution IN are manufactured from USP-NF quality Water for Injection and reagents.
  • the present invention further encompasses a stable liquid formulation comprising a compound of Formula 3, Formula 4, or Formula 5, or a compound comprising any one of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, and SEQ ID NO: 9 or an active fragment thereof, wherein the formulation has a pH range of from about 3.5 to about 8.0 or from about 4.0 to about 7.0.
  • the formulation is substantially free of sodium chloride.
  • the formulation of the invention is substantially free of cysteine.
  • the formulation optionally comprises additional excipients selected from organic bases, tonicity agents and other excipients which do not destabilize or negatively affect the formulation.
  • the composition or claimed invention may encompass OXM, any OXM analog as described herein or in the literature and in the patent literature and related or similar GLP-1 /glucagon receptor agonists.
  • such patent publications or patents are inclusive of US20150290324; US20110034374, US20150182593, US20150024066, US20150072924, US20150148289, US20090298757, US20140349922; US20150299282; U.S. Patent No. 8,415,926; U.S. Patent No. 8,415,296, U.S. Patent No.
  • OXM “oxyntomodulin,” “oxyntomodulin analog,” “oxyntomodulin peptide analog,” or“oxyntomodulin derivative” includes native oxyntomodulin and any derivative of such peptide that is prepared or contains a substitution, addition, deletion or post-translational modification (methylation, acylation, ubiquitination, intramolecular covalent bond) in the amino acid sequence of oxyntomodulin (HSQGTGTSDYSKYLDSRRAQDFVQWLMNKRNRNNIA) (SEQ ID NO: 4), all of which retain the properties of and/or have improved properties at either or both of the GLP-1 and glucagon receptors.
  • Such compounds may include those having SEQ ID NOS: 10-42 (corresponding to sequences 4 to 36 from US20170128589) and with at least one optional cysteine residue at positions 38 and/or 39.
  • Amino acids and/or atypical amino acids are available from commercial sources such as Sigma- Aldrich and the like.
  • such compounds may include derivatives of oxyntomodulin (OXM) peptide or variants of the peptide obtained through modifications to any amino acids of the oxyntomodulin (OXM) peptide as well as any side chains or terminals of the amino acids with functional groups or polymers, incorporation of natural or unnatural amino acids and/or their derivatives within the peptide, and/or crosslinking with other peptides.
  • OFM oxyntomodulin
  • the present invention further encompasses use of a stable liquid formulation of the invention, for example, a formulation having a compound of formula 3, to treat diabetes and/or obesity and/or excess weight in patients in need of treatment thereof.
  • a stable liquid formulation of the invention for example, a formulation having a compound of formula 3, to treat diabetes and/or obesity and/or excess weight in patients in need of treatment thereof.
  • the present invention comprises a stable PEGylated oxyntomodulin analog liquid formulation that efficaciously lowers EibAlc in patients having type 2 diabetes, obesity or any associated medical disorder, disease or condition treated or treatable by a GLP-1 and/or glucagon receptor agonist.
  • the present invention encompasses use of a stable PEGylated oxyntomodulin analog liquid formulation of the invention that efficaciously lowers EibAlc in patients having type 2 diabetes, obesity or any associated medical disorder, disease or condition treated or treatable by a GLP-1 and/or glucagon receptor agonist and further lowers body weight and/or changes fasting plasma glucose (FPG).
  • FPG fasting plasma glucose
  • the present invention encompasses a method of treating type 2 diabetes, obesity or any associated medical disorder, disease or condition treated or treatable by a GLP-1 and/or glucagon receptor agonist in patients in need of treatment thereof comprising administering a stable liquid formulation of the invention, e.g., a formulation having a PEGylated oxyntomodulin analog of formula 3, to the patient.
  • a stable liquid formulation of the invention e.g., a formulation having a PEGylated oxyntomodulin analog of formula 3, to the patient.
  • PEGylation refers to the attachment of one or more poly(ethylene glycol) (PEG) molecules, as described herein, to an OXM analog as described herein.
  • PEG group can be covalently linked to the OXM molecule directly or through a linking group, whereas“PEGylated” refers to an OXM analog having a PEG substituent attached thereto.
  • PEGylation of oxyntomodulin (OXM) peptide analogs can occur through reaction with available amino or sulfhydryl groups, which are predominantly on the OXM component with a PEG having reactive functional groups, including, but not limited to, azide, carbonate, ester, aldehyde, acrylate, carboxyl, carbodiimide, carbonylimidazole, dichlorotriazine, epoxy, isocyanate, isothiocyanate, maleimide, nitrophenyl carbonate, orthopyridyl disulfide, pyridinyloxycarbonyl, succinimidyl carbonate, succinimidyl glutarate, succinimidyl methyl butanoate, succinimidyl succinate, succinic acid, sulfhydryl, tresylate, vinyl sulfone, and the like.
  • reactive functional groups including, but not limited to, azide, carbonate, ester, aldehyde, acrylate
  • the term“PEG” or the“PEG” for the PEGylation refers to any polyethylene glycol molecule, with any size or modification of the polyethylene glycol molecule.
  • the PEG may have a linear, branched, or multi-armed structure and may be in mono-, bi-, or poly- functional form.
  • the PEG can be substituted or unsubstituted so long as at least one reactive site is available for substitution or reaction.
  • the PEG can have an average molecular weight of from 200 to 100,000.
  • the PEG as used herein is commercially available (NOP Corporation, Kawasaki-Shi, Kanagawa, Japan) or can be prepared by polymerization of ethylene glycol according to methods known to those of ordinary skill in the art.
  • PEG can be a linear polymer with terminal hydroxyl groups of the formula HO-CPbCPb ⁇ CPbCPbOVCPbCPh-OH, wherein n is from about 5 to about 4,000. In one embodiment, n is from about 5 to about 2,500, or from about 8 to about 2,500, or from about 30 to about 2,000, or from about 35 to about 2,000, or from about 35 to about 1,500, or from about 35 to about 1,000, or from about 35 to about 750.
  • the terminal hydrogen may be substituted with a capping group such as an alkyl moiety, e.g., a methyl group, or it may be a terminal hydroxyl group which is attached to a linker moiety which can react with oxyntomodulin via a covalent linkage.
  • a capping group such as an alkyl moiety, e.g., a methyl group
  • the linker moiety may be an amide, carbamate, or urea linkage to an amine group (including but not limited to, the epsilon amine of lysine or the N-terminus) of the oxyntomodulin peptide analog.
  • the linker moiety may be a maleimide linkage to a thiol group (including but not limited to, the thiol group of cysteine).
  • the PEG molecules are mPEG-20 kDa maleimide which react with at least one cysteine on the oxyntomodulin analog to form the PEGylated OXM peptide analog for the liquid formulation of the invention.
  • PEG vinyl sulfone is stable and isolatable and highly selective for coupling with thiol moieties on molecules to form thiol-selective, hydrolytically stable linkages.
  • the PEG can be a branched or "multi-armed.”
  • a branched or multi-armed polymer may have the following structure
  • Poly a and Poly b each represent a HO-CPhCPh-CCPhCPhOVCPpCPh- moiety as described above, and at least one of Poly a and Poly b is capped with an essentially nonreactive end group, for example, a CPbO-CPhCPh-CCPhCPhOVCPhCPh- moiety (“mPEG-“); C represents carbon; P and Q represent linkage fragments that may be the same or different and that join polymer arms Poly a and Poly b , respectively, to C by hydrolytically stable linkages in the linkage fragments; R can be H or a substantially nonreactive moiety, e.g., alkyl; and the moiety -Z can be a moiety having a single site reactive toward nucleophilic moieties, or that can be converted to sites reactive toward nucleophilic moieties, and the reaction product of a nucleophilic moiety and moieties having a single site reactive toward nucleophilic moieties.
  • a multi-armed PEG may have the following structure
  • R is a hydrocarbon group having 1 to 24 carbon atoms
  • OA 1 and OA 2 are each an oxyethylene group
  • n represents 0 to 1000
  • m represents 10 to 1000
  • X represents a functional group, for example, halogen atom selected from Cl, Br and I, which is capable of chemically reacting with an oxyntomodulin (OXM) peptide analog.
  • the branched polyethylene glycols can be represented in general form as R[-PEG(linear)-OH] m in which R represents the core moiety, such as glycerol or pentaerythritol, and m represents the number of arms, as described in U.S. Patent No. 6,436,386, which is hereby incorporated by reference.
  • the PEG may have the structure: T-L-POLY a -R(-POLY b -X) q , wherein POLY a and POLY b are -O-CCPhCPhOj n -CPhCPh-O-, and R is a central core molecule, such as an amino acid or a polyol (e.g., trimethylolpropane, di-trimethylolpropane, glycerol, pentaerythritol, sorbitol, lysine, and di-lysine); L is a linker, T is a bisphosphonate, and Q is an integer from 2 to about 300; and X can be protected or unprotected chemically reactive group.
  • POLY a and POLY b are -O-CCPhCPhOj n -CPhCPh-O-
  • R is a central core molecule, such as an amino acid or a polyol (e.g., trimethyl
  • bifunctional PEG derivatives may have the structure of Y- PEG-X, in which the first functional group X and the second functional group Y are reactive moieties that are capable of reacting with other molecules to which the PEG derivatives are desired to be conjugated to, e.g., oxyntomodulin or its analogs, as described in U.S. Patent No. 6,448,369, which is hereby incorporated by reference.
  • the PEG may contain a polymer derivative comprising a water- soluble and non-peptidic polymer backbone having at least one terminus bonded to the structure: -W-T, wherein W is a hydrolytically unstable ester linkage selected from the group consisting of -0 2 C-(CH 2 ) compassion-0-, -0-(CH 2 ) fond-C02-(CH 2 ) m -, -0-(CH 2 ) administrat-C02-(CH 2 ) m -0-, -(CH 2 ) hurry-0P03-(CH 2 ) m -, and -0-(CH 2 ) n -C0 2 -(CHR) m -, wherein each R is El or alkyl, provided at least one R is alkyl, n is from about 1 to about 5, and m is about 1 to about 5, and T is a reactive group, e.g., -COOE1, - CCh-succinimidy
  • a PEG containing an aldehyde functional group (PEG- aldehyde) reacts spontaneously with the amine and thiol functional groups of cysteine residue at an oxyntomodulin peptide analog, as described in U.S. Patent Publication No. 2010/0016550 Al, which is hereby incorporated by reference.
  • the newly generated functional group between PEG and the oxyntomodulin peptide analog is a 1,3-thiazolidine.
  • Such PEG may provide site-specific pegylation of the oxyntomodulin peptide analog.
  • the PEG used in the present invention can have different molecular weights (e.g., 2-40 kDa), have linear, branched, and/or multi-arm structures, and contain one or more than one functional group.
  • PEG containing two functional groups the final product will be OXM dimer and the linker in between is the PEG.
  • PEG with multiple functional groups will generate multimer of pegylated OXM.
  • the terms “PEGylated oxyntomodulin peptide analog,” “PEGylated oxyntomodulin compound,” “PEGylated oxyntomodulin,” and “PEGylated oxyntomodulin analog” are used herein interchangeably.
  • the oxyntomodulin peptide analog refers to a PEGylated oxyntomodulin peptide analog.
  • the PEGylated oxyntomodulin peptide analog is OPK-88003 (Formula 3).
  • the PEGylated oxyntomodulin peptide analog is Formula 4.
  • the PEGylated oxyntomodulin peptide analog is Formula 5.
  • the oxyntomodulin peptide analog used in the formulations herein can be made as described in U.S. Patent No. 8,367,607 or U.S. Patent No. 8,415,296 which is hereby incorporated by reference in its entirety. Further, a compound of the invention can be prepared as described in Example 1 and Figure 1.
  • Fmoc-Rink Amide MB HA resin is deprotected (piperdine/DMF) followed by coupling of the first amino acid (Fmoc-Cys(Trt)-OH to the resin in the appropriate solvent.
  • the deprotection step is repeated and the polypeptide analog of choice is prepared using the selected protected amino acids. Cleavage from the resin and deprotection leads to the target polypeptide.
  • the amide is formed at the amino acid C terminal cleaved from the resin.
  • the peptide analogs according to SEQ ID NOS: 1-9 and formulas 3, 4, and 5 are generated by solid phase peptide synthesis on a Protein Technologies Inc. Symphony or Applied Biosystems 433A automated peptide synthesizer. Synthesis is performed on Fmoc-Rink amide polystyrene resin (Rapp Polymere Tubigen, Germany) with substitution approximately 0.7 mmol/g. The synthesis performed using the Fmoc main-chain protecting group strategy.
  • Amino acid side chain derivatives used were: Arg (Pbf), Asn (Trt), Asp (OtBu), Cys(Trt), Gln(Trt), Glu(OtBu), His(Trt), Fys(boc), Ser(OtBu), Thr(OtBu), Trp (Boc), and Tyr(OtBu).
  • Coupling is performed with about 10 equivalents of amino acid activated with didsopropylcarbodiimide (DIC) and hydroxybenzotriazole (HObt) (1: 1: 1 molar ratio) in dimethylformamide (DMF) or N- methylpyrrolidinone (NMP). Coupling is carried out for 45 to 90 minutes at room temperature.
  • Product generally elutes at 30-35% acetonitrile.
  • Peptide purity and molecular weight is confirmed on an Agilent 1100 Series liquid chromatography-mass spectrometer with a single quadrupole MS detector.
  • the peptide analog is purified to > 95% purity.
  • Salts may be formed from the cleaved polypeptide with carboxylic acid salts (e.g. triflu oro acetate salts) preferred.
  • the resultant TFA salt is then used in the final PEGylation step(s).
  • Cation scavengers are utilized to prevent alkylation of the amide which is derived from the cleaved resin.
  • PEGylation of the peptide obtained is then performed.
  • a lyophilized peptide analog or salt thereof of the appropriate sequence such as SEQ ID NOS: 1-9 and formulas 3, 4, and 5 or as otherwise shown herein or in U.S. Patent No. 8,367,607 or U.S. Patent No. 8,415,296 is weighed out depending upon the amount of material needed.
  • a small scale synthesis can start with, for example, 30-50 mgs.
  • a 2.5 fold molar equivalent of mPEG of the desired molecular weight and chemical structure e.g.
  • mPEG-20kDa maleimide (03 ⁇ 40(03 ⁇ 404 2 ) - (CEppNElCOCCEhp-malimide) is weighed out and combined with the peptide of SEQ ID NO: 1 or 2.
  • the reactants are dissolved in a 50/50 (v/v) water/acetonitrile mixture to a peptide concentration of approximately 20 mg/mL.
  • the peptide analog solution is diluted two-fold with 100 mM ammonium acetate, 10 mM ethylenediaminetetracetic acid (EDTA), pE17.
  • the resultant mixture is monitored by analytical reversed phase E1PLC and the reaction is complete after roughly two hours.
  • the PEGylated compounds are then diluted and purified as described above (ion exchange, reverse phase E1PLC) for the peptide to form a purified form having formula 3 or the target PEGylated derivative.
  • the purified form is in the form of a salt such as an acetate salt.
  • the purified compound may be in crystalline or amorphous form. The reactions are essentially scaled up to obtain a sufficient amount needed for clinical or commercial use.
  • the present invention provides a process of preparing a pharmaceutically acceptable salt of a PEGylated oxyntomodulin peptide analog.
  • the present invention provides a process of preparing a PEGylated oxyntomodulin peptide analog.
  • the present invention provides a process of preparing an acetate salt of a PEGylated oxyntomodulin peptide analog, comprising
  • step (a) dissolving an oxyntomodulin (OXM) peptide analog in a buffer solution to form an OXM peptide analog solution, wherein the buffer solution has a pEl value of from about 6.6 to about 7.0;
  • step (b) adding the OXM peptide analog solution to a stirred solution of PEG to produce a reaction mixture containing a crude PEGylated oxyntomodulin peptide analog product, wherein the solution of PEG is formed by dissolving PEG in the same buffered solution as the one to dissolve the OXM peptide analog of step (a);
  • the HPLC column of step (d) is a reverse-phase HPLC column.
  • the process of the invention further comprises a step of purifying the crude PEGylated oxyntomodulin peptide analog product on a cation exchange HPLC column prior to step (d).
  • the PEGylated oxyntomodulin peptide analog product prepared by the process of the invention is a compound of Formula 3, 4, or 5.
  • the PEGylated oxyntomodulin peptide analog product is a compound of Formula 3.
  • the buffer solution in the process of the invention is a solution of acetonitrile and ammonium acetate buffer.
  • the PEG in the process of the invention has a molecular weight as described herein. In one embodiment, the PEG in the process of the invention has a molecular weight of about 20 kDa, or about 30kDa, or about 40kDa. In one embodiment, the PEG contains a linker. In one embodiment, the linker is a maleimide linker. In certain embodiment, the PEG is a compound of Formula 1.
  • the present invention further provides a pharmaceutically acceptable salt of a PEGylated oxyntomodulin peptide analog as described herein, for example, the PEGylated oxyntomodulin peptide analog that comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or the PEGylated oxyntomodulin peptide analog that is represented by Formula 3, Formula 4, or Formula 5.
  • a pharmaceutically acceptable salt of a PEGylated oxyntomodulin peptide analog as described herein, for example, the PEGylated oxyntomodulin peptide analog that comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or the PEGylated oxyntomodulin peptide analog that is represented by Formula 3, Formula 4, or Formula 5.
  • a pharmaceutically acceptable salt of a PEGylated oxyntomodulin peptide analog as described herein can be formed by reacting an acid with a basic group of a PEGylated oxyntomodulin peptide analog, such as an amino functional group, or reacting a base with an acidic group of the PEGylated oxyntomodulin peptide analog, such as a carboxylic acid functional group.
  • the pharmaceutically acceptable salt of the PEGylated oxyntomodulin peptide analog is an acid addition salt of an amino functional group in a PEGylated oxyntomodulin peptide analog, for example, the amino group of lysine or other amino acid.
  • Suitable pharmaceutically acceptable salts of an amino group of a PEGylated oxyntomodulin peptide analog as described herein may be prepared from an inorganic acid or from an organic acid.
  • inorganic salts of amines include, but are not limited to, bisulfates, borates, bromides, chlorides, hemisulfates, hydrobromates, hydrochlorates, 2- hydroxyethylsulfonates (hydroxyethanesulfonates), iodates, iodides, isothionates, nitrates, persulfates, phosphate, sulfates, sulfamates, sulfanilates, sulfonic acids (alkylsulfonates, arylsulfonates, halogen substituted alkylsulfonates, halogen substituted arylsulfonates), sulfonates and thiocyanates.
  • examples of organic salts of amines include, but are not limited to, aliphatic, cycloaliphatic, aromatic, araliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids, examples of which are acetates, arginines, aspartates, ascorbates, adipates, anthranilates, algenates, alkane carboxylates, substituted alkane carboxylates, alginates, benzenesulfonates, benzoates, bisulfates, butyrates, bicarbonates, bitartrates, carboxylates, citrates, camphorates, camphorsulfonates, cyclohexylsulfamates, cyclopentanepropionates, calcium edetates, camsylates, carbonates, clavulanates, cinnamates, dicarboxylates, digluconates, dodecylsulfonates, dihydr
  • inorganic acids include, but are not limited to, hydrogen bisulfide, hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid and phosphoric acid
  • organic acids include, but are not limited to, para-toluenesulfonic acid, salicylic acid, tartaric acid, bitartaric acid, ascorbic acid, maleic acid, fumaric acid, gluconic acid, glucuronic acid, formic acid, glutamic acid, methanesulfonic acid, ethanesulfonic acid, benzenesulfonic acid, lactic acid, oxalic acid, para-bromophenylsulfonic acid, carbonic acid, succinic acid, citric acid, benzoic acid and acetic acid, as well as related inorganic and organic acids.
  • Such pharmaceutically acceptable salts thus include sulfate, pyrosulfate, bisulfate, sulfite, bisulfite, phosphate, monohydrogenphosphate, dihydrogenphosphate, metaphosphate, pyrophosphate, chloride, bromide, iodide, acetate, propionate, decanoate, caprylate, formate, isobutyrate, caprate, heptanoate, propiolate, oxalate, malonate, succinate, suberate, sebacate, fumarate, maleate, butyne-l,4-dioate, hexyne-l,6-dioate, benzoate, chlorobenzoate, methylbenzoate, hydroxybenzoate, methoxybenzoate, phthalate, terephthalate, sulfonate, xylene sulfonate, phenylacetate, phenylpropionate, phenylbutyrate
  • examples of inorganic salts of carboxylic acids or phenols may be selected from ammonium, alkali metals including lithium, sodium, potassium and cesium; alkaline earth metals including calcium, magnesium, and aluminium; zinc, barium, cholines, quaternary ammoniums.
  • examples of organic salts of carboxylic acids or phenols may be selected from arginine, organic amines including aliphatic organic amines, alicyclic organic amines, aromatic organic amines, benzathines, /-buLylamincs, benethamines (N- benzylphenethylamine), dicyclohexylamines, dimethylamines, diethanolamines, ethanolamines, ethylenediamines, hydrabamines, imidazoles, lysines, methylamines, meglamines, /V-methyl-D- glucamines, /V,/V’-dibcnzylcLhylcncdiamincs, nicotinamides, ornithines, pyridines, picolies, piperazines, procaine, tris(hydroxymethyl)methylamines, triethylamines, triethanolamines, trimethylamines
  • the bases commonly employed to form a pharmaceutically acceptable salt of a GLP-1 and/or Glucagon receptor agonist include, but are not limited to, hydroxides of alkali metals, including sodium, potassium, and lithium; hydroxides of alkaline earth metals such as calcium and magnesium; hydroxides of other metals, such as aluminum and zinc; ammonia, organic amines such as unsubstituted or hydroxyl-substituted mono-, di-, or tri-alkylamines, dicyclohexylamine; tributyl amine; pyridine; N-methyl, N-ethylamine; diethylamine; triethylamine; mono-, bis-, or tris-(2-OH- (Cl-C6)-alkylamine), such as N,N- dimethyl-N-(2-hydroxyethyl)amine or tri-(2-(2-OH- (Cl-C6)-alkylamine), such as N,N- dimethyl-N-(2-hydroxyeth
  • the salts may be formed by conventional means, such as by reacting the free base or free acid form of the product with one or more equivalents of the appropriate acid or base in a solvent or medium in which the salt is insoluble or in a solvent such as water, which is removed in vacuo or by freeze drying or by exchanging the ions of an existing salt for another ion or suitable ion-exchange resin.
  • the pharmaceutically acceptable salt is prepared by the processes as described herein.
  • the present invention further provides a pharmaceutically acceptable salt of a GLP- 1 and/or Glucagon receptor agonist (e.g., a PEGylated oxyntomodulin peptide analog), wherein said GLP-1 and/or Glucagon receptor agonist comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or is represented by Formula 3, Formula 4, or Formula 5.
  • said GLP-1 and/or Glucagon receptor agonist is represented by a compound of Formula 3.
  • the pharmaceutically acceptable salt of the invention is a hydrochloric acid salt, a hydrobromic acid salt, an ascorbic acid salt, a maleic acid salt, or an acetic acid salt.
  • the salt is an acetic acid salt.
  • the salt is a hydrochloride salt.
  • the present invention provides a hydrochloride salt or an acetate salt of a GLP-1 and/or Glucagon receptor agonist (e.g., a PEGylated oxyntomodulin peptide analog) in crystalline or amorphous form, wherein said GLP-1 and/or Glucagon receptor agonist comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or is represented by Formula 3, Formula 4, or Formula 5.
  • the GLP-1 and/or Glucagon receptor agonist is represented by a compound of Formula 3.
  • the acetate salt is in a crystalline or amorphous form
  • the present invention provides an acetate salt of a a GLP-1 and/or Glucagon receptor agonist (e.g., a PEGylated oxyntomodulin peptide analog) as described herein.
  • the present invention provides an acetate salt of a compound of formula 3.
  • the present invention provides an acetate salt of a compound of formula 4.
  • the present invention provides an acetate salt of a compound of formula 5.
  • the acetate salt of the compound of the invention is in crystalline or amorphous form.
  • the acetate salt of the compound of the invention is in amorphous form.
  • the present invention provides a hydrochloride salt of a compound of the invention.
  • the present invention provides a hydrochloride salt of a compound of formula 3.
  • the present invention provides a hydrochloride salt of a compound of formula 4.
  • the present invention provides a hydrochloride salt of a compound of formula 5.
  • the hydrochloride salt of the compound of the invention is in crystalline or amorphous form.
  • the hydrochloride salt of the compound of the invention is in amorphous form.
  • the present invention provides a GFP-1 and/or Glucagon receptor agonist formulation comprising an acetate salt of a GFP-1 and/or Glucagon receptor agonist (e.g., a PEGylated oxyntomodulin peptide analog) and a pharmaceutically acceptable excipient, wherein said GFP-1 and/or Glucagon receptor agonist comprises any one of SEQ ID NOS: 1-9 or an active fragment thereof, or is represented by Formula 3, Formula 4, or Formula 5.
  • the GFP-1 and/or Glucagon receptor agonist is represented by a compound of Formula 3.
  • the GFP-1 and/or Glucagon receptor agonist is an acetate salt of a compound of Formula 3.
  • the invention provides a GFP-1 and/or Glucagon receptor agonist formulation comprising an acetate salt of a GFP-1 and/or Glucagon receptor agonist of the invention and an aqueous buffer solution, wherein the formulation has a pH range of from about 3.5 to about 8.0 and one or more additional pharmaceutically acceptable excipients.
  • the GFP-1 and/or glucagon receptor agonist such as PEGylated oxyntomodulin analogs as described herein are useful in the treatment of type 2 diabetes, type 1 diabetes, obesity or any associated medical disorder, disease or condition treated or treatable by a GFP-1 and/or glucagon receptor agonist.
  • the formulations of the invention comprising the GFP- 1 and/or Glucagon receptor agonist (e.g., a PEGylated oxyntomodulin peptide analog) are capable of causing a reduction in food intake in patients in need of treatment thereof and thus is useful in the treatment of weight gain and/or obesity and/or the treatment of metabolic disorders.
  • the formulations of the invention result in improved glucose tolerance and lipid profiles in patients with type 2 diabetes and/or related metabolic diseases or conditions, and/or obesity or any associated medical disorder, disease or condition treated or treatable by a GLP-1 and/or glucagon receptor agonist.
  • patients with impaired glucose tolerance or impaired fasting glucose patients with body weight of about 25% or more above normal body weight for the subject’s height and build, patients that have gestational diabetes, patients with metabolic disorders may also be treated with the improved stable formulation of the invention.
  • Other diseases treatable by the claimed formulation include Maturity Onset Diabetes of the Young (MODY); latent autoimmune diabetes, gestational diabetes, metabolic syndrome X, dyslipidemia, hyperglycemia, hyperinsulinemia, hypertriglyceridemia and insulin resistance.
  • the formulations of the invention may also be useful in the treatment of glucocorticoid excess, growth hormone excess, pheochromocytoma and drug-induced diabetes.
  • the formulations of the present invention can be administered parenterally. This includes systemic administration by intramuscular, intravenous, subcutaneous, intradermal or interperitoneal means. As described herein, the active pharmaceutical moiety in the form of the PEGylated analog is administered to a subject in need of treatment thereof. Such subjects include mammals such as humans and animals (farm animals, companion animals etc.).
  • the present invention provides a method of administering a GLP-1 and/or glucagon receptor agonist formulation of the invention or the GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein.
  • the method comprises administering a stable liquid formulation of the invention to a patient through a slow dose-titration schedule.
  • the method comprises a first once- weekly (QW) administration period at a first QW dose that is followed by a second once-weekly (QW) administration period providing a dose escalation of the compound of the invention, and the second QW dose is greater than the first QW dose.
  • the second QW dose is at least 0.25-2.0 (e.g., 0.25, 0.5, 0.75, 1.0, 1.25, 1.50, 1.75, or 2.0) times greater than the first QW dose. In one embodiment, the second QW dose is at least 0.5 time greater than the first QW dose. In one embodiment, the second QW dose is at least 0.75 time greater than the first QW dose. In one embodiment, the second QW dose is at least 1.0 times greater than the first QW dose. In one embodiment, the second QW dose is at least 1.25 times greater than the first QW dose. In one embodiment, the second QW dose is at least 1.5 times greater than the first QW dose. In one embodiment, the second QW dose is at least 1.75 times greater than the first QW dose.
  • the method further comprises at least one more (e.g., a third) administration period providing a dose escalation of the compound of the invention to a higher QW dose relative to the second QW dose.
  • the method further comprises at least one more administration period, subsequent to the second administration period, providing a QW dose at least about 0.25-2.0 (e.g., 0.25, 0.5, 0.75, 1.0, 1.25, 1.50, 1.75, or 2.0) times greater than the second QW dose.
  • the method further comprises at least one more administration period, subsequent to the second administration period, providing a QW dose at least 0.25 time greater than the second QW dose.
  • the method further comprises at least one more administration period, subsequent to the second administration period, providing a QW dose at least 0.5 time greater than the second QW dose. In one embodiment, the method further comprises at least one more administration period, subsequent to the second administration period, providing a QW dose at least 0.75 time greater than the second QW dose. In one embodiment, the method further comprises at least one more administration period, subsequent to the second administration period, providing a QW dose at least 1 time greater than the second QW dose. In one embodiment, the method further comprises at least one more administration period, subsequent to the second administration period, providing a QW dose at least 1.25 times greater than the second QW dose. In one embodiment, the method further comprises at least one more administration period, subsequent to the second administration period, providing a QW dose at least 1.5 time greater than the second QW dose.
  • Administration of a first QW dose is continuous over the first administration period of at least about 2 weeks, at least about 3 weeks, at least about 4 weeks, at least about 5 weeks, at least about 6 weeks.
  • Administration of a second QW dose is continuous over the second administration period of at least about 2 weeks, at least about 3 weeks, at least about 4 weeks, at least about 5 weeks, at least about 6 weeks.
  • the second QW dose is greater than the first QW dose.
  • the additional (e.g., the third) administration period is continuous for at least about 2 weeks, at least about 3 weeks, at least about 4 weeks, at least about 5 weeks, at least about 6 weeks.
  • the dose is escalated to a maintenance dose.
  • the dose is escalated to a second (higher than the first) once-weekly dose, optionally a third (higher than the second) once-weekly dose, until the dose is escalated to a further higher once-weekly maintenance dose.
  • QW low once-weekly
  • a second dose higher than the first
  • third dose higher than the second
  • Dose escalation allows a subject to receive a therapeutic benefit while being gradually exposed to the treatment. Such an administration schedule improves patient’ s tolerance during treatment and reduces the incidence of side effects.
  • dose escalation is from a low dose of the drug, for example, about 1-30 (e.g., 1, 2, 3, 5, 10, 12, 15, 20, 25, or 30) mg QW to a high dose of greater than the low dose to at least about 15-50 (e.g., 15, 20, 25, 30, 35, 40, 45, or 50) mg QW, further to at least about 40-80 (e.g., 40, 45, 50, 55, 60, 65, 70, 75, or 80) mg QW.
  • a low dose of the drug for example, about 1-30 (e.g., 1, 2, 3, 5, 10, 12, 15, 20, 25, or 30) mg QW to a high dose of greater than the low dose to at least about 15-50 (e.g., 15, 20, 25, 30, 35, 40, 45, or 50) mg QW, further to at least about 40-80 (e.g., 40, 45, 50, 55, 60, 65, 70, 75, or 80) mg QW.
  • a first QW dose for example, is from about 1 mg QW to about 20 mg QW, followed by dose escalation to a second QW dose of from about 10 mg QW to about 50 mg QW, and followed by a third QW dose (or the maintenance dose) of from about 40 mg QW to about 80 mg QW.
  • the subject receives a 20 mg QW dose for 4 weeks, followed by 4 weeks of a 40 mg QW dose, and followed by a maintenance dose of 70 mg QW.
  • the subject receives a 20 mg QW dose for 4 weeks, followed by 4 weeks of a 40 mg QW dose, and followed by a maintenance dose of 80 mg QW.
  • the first QW dose is from about 1 mg QW to about 20 mg QW, e.g., from about 3 mg QW to about 20 mg QW, from about 5 mg QW to about 20 mg QW, from about 8 mg QW to about 20 mg QW, from about 10 mg QW to about 20 mg QW, or from about 15 mg QW to about 20 mg QW.
  • the second mg QW dose is from about 10 mg QW to about 50 mg QW, from about 15 mg QW to about 50 mg QW, from about 20 mg QW to about 50 mg QW, from about 25 mg QW to about 50 mg QW, from about 30 mg QW to about 50 mg QW, from about 35 mg QW to about 50 mg QW, or from about 40 mg QW to about 50 mg QW.
  • the third mg QW dose is from about 40 mg QW to about 100 mg QW, from about 45 mg QW to about 100 mg QW, from about 50 mg QW to about 100 mg QW, from about 55 mg QW to about 100 mg QW, from about 60 mg QW to about 100 mg QW, from about 65 mg QW to about 100 mg QW, from about 70 mg QW to about 100 mg QW, from about 75 mg QW to about 100 mg QW, from about 80 mg QW to about 100 mg QW, from about 85 mg QW to about 100 mg QW, or from about 90 mg QW to about 100 mg QW.
  • the third mg QW does is the maintenance mg QW dose.
  • exemplary dose escalations for a GLP-1 and/or glucagon receptor agonist or a formulation comprising the same include, but are not limited to, administration of about 10 mg QW followed by about 20 mg QW; or administration of about 10 mg QW followed by about 30 mg QW, or administration of about 10 mg QW followed by about 40 mg QW, or administration of about 10 mg QW followed by about 50 mg QW, or administration of about 10 mg QW followed by about 60 mg QW, or administration of about 10 mg QW followed by about 70 mg QW, or administration of about 10 mg QW followed by about 80 mg QW, administration of about 15 mg QW followed by about 20 mg QW, or administration of about 15 mg QW followed by about 30 mg QW, or administration of about 15 mg QW followed by about 40 mg QW, or administration of about 15 mg QW followed by about 50 mg QW, or administration of about 15 mg QW followed by about 60 mg QW, or administration of about 15 mg QW followed by about 70 mg QW, or administration of about 10 mg QW followed
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention or the GLP-1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein may be administered twice a week, or once for every two days, or every day, instead of or in place of the once-weekly (QW) dose administration as described above.
  • the GLP-1 and/or glucagon receptor agonist formulation of the invention or the GLP- 1 and/or glucagon receptor agonist or its pharmaceutically acceptable salt as described herein may be administered once a week, once every two weeks, or at longer dosage intervals.
  • the present invention provides an oxyntomodulin peptide analog and formulations comprising the oxyntomodulin peptide analog and uses thereof in treating diabetes and/or obesity.
  • One efficacious dosing regimen for delivery of these molecules to patients is a once-a-week (QD) dosing schedule.
  • the preferred delivery route is by subcutaneous administration using a liquid formulation.
  • the particular molecules described herein in a liquid formulation need to be sterile as well as chemically and physically stable for both quality/safety /delivery purposes and for shelf-life purposes.
  • the parameters used to assess chemical and physical stability include, but are not limited to, appearance (color, clarity etc.), pH, purity, impurities, assay, monomer purity, % aggregates, particulate matter, subvisible particulates, peptide mapping, potency (in vitro activity), osmolality and viscosity.
  • Various stress conditions were applied to attempted liquid formulations of OXM to determine a formulation that would offer optimal physical and chemical stability.
  • the inventors have found that while typical isotonic solutions containing sodium chloride are generally suitable for delivering drugs in liquid or parenteral formulations, the presence of sodium chloride in solutions containing the PEGylated oxyntomodulin analogs unexpectedly cause instability issues. Further, the addition of the PEGylated oxyntomodulin compounds or analogs described herein surprisingly cause a rise in pH beyond the preferred range.
  • the inventors therefore have discovered liquid formulations according to the present invention that meet the requisite physical and chemical stability criteria. The inventors have, by discovering the stable liquid formulation herein, avoids the need to use solid dispersions of drug (i.e., lyophilized or otherwise) which need to be reconstituted with water or saline solution prior to administration to the patient.
  • the formulation is stable as a refrigerated liquid and does not require freezing to maintain stability, allowing for storage in a pre-filled syringe or cartridge rather than a vial, and making it easier for at home use by patients.
  • the patient or medical professional can thus“directly administer” the dosage form from a pre-filled syringe, cartridge or filled vial without taking the additional step of reconstituting a powder formulation and/or such individual could not use a pre-filled syringe (or pre-filled vial) absent of having such a stable liquid formulation.
  • the present invention addresses the need therefore to efficiently deliver a formulation (e.g., a once-a-week formulation) in suitable dosages to patients in need of treatment thereof and is directed to effectively lowering each criteria for determining diabetes type 2 or obesity or any associated medical disorder, disease or condition treated or treatable by a GLP-1 and/or glucagon receptor agonist including lowering FPG to below 126 mg/dL and/or lowering 2- h PG to less than 200 mg/dL and lowering AIC to less than 6.5% (48 mmol/mol) and lowering PG to less than 200 mg/dL.
  • a formulation e.g., a once-a-week formulation
  • the compounds of the present invention are prepared by Solid Phase Peptide Synthesis (SPPS) and chromatographic purification.
  • SPPS Solid Phase Peptide Synthesis
  • SPPS Solid Phase Peptide Synthesis
  • SPPS Solid Phase Peptide Synthesis
  • the Solid Phase Peptide Synthesis (SPPS) of the compounds is performed according to standard procedures and protocols well developed and used routinely world wide.
  • the SPPS is the sequential synthesis of a peptide chain anchored on a solid support by repetition of a cycle encompassing the following steps: removal of the N-terminus Fmoc protecting group of the peptide res in (or resin for the first deprotection), wash, coupling of the next activated amino acid, capping by acetylation, and wash. This cycle is repeated until the sequence of the desired peptide is synthesized as described below.
  • the a-amino group of each amino acid was protected with the base-sensitive 9-fluorenylmethyloxycarbonyl (Fmoc) group, while side chain functional groups were protected with acid-labile groups. All used amino acids derivatives were commercially available ( Figure 1).
  • the trifluoroacetate key intermediate was assembled on a Fmoc-Rink amide resin.
  • the Fmoc group of the rink amide resin was removed with piperidine in DMF. After washing with DMF and IPA, a small sample of the resin was removed and subjected to the ninhydrin/Kaiser or chloranil in-process control test. It is a color test measuring residual resin-bound amine groups. The test should be positive to confirm the presence of the free amine group.
  • the crude peptide solution was purified by preparative HPLC using reversed phase silica washed with methanol and pre-equilibrated with dilute aqueous TFA.
  • the peptide adsorbed was eluted from the column by applying a gradient of acetonitrile in dilute aqueous TFA (ambient temperature).
  • Mass spectra of Formula 3 were obtained using ESI ion trap mass spectrometer. Intact Masses by LC/MS with Post-Column Neutralization
  • Formula 3 intact masses were determined by LC-MS analysis with post-column neutralization by diethylmethylamine (DEMA).
  • DEMA diethylmethylamine
  • the most common cleavage sites are at the CO-NF1 bonds which give rise to the b and/or the y" ions, which, since they are the strongest ions, are the ones most often used in sequence analysis of peptides.
  • the mass difference between two adjacent b ions, or y" ions, is indicative of a particular amino acid residue.
  • the larger b and y" fragments are often found as multiply charged ions.
  • the most common cleavage sites are at the NF1-CF1 bonds which give rise to the c and/or the z ions but the principle to get amino acid sequence is similar.
  • This procedure determines the amino acid composition by hydrolysis (modification of USP ⁇ 1052>) of the peptide followed by ion-exchange separation of the resulting free amino acids and quantitation by post-column derivatization with ninhydrin.
  • the ion-exchange system is calibrated prior to analysis using a certified mixture of amino acids.
  • the results are expressed as relative amino acid ratios, which are expected to conform with amino acid composition of the molecule; and as peptide content (quantity), which is calculated by taking the ratio of the averaged amino acid recovery to the total amount of sample.
  • the peptide content is then used to calculate quantity.
  • the peptide was hydrolyzed in 6 N DC1 in D20 (compensates for any racemization which may occur during hydrolysis). After removal of excess reagent with a stream of nitrogen, the dried sample was esterified with DC1 in methanol. After cooling, the vial was opened, and the excess reagent removed under a nitrogen stream with slight heating. The residue was dissolved in trifluoroacetic anhydride or pentafluoropropionic anhydride, and the vial was tightly closed and heated. After cooling to ambient temperature, the excess reagent was removed by a stream of nitrogen. The residue was dissolved in toluene and subjected to analysis by GC-MS.
  • N(0, S)-fluoroacetyl amino acid esters were separated on a deactivated glass capillary coated with Chirasil-Val.
  • the carrier gas was hydrogen.
  • the peaks were identified by retention time and mass spectrum.
  • Acetate and Trifluoroacetate determination by RP-F1PLC [00236] This procedure is a gradient reversed-phased HPLC method with UV detection at 210 nm designed to determine the acetate and trifluoroacetate content. This method determines acetate and trifluoroacetate content as a weight percent.
  • the GLP-1 activity of Formula 3 is assessed using a cell-based reporter gene assay.
  • This assay utilizes HEK293 cells stably transfected with GLP-1 receptor and cAMP response element (CRE) responsive lucif erase gene.
  • CRE cAMP response element
  • Formula 3 binds to the GLP-1 receptor on the cell surface, which activates cAMP.
  • CREB cAMP Response Element Binding Protein
  • CRE cAMP Response Element Binding Protein
  • the glucagon activity of Formula 3 is assessed using a cell-based reporter gene assay.
  • This assay utilizes an HEK293 cell line (separate from the HEK293 with GLP-1 receptor), which has been engineered to stably express the glucagon receptor and a cAMP responsive element (CRE) responsive luciferase gene.
  • CRE cAMP responsive element
  • Formula 3 binds and activates the glucagon receptor, which activates cAMP.
  • CREB cAMP Response Element Binding Protein
  • CREB cAMP Response Element Binding Protein
  • Amino acid sequence of Formula 3 was confirmed by amino acid analysis (AAA), N- terminal sequencing, LC/MS peptide mapping and intact LC/MS.
  • AAA amino acid analysis
  • N-terminal sequencing was consistent with the theoretical composition except Trp and Cys, which were almost completely destroyed during the acidic hydrolysis.
  • the 30 cycles of N-terminal sequencing were consistent with the expected sequence of Formula 3.
  • Peptides identified by LC/MS peptide mapping accounted for 35 of total 39 amino acid residues.
  • DePEGylated C-terminal Ile-Ala-Cys- Cys peptide of Formula 3 was not detected by LC/MS peptide mapping, indicating that free peptide intermediate did not exist in Formula 3.
  • Electrospray ionization mass spectrometry was used to determine the mass of the peptide. The deconvoluted mass obtained from each of the multiple charged ions confirms the correct monoisotopic mass of the peptide intermediate.
  • Matrix assisted laser desorption ionization-time of flight was used to obtain the molecular mass of the Formula 3 drug substance.
  • a sample from Formula 3 as prepared in Example 1 was analyzed.
  • FC/ESI-MS with post-column neutralization by diethylmethylamine (DEMA) was used to obtain the accurate molecular mass of the reference standard of Formula 3.
  • N-terminal amino acid sequence of Formula 3 reference standard was determined by 30 cycles of N-terminal amino acid sequencing (Edman degradation).
  • thermolytic peptides Besides the expected thermolytic peptides, a few very minor modified peptides were also identified. They are oxidized Formula 3 peptide 22-25 (Trp25 oxidation) and deamidated Formula 3 26-35. Formula 3 22-25 only contains one potential oxidized site, Trp25, but Formula 3 26-35 contains 4 Asn residues, and specific deamidation site has not been identified. Part of the degradations might be generated during the thermolytic digest. No significant peptide isomer was identified, indicating that Formula 3 did not contain significant amino acid racemization, i.e. pure amino acid chirality.
  • Peptide Intermediate and Formula 3 Drug Substance [00260] To ensure the identity and the correct ratio of the constituent amino acids, amino acid analysis was performed on the peptide intermediate, as well as the drug substance to show consistency of results (See Table IE). This method involves hydrolyzing the peptide in strong acid, separating the amino acids on an ion-exchange column, and, finally, detecting the eluents after ninhydrin derivatization.
  • the peptide portion of the molecule consists of natural amino acids with the exception of two 2-aminoisobutyric acid moieties present in the molecule. This amino acid and the two glycines present in the molecule represent the only achiral amino acids.
  • Chiral amino acid analysis of the peptide intermediate and Formula 3 drug substance was performed to investigate the chiral identity of each constituent amino acid residue.
  • the peptide is hydrolyzed in deuterated solvents (DCI/D2O), suitably derivatized, and analyzed using gas chromatography-mass spectrometry (GC- MS) to determine each amino acid enantiomer.
  • DCI/D2O deuterated solvents
  • GC- MS gas chromatography-mass spectrometry
  • Oxyntomodulin is a peptide hormone that is released along with GLP-1 from the L-cells of the small intestine in proportion to nutrient ingestion. Distinct receptors for OXM have not been identified. OXM can bind and activate both GLP-1 receptor (GLP1R) and glucagon receptor (GcgR) in vitro. Mechanisms of GLP1R agonists in glucose lowering and weight reduction are well validated. It was reported that glucagon could reduce food intake and increase energy expenditure in the Wistar rats. In contrast, an anti-glucagon antibody was shown to increase meal size and duration in a fasting and re-feeding experiment.
  • GLP1R GLP-1 receptor
  • GcgR glucagon receptor
  • glucagon was demonstrated to reduce food intake. Furthermore, glucagon was demonstrated to increase FGF21 and decrease PCSK9 expression. Therefore, a combination of GLP1R and GcgR agonism may provide a potential for superior weight reduction and lipid profile improvement as long as GLP1R activity is sufficient to improve glycemic control.
  • Dimers of the mono-PEGylated form may occur due to intermolecular cross-linking of cysteine residues and have been preliminarily identified as high molecular weight polymers (may be on the right of the API on chromatogram).
  • Potential inorganic impurities, inorganic salts used mainly during purification, are expected to be completely removed in the purification steps.
  • the acids (acetic and trifluoroacetic acid) used, which may form salts of the peptide, are included in the analysis of the drug substance. No metallic catalytic reagents are used in the manufacturing process. Only insignificant amounts of metal ions may remain as stainless- steel chromatography columns are used. Mono-PEGylation may also result.
  • the limit for total impurities/degradants in the drug product is 10% and single largest impurity is 5%.
  • the formulations of the invention stay within the limits when samples are stored for 2 years at 5+3 °C.
  • the formulations of the invention were initially prepared in an aqueous solution having about 50 to 85 mg/mL of the active ingredient, formula 3.
  • the preferred concentration of the active ingredient PEGylated oxyntomodulin of formula 3 is about 70 mg/mL.
  • Various compositions comprising the active ingredient and buffers selected from acetate, citrate and histidine were prepared at various pH levels between 4.0 to 7.0. Solutions of the PEGylated oxyntomodulin analog (formula 3) were stored for six days at three storage conditions: 5 ⁇ 3°C, 25 ⁇ 2°C and 40 ⁇ 2°C, and then were analyzed by DLS and RP-HPLC for particle size analysis and purity/impurities respectively.
  • Particle distribution in the solutions was also tested by DLS and showed multimodal size distribution with high polydispersity and with low concentration of particles.
  • the invention thus comprises PEGylated oxyntomodulin formulations having such characteristics.
  • the formulations of the invention were also tested for related impurities by RP- HPLC and soluble aggregates by SEC-HPLC under various conditions.
  • the most stable conditions in terms of the least increase in impurities was at a pH range of about 4.5 to about 5.9 and/or with solutions lacking sodium chloride at the tested concentration of 100 mM.
  • Acetate buffer with pH 4.5 was selected as offering the most stability for a liquid formulation containing PEGylated oxyntomodulin peptide and analogs thereof.
  • Phase 1 Pre-Formulation development to narrow down selection of 1) pH, 2) Buffer,
  • Phase 2 DOE study to evaluate stability of selected combinations utilizing statistical design
  • Phase 3 Long-term stability of selected lead formulations.
  • Pre-formulation development included assessment of stability as a function of pH, buffer type, and addition of various excipients and the effect of surfactants.
  • Stability analytical testing included RP-HPLC and SEC-HPLC, particulates by DLS, HIAC and MFI, as well as pH, osmolarity, viscosity, etc.
  • Excipient Screening Various excipients were evaluated or experimentally assessed in acetate buffer (pH 4.5 and 5.0) or citrate buffer (pH 5.5): methionine, arginine, cysteine, glycine, sodium chloride, mannitol, sorbitol and sucrose. Improvements in formulations containing methionine and arginine were noted and were selected for further assessment in DOE testing. Sorbitol and sucrose appeared inert and either would be suitable as a tonicity modifier. Sorbitol was selected for DOE testing due to less possible effects on viscosity.
  • Surfactant Screening The effect of various surfactants on particle and aggregate formulation was assessed in a surfactant screening study. The effect of following surfactants: Polysorbate 20, Polysorbate 80, and Poloxmer 188 were evaluated in samples subjected to agitation and successive freeze/thaw cycles. Samples were analyzed by SEC-HPLC, DLS, MFI & HIAC for soluble and insoluble aggregates. No chemical degradation or aggregation was observed in samples containing any of the surfactants relative to the control samples, therefore it was decided to exclude any surfactant from the formulation for further testing.
  • DOE design of experiments
  • Buffer Selection During pre-formulation studies, the acetate buffered solutions were identified as similar to citrate buffered solutions when tested in the low pH range. Since acetate is a better buffer in the pH 4.5 - 5.0 range, acetate buffer was selected for the DOE study and lead formulation. Additionally, lower viscosities were observed in samples prepared in acetate buffer, however this needs to be confirmed.
  • pH 4.5-4.9 was identified as the optimal pH range during pre formulation studies for OPK-88003 stability and this range was selected for testing in the DOE studies. Modeling of DOE study results demonstrated there was statistically significant stability improvement in total aggregates and/or impurities by SEC-HPLC or RP-HPLC. Since statistical improvements were consistently observed in samples at lower pH it is recommended to select the lowest pH tested for the preferred formulations.
  • Methionine During modeling of DOE study results, the level of methionine was identified as having a statistically significant effect on levels of impurities by SEC (total aggregates) and RP-HPLC (total back-peak impurities) following accelerated stability. Specifically, methionine appears to function as a protective agent against dePEGylation based off DOE stability results. Statistical modelling of DOE results indicate ⁇ 30 mM potency is an optimal methionine concentration.
  • Arginine Although arginine does seem to improve stability in certain situations (i.e., in presence of low levels of methionine), differences were not deemed statistically significant. There may be some improvement in samples containing arginine under certain conditions, but not in our optimal pH range. In addition, as a tonicity modifier, sorbitol will be less costly at commercial scale than arginine as a drug product excipient.
  • Sorbitol was selected as the tonicity modifying agent as it is more inert and less expensive relative to an amino acid such as arginine. Maximum potency of sorbitol on FDA’s inactive ingredient database for subcutaneous injection is 4.7% and 4.0% is required to achieve target osmolarity in the preferred formulation, which is within this range.
  • Osmolarity An osmolality of about 300 mOsm/kg is recommended to maintain isotonicity. Since osmolality can be adjusted with sorbitol while staying within the approved drug precedent for sorbitol potency, we will target 300 mOsm/kg.
  • Extrapolated Stability By extrapolation off of preliminary accelerated stability data from DOE testing, the liquid formulation should be stable ( ⁇ 5% degradation of API) for 2 years when stored at 2-8°C.
  • Formulation 2 Identical formulation to Formulation 1 but pH 4.7.
  • Formulation 3 Substitute sorbitol (230mM) for arginine (lOOmM) in formulation 1. Resulting osmolarity will be slightly lower (290mOsm/kg). This formulation demonstrates if there are any long term stability improvements with the presence of arginine in the formulation.
  • Example 5 Physical and Chemical Stability of PEGylated OXM Peptide Analog
  • a panel of analytical techniques was used to evaluate the physical and chemical stability of OPK-88003 peptide (Formula 3) including: appearance, pFl, SEC-F1PLC, RP-F1PLC, DLS, F1IAC, MFI, osmolality, and viscosity. Based on the obtained results, the following formulation conditions are optimal for OPK-88003 (Formula 3) at 70 mg/mL: 10 mM acetate buffer with 30 - 35 mM Methionine, pFi 4.5. No effect on OPK-88003 stability was observed in presence of sorbitol and, therefore, it is recommended to be used as a tonicity agent.
  • Dynamic light scattering was performed using at least 80 pL of undiluted sample in an optical-quality plastic cuvette. Five consecutive measurements were acquired for each sample at 25 °C with at least 3 minutes of equilibration at the beginning of each scan.
  • the Protein Analysis algorithm (Malvern Zetasizer software) was used as a model for data processing. The Z-average hydrodynamic diameter was calculated from a cumulants analysis and the Stokes-Einstein equation, using the viscosity of water (0.8872 mPa- s) at 25°C The polydispersity index was obtained from the same cumulants analysis. Modality of fit is evaluated based on plots of size distribution versus intensity and modality can be described as monomodal (i.e. one peak) or multimodal (i.e. two or more peaks).
  • Concentration of particles was measured by Liquid Particle Counting System, HIAC model 9703/9703+, following the testing parameters outlined in USP ⁇ 788>, testing for Particulate Matter in Injections. Injections of 0.2 mL using a 1 mL syringe with a small sample size probe were made. The number of particles (2 - 25 pm size) was reported as a value per 1 mL of protein solution (cumulative counts/mL).
  • Reverse Phase chromatography was utilized to measure purity and related substances of OPK-88003 according to method PRD-P80101-LNCM. This procedure is a gradient reversed-phased HPLC method with UV detection at 214 nm designed to determine the identity, quantity and related substances of OPK-88003 in the drug product. It uses a Zorbax 300 A SB- 08 column.
  • the mobile phase consists of 0.1% volume/volume triflu oroacetic acid in water (mobile phase A) and 0.1% volume/volume trilu oroacetic acid in acetonitrile (mobile phase B).
  • This method determines identity by retention time match of the main peak or co-elution with the reference standard, quantity by comparative determination of OPK-88003 main peak area relative to a reference standard, and purity and impurities/related substances as a total area percent.
  • the procedure is stability indicating as judged by its ability to resolve known impurities from OPK- 88003 and demonstrated by the analysis of stressed samples.
  • This procedure is a size-exclusion HPLC method with UV detection at 214 nm designed to determine the monomer purity and related substances of OPK-88003 in the drug product. It uses a Sepax Zenix SEC-300 column The mobile phase consists of 60 mM potassium phosphate, 250 mM sodium chloride, 20% ACN at pH7.0. This method determines monomer purity and impurities/related substances as a total area percent. The procedure is stability indicating as judged by its ability to resolve known impurities from OPK-88003 anddemonstrated by the analysis of stressed samples.
  • Micro-Flow Imaging experiments were performed using an MFI 5200 with Automated Pipet System to characterize the size, concentration, and morphology of particles present in OPK-88003 samples. Samples were prepared in a laminar flow hood, with triple-rinsed barrier pipet tips to minimize contamination. The analyses were performed with single measurements using 700 or 1000 pL of neat sample, depending on the amount of sample available. The operations and respective liquids used for MFI testing are listed in Table 3A below:
  • Circular fraction - ; -— - -
  • the calculated circular fraction thus provides a ratio of the non-proteinaceous particles to proteinaceous particles found in each test sample.
  • a low circular fraction value indicates that the test article is comprised of mostly non-circular, likely proteinaceous particles.
  • Osmolality [00309] The osmolality of the OPK-88003 formulations was measured by Vapro Vapor Pressure Osmometer carried out according to a dew point temperature depression method (GTM- 0614). Note that due to the higher viscosity of samples, osmolality was measured by dew point temperature depression method rather than freezing point depression method. The osmometer was calibrated using a series of standard solutions prior to sample measurements. Samples were analyzed in triplicate using 10 pL of sample for each measurement and the average value was reported.
  • the viscosity of the OPK-88003 sample was measured by Brookfield DV-III Ultra Programmable Rheometer following method GTM-0614. Prior to sample measurements, viscometer performance was verified using a certified viscosity standard. Following the standard measurement, 600 pL of OPK-88003 sample was loaded into the viscometer. The viscosity measurements were performed at multiple percentage torque values to evaluate Newtonian or non- Newtonian properties.
  • OPK-88003 The stability of OPK-88003 was determined by RP-HPLC chromatography. Samples were tested for the conditions and time point described above and the results are summarized in Table 14. The lowest accumulation of OPK-88003 impurities was observed in acetate buffer containing methionine or arginine at pH 4.5 and subjected to 40 ⁇ 2°C and at pH 4.5 and 5.0 subjected to 50°C, compared to corresponding control formulations stored at the same temperatures. A slight beneficial effect of the presence of methionine on OPK-88003 stability was also observed in all formulations stored at 5 ⁇ 3°C.
  • samples were prepared (F21, F24, F26, and F31 - F37) by mixing the various excipients.
  • samples were stored at 50°C for one week.
  • Corresponding controls were stored at 5 ⁇ 3°C for the same period.
  • samples were agitated for ⁇ 50 hours (50 rpm, at room temperature).
  • Corresponding controls with no agitation were stored proximate at room temperature.
  • samples were subjected to three fast freeze-thaw cycles. Vials were frozen for at least overnight at 75 ⁇ 10°C. The samples were thawed by placing vials on the lab bench at room temperature for at least two hours.
  • Vials were refrozen and the freezing procedure was repeated for a total of three times.
  • the stressed and control samples were analyzed by visual inspection (appearance), SEC-HPLC, and DLS methods. RP-HPLC analysis was performed only for samples stored at 50°C. [00335] In performed studies, all stressed samples remained unchanged in terms of color, clarity, and particle content in comparison to the control samples.
  • design components were selected to be evaluated in a DOE study.
  • the design components included pH, methionine, arginine and sorbitol were evaluated in acetate buffer with OPK-88003 concentration of 70 mg/mL.
  • a total of 36 formulations (FDOEI - FDOE36) were evaluated (Table 22).
  • three formulations (FDOE37, FDOE38 and FDOE39) were prepared to evaluate the effect of cysteine, 20 mM concentration acetate buffer and different concentrations of methionine and arginine than those selected for the DOE study. The results obtained for these formulations were not included for the statistical analysis.
  • the designed center point formulation (FDOE20: 70 mg/mF OPK-88003, 25 mM methionine, 65 mM arginine, 95 mM sorbitol, pH 4.7) was prepared and tested in triplicate.
  • DOE samples were placed under non-stressed (5 ⁇ 3°C) and stressed (40 ⁇ 2°C/75% ⁇ 5 RH) conditions for four weeks prior to analysis.
  • Statistical optimizations were performed that resulted in the selection of candidate formulations for OPK-88003 product.
  • three additional formulations (FDOE37, FDOE38, and FDOE39) were prepared and tested concurrently with the DOE samples. The results obtained for these formulations were not included for statistical analysis.
  • the DOE calculations were carried out using four factors: pH, methionine concentration, arginine concentration, and sorbitol concentration and two responses: accumulation of % back main peak impurities (RP-HPLC), accumulation of % total aggregate impurities (SE- HPLC). The calculations were carried out with pH values obtained for samples stored at 40 ⁇ 2°C for 4 weeks.
  • OPK-88003 was tested in a phase 1 and 2 trials on 402 subjects having T2DM with a once-weekly (QW) subcutaneous (SC) dosage.
  • QW once-weekly subcutaneous
  • SC subcutaneous
  • Single and multiple ascending doses up to 60 mg QW were tested in a two-part, phase 1 double-blind, randomized, placebo-controlled, clinical pharmacology trial.
  • Doses ranging from 10 mg to 50 mg per week were tested in a 24-week double-blind (for the first 12 weeks), randomized, placebo- and active comparator (2mg exenatide ER)-controlled phase 2 trial.
  • Supratherapeutic multiple SC doses of 40 mg once daily for seven days and titrated doses of 15 to 60 mg over six days were also tested in a double blind, placebo controlled clinical pharmacology study.
  • SMBG self-monitored blood glucose
  • composition of the drug product used in this study was Formula 3 (now called OPK-88003) as a lyophilized formulation in a glass vial and which, in addition to active ingredients, contained sodium citrate dihydrate (buffer), citric acid (buffer), sucrose (stabilizer), and mannitol (bulking agent) and, eventually, sterile water prior to injection.
  • the vials contained 25 mg of Formula 3 at a pH of about 5.5.
  • the vials are provided with a solid lyophilized formulation which are reconstituted for injection with 1.1 mL sterile water for injection.
  • OPK-88003 also produced a dose-dependent weight loss of up to 3.3 kg by week
  • a randomized, double blind, dose escalation, placebo controlled study was conducted in around 110 subjects having type 2 diabetes controlled with diet and exercise alone or with a stable dose of metformin.
  • the study was aimed at treating type 2 diabetes and obesity.
  • the dose escalation regime was designed to improve glucose control and increase weight loss.
  • the study had have four phases consisting of a screening/baseline phase (up to two weeks prior to first dose); a 30-week treatment period consisting of a dose escalation phase (8 weeks) and a target dose phase (22 weeks), and a follow-up period (4 weeks).
  • Subjects were randomly assigned to OPK-88003 (Formula 3 in buffered solution) or placebo administered QW (l x per week).
  • the study evaluated the effects of a dose escalation regimen of OPK88003 on FlbAlc, weight loss, and safety over 30 weeks in adult type 2 diabetes patients with inadequate glucose control with metformin and/or diet and exercise.
  • OPK-88003 or placebo were supplied for once-weekly SC injection.
  • OPK-88003 or placebo was initially administered for 4 weeks at 20 mg QW followed by 4 weeks at 40 mg QW. Once eight weeks of dose escalation are complete, subjects received a target dose of 70 mg QW for 22 weeks.
  • the control group received matched placebo SC injections QW for 30 weeks.
  • the primary efficacy outcome of FlbAlc change from baseline to the 30-week endpoint was performed on the mITT analysis set.
  • the primary efficacy outcome was analyzed using linear constructs from an analysis of covariance (ANCOVA) model with treatment arm and BMI strata as factors and the baseline FlbAlc value as a covariate.
  • An additional supportive analysis of the primary efficacy outcome was a mixed-model repeated-measures (MMRM).
  • the factors in the model are BMI strata, treatment group, baseline value, visit, and the treatment group by visit interactions. Additional covariates may be added.
  • the mean percent weight change from baseline at the 30 week endpoint was analyzed using similar dose response models as the primary analysis.
  • a logistic regression analysis was performed for the percent of subjects with 5% or greater body weight loss with treatment and FlbAlc and BMI strata as fixed effects, and baseline weight as a covariate. Comparisons between treatment groups for the number and percent of subjects achieving FlbAlc less than or equal to 6.5% were performed for responses after 30 weeks treatment with LOCF based on a logistic regression model with a factor for treatment group with BMI strata and baseline FlbAlc as a covariate.
  • HbAlc glycosylated hemoglobin
  • the primary objective of the study is to evaluate the effect of dose escalation of QW SC OPK-88003 vs placebo injections on HbAlc absolute change from baseline to after 30 weeks treatment in subjects with type 2 diabetes mellitus (T2DM) inadequately controlled with diet and exercise alone, or treated with a stable dose of metformin.
  • Patients included in the Study have T2DM for at least 6 months based on the disease diagnostic criteria in the American Diabetes Association 2. Classification and diagnosis of diabetes: Standards of Medical Care in Diabetes- 2018 guidelines (Diabetes Care 2018: 41 (Suppl 1):S13-S27.
  • Secondary endpoints include: mean percent body weight change from baseline after the full treatment period (30 weeks); percent of subject with 5% or greater body weight loss after 30 weeks treatment; change of FPG from baseline to after 30 weeks treatment; and the number and percentage of subjects achieving HbAlc less than or equal to 6.5% (note that a 7.6% HbAlc is 60 mmol/mol and a 7.2% HbAlc is 55 mmol/mol).
  • Other objectives include: change from baseline to after 30 weeks treatment in HDL- C, total cholesterol, trigylcerides, and LDL-C; fasting FGF-21, adiponectin, beta-hydroxybutyrate, glucogon and insulin levels; incidence and rate of GI and CV events; immunogenicity of OPK- 88003 and to assess PK of OPK-88003; as well as PD endpoints that are inclusive of, but not limited to, efficacy (glucose, HbAlc, weight), tolerability (e.g. nausea and vomiting), safety (e.g., QTc, HR) and biomarkers (e.g. insulin, glucagon).
  • efficacy glucose, HbAlc, weight
  • tolerability e.g. nausea and vomiting
  • safety e.g., QTc, HR
  • biomarkers e.g. insulin, glucagon
  • Patients included in the Study were males or females 18 to 80 years of age and had an HbAlc value at screening of greater than or equal to 7.0% and less than or equal to 10.5% and a BMI of greater than or equal to 27 and less than or equal to 45 kg/m 2 at screening.
  • An adequate dose as described herein in the stable formulation directly administered to the T2DM patient in need of treatment thereof lowers HbAlc by an amount that is less than the patients pre-regimen (baseline) state.
  • the drug product/formulation is a sterile solution (1 mL extractable volume in a 2 ml, glass vial) for injection.
  • the vial contains 70 mg/mL of OPK-88003 and inactive ingredients selected from L-methionine (antioxidant), sorbitol (tonicity agent) and sodium acetate trihydrate (buffer) at a pH of about 4.5.
  • the pH is adjusted with acid or base.
  • the formulation comprises:
  • the placebo product composition is identical to the OPK-88003 drug product, without the OPK-88003 active ingredient.
  • the previous phase 2 trial study investigated the dose -response relationship of OPK-88003 versus placebo and positive control exenatide ER, and established that QW injections over 24 weeks could reduce HbAlc by up to 1.43% and weight by up to 3.3 kg.
  • the benefit risk balance of OPK-88003 supports additional clinical testing of OPK-88003 at doses higher than 50 mg QW.
  • This study includes OPK-88003 target dose of 70 mg administered weekly. Based on data from subjects with T2DM in the previous phase 2 study, the 70 mg QW dose is anticipated
  • the 70 mg QW dose level will be administered using a fixed dose escalation schedule over 8 weeks.
  • Plasma levels of OPK-88003 reach steady state over 5 weeks with the accumulation ratio for Cmax and area under the curve (AUC) up to 2.6-fold.
  • AUC area under the curve
  • a population PK model with a first order absorption and first order elimination, along with inter-individual variability for all PK parameters was used to simulate the proposed 70 mg QW dose. This dose is 33% higher (for Cmax and AUC) when compared to the 50 mg dose that had acceptable safety and tolerability over 24 weeks.
  • Simulated PK exposures derived from the previous phase 2 trial study modeling in conjunction with the phase 1 clinical pharmacology trial study with supratherapeutic exposures and nonclinical safety margins support a multiple dose of 70 mg, administered QW, in the targeted population.
  • the toxicology program for OPK-88003 provided continuous plasma exposure in rats and monkeys with a BIW dosing schedule and supports the proposed dosing regimen.
  • the safety margins for the 70 mg dose based on the exposures (AUC) derived from population PK modeling in humans and the NOAELs for organ toxicity as determined in rats (3 mg/kg) and monkeys (1.5 mg/kg) after chronic dosing correspond to exposure multiples of 0.7-fold and 10- fold, respectively.
  • the subjects followed a fixed dose escalation that includes a dose escalation over 8 weeks.
  • the target dose of 70 mg QW was reached after receiving 20 mg for 4 weeks followed by 4 weeks of 40 mg QW.
  • the study duration for individual subjects was up to 36 weeks. Blinding will be maintained throughout the study.
  • This study is designed to establish the effect of a dose-escalation regimen on safety, tolerability and efficacy of 70 mg QW OPK-88003 in subjects with T2DM, relative to placebo.
  • the study duration, target population and efficacy endpoints are typical of phase 2 trials and are consistent with FDA guidance.
  • a four-week follow-up after the treatment period will ensure an adequate time to assess reversibility of any clinical or laboratory abnormalities.
  • Subjects who develop ADA at follow-up will have one additional follow-up assessment approximately four months post last dose.
  • This clinical study enrolled subjects with inadequate glycemic control based on HbAlc values ranging from 7.0% to 10.5%, inclusive. Similar ranges of screening HbAlc have been used in numerous studies of T2DM treatments.
  • Subjects treated with diet and exercise alone or in combination with stable metformin monotherapy were enrolled.
  • Subjects on a second oral antihyperglycemic medication may be also be eligible if the second OAM was discontinued 3 months or more prior to visit 1.
  • Stable metformin treatment for at least 3 months is required to minimize baseline glucose drift prior to study entry.
  • the study duration for individual subjects was up to 36 weeks and consisted of four phases: screening (up to 2 weeks prior to first dose), dose escalation (8 weeks), target dose/maintenance (22 weeks) and follow-up (4 weeks).
  • the data was analyzed for the modified intent to treat patient population (mITT ; 108 of 113 patients) using the mixed model repeated measures (MMRM).
  • MMRM mixed model repeated measures
  • OPK88003 showed a strong, clinically meaningful reduction in HbAlc at 30 weeks
  • Tables 29 to 33 show analysis of HbAlc change from baseline to weeks 4, 8, 12, 22, and 30/LOCFh in the MMRM mITT population.
  • Table 34 shows the analysis of HbAlc change from baseline to week 30/LOCFall in the ANCOVA mITT population.
  • Table 35 shows the analysis of weight change from baseline to week 30 in the MMRM mITT population.
  • OPK88003 treated patients showed significant blood triglyceride decreases from baseline.
  • OPK88003 treatment showed a safety and tolerability profile expected for the GLP-1 receptor agonist class.
  • the most frequent adverse events were nausea, vomiting and diarrhea. These were mostly mild and occurred predominantly during the titration period and resolved over time. No serious adverse events were observed.
  • Table 37 shows the analysis of triglycerides change from baseline to week 30 in MMRM mITT population.
  • Table 30 Analysis of HbAlc Change from Baseline to Week 8: MMRM mlTT Population
  • Table 31 Analysis of HbAlc Change from Baseline to Week 12: MMRM mlTT Population
  • Table 32 Analysis of HbAlc Change from Baseline to Week 22: MMRM mlTT Population
  • Table 33 Analysis of HbAlc Change from Baseline to Week 30/LOCFh: MMRM mlTT Population
  • Table 34 Analysis of HbAlc Change from Baseline to Week 30/LOCFall: ANCOVA mlTT Population
  • Table 35 Analysis of Weight Change from Baseline to Week 30: MMRM mlTT Population
  • Table 37 Analysis of Triglycerides Change from Baseline to Week 30: MMRM mITT Population
  • Example 8 Solubility, Viscosity, Syringeability, Temperature Excursion, and Stability
  • OPK-88003 peptide formulated at 60, 70, and 80 mg/mL in 10 mM citrate buffer pH 5.5 The following methods were used for testing the OPK-88003 samples: MFI, HIAC, DLS, Viscosity and Syringeability. Further, a solubility study was performed for OPK-88003 samples formulated at 40, 60, and 80 mg/mL in 10 mM citrate buffer pH 5.5.
  • Viscosity As expected, the viscosity in the tested formulations increased with increasing the OPK-88003 concentration. For all formulations the viscosity remained unchanged with increasing shear rate displaying Newtonian behavior.
  • Rabbits were assigned to four treatment groups (two females/group), and each animal received two single subcutaneous injections, one containing vehicle control, and the other containing OPK-88003 test item formulation: Rabbits were subcutaneously injected with 1 mL of either an acetate buffer-based Vehicle Control 1 and 25 or 75 mg/mL of OPK-88003 formulated in the acetate buffer-based vehicle, or a citrate buffer-based Vehicle Control 2 and 25 or 75 mg/mL of OPK-88003 formulated in the citrate buffer based vehicle as outlined below.
  • Vehicle (Control) 1 10 mM Acetate buffer, 30 mM Methionine, 230 mM Sorbitol, pH 4.5
  • injection site 1 was in a different location than injection site 2
  • Erythema No animals exhibited erythema at the injection site after administration of either of the two vehicle controls or the test item formulations at 25 or 75 mg/mL during the study.
  • Edema Associated with Vehicle Controls Very slight edema (score 1) was observed in one animal (#002) up to 30 minutes post dosing at the injection site of acetate buffer- based vehicle (Vehicle Control 1) administration, and in two animals (#006, #007) (score 1) up to 77 minutes post dosing at the injection site of citrate bufferbased vehicle (Vehicle Control 2) administration. Average edema scores at the acetate buffer-based vehicle injection sites were 0.25 and 0 at 15 minutes post dosing and the last scoring time point, respectively (beginning and end of study, respectively). Average edema scores at the citrate buffer-based vehicle injection sites were 0.5 and 0.5 at the beginning and end of study, respectively.
  • Edema Associated with 25 and 70 mg/niL of OPK-88003 Very slight (score 1) to slight (score 2) edema was seen in all animals at the injection sites of OPK-88003 test item formulation administration, as early as 15 minutes post dosing, and either remained the same or decreased in severity by the end of the study. Animals in Groups 1 and 3 (administered the test item at 25 mg/animal formulated in acetate and citrate buffered-based vehicle, respectively) similarly exhibited average edema scores of 2 and 1.5 at the beginning and end of study, respectively.
  • the degree of localized edema at the injection site was slightly greater with administration of OPK-88003 compared to vehicle controls, regardless of the vehicle used for formulation.
  • Injection site edema associated with 25 mg/mL of OPK-88003 was similar whether formulated in an acetate or citrate buffer-based vehicle.
  • Injection site edema associated with 70 mg/mL of OPK-88003 was slightly greater in the acetate compared to the citrate buffer- based vehicle.
  • the degree of injection site edema and any differences observed between treatment groups were minimal, and therefore not considered adverse or significant.
  • OPK-880033 formulated in either an acetate or citrate buffer-based vehicle at a dose level of 25 or 70 mg/animal was well tolerated in female New Zealand white rabbits and associated with only very slight edema localized to the injection site.
  • edema associated with OPK-88003 formulations likely due to high viscosity, was slightly greater than what was seen with vehicle controls alone, because the edema was not dose-dependent, minimal, and not considered adverse it was concluded that there were no considerable differences in localized injection site edema between the two vehicle controls or dose levels of OPK-88003 formulation.
  • the inventors found that while typical isotonic solutions containing sodium chloride are generally suitable for delivering drugs in liquid or parenteral formulations, the presence of sodium chloride in solutions containing the PEGylated oxyntomodulin analogs unexpectedly caused instability issues. Further, the addition of the PEGylated oxyntomodulin compounds or analogs described herein surprisingly caused a rise in pH beyond the preferred range.
  • the inventors therefore discovered liquid formulations according to the present invention that meet the requisite physical and chemical stability criteria. The inventors have, by discovering the stable liquid formulation herein, avoided the need to use solid dispersions of drug (i.e., lyophilized or otherwise) which need to be reconstituted with water or saline solution prior to administration to the patient.
  • the formulation is stable as a refrigerated liquid and does not require freezing to maintain stability, allowing for storage in a pre-filled syringe or cartridge rather than a vial, and making it easier for at home use by patients.
  • the patient or medical professional can thus“directly administer” the dosage form from a pre-filled syringe, cartridge or filled vial without taking the additional step of reconstituting a powder formulation and/or such individual could not use a pre-filled syringe (or pre-filled vial) absent of having such a stable liquid formulation.
  • formulations can include any PEGylated oxyntomodulin analog and any suitable buffer and/or tonicity agents and/or stabilizing agents provided such liquid formulations made therefrom are substantially free of impurities, amenable to sterile manufacturing, stable and meet the requisite delivery characteristics and physical characteristics including flow, viscosity and suitability for the delivery methods which include pre-filled syringes, autoinjectors etc for single and multiple use.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Diabetes (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Endocrinology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Hematology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Obesity (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Toxicology (AREA)
  • Emergency Medicine (AREA)
  • Immunology (AREA)
  • Dermatology (AREA)
  • Analytical Chemistry (AREA)
  • Child & Adolescent Psychology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
PCT/EP2019/083022 2018-11-30 2019-11-29 Oxyntomodulin peptide analog formulations Ceased WO2020109526A2 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
KR1020217020458A KR20210135476A (ko) 2018-11-30 2019-11-29 옥신토모둘린 펩티드 유사체 제제
CA3120794A CA3120794C (en) 2018-11-30 2019-11-29 OXYNTOMODULINE PEPTIDE ANALOGUE FORMULATIONS
CN202510607757.5A CN120514662A (zh) 2018-11-30 2019-11-29 胃泌酸调节素肽类似物制剂
MX2021006259A MX2021006259A (es) 2018-11-30 2019-11-29 Formulaciones de análogos peptídicos de oxintomodulina.
JP2021531335A JP7798569B2 (ja) 2018-11-30 2019-11-29 オキシントモジュリンペプチド類似体製剤
CN201980089205.2A CN113365606A (zh) 2018-11-30 2019-11-29 胃泌酸调节素肽类似物制剂
EP19820673.2A EP3886807A2 (en) 2018-11-30 2019-11-29 Oxyntomodulin peptide analog formulations
AU2019387342A AU2019387342B2 (en) 2018-11-30 2019-11-29 Oxyntomodulin peptide analog formulations
EA202191511A EA202191511A1 (ru) 2019-03-20 2019-11-29 Составы на основе аналога пептида оксинтомодулина
MX2025015078A MX2025015078A (es) 2018-11-30 2021-05-27 Formulaciones de analogos peptidicos de oxintomodulina
PH12021551243A PH12021551243A1 (en) 2018-11-30 2021-05-28 Oxyntomodulin peptide analog formulations
IL283553A IL283553A (en) 2018-11-30 2021-05-30 Oxyntomodulin peptide analog formulations

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201862773651P 2018-11-30 2018-11-30
US62/773,651 2018-11-30
US201962821382P 2019-03-20 2019-03-20
US62/821,382 2019-03-20

Publications (3)

Publication Number Publication Date
WO2020109526A2 true WO2020109526A2 (en) 2020-06-04
WO2020109526A3 WO2020109526A3 (en) 2020-09-17
WO2020109526A8 WO2020109526A8 (en) 2021-10-07

Family

ID=68886992

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2019/083022 Ceased WO2020109526A2 (en) 2018-11-30 2019-11-29 Oxyntomodulin peptide analog formulations

Country Status (11)

Country Link
US (1) US12441776B2 (cg-RX-API-DMAC7.html)
EP (1) EP3886807A2 (cg-RX-API-DMAC7.html)
JP (1) JP7798569B2 (cg-RX-API-DMAC7.html)
KR (1) KR20210135476A (cg-RX-API-DMAC7.html)
CN (2) CN120514662A (cg-RX-API-DMAC7.html)
AU (1) AU2019387342B2 (cg-RX-API-DMAC7.html)
CA (2) CA3120794C (cg-RX-API-DMAC7.html)
IL (1) IL283553A (cg-RX-API-DMAC7.html)
MX (2) MX2021006259A (cg-RX-API-DMAC7.html)
PH (1) PH12021551243A1 (cg-RX-API-DMAC7.html)
WO (1) WO2020109526A2 (cg-RX-API-DMAC7.html)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021140174A1 (en) * 2020-01-10 2021-07-15 Medimmune Limited Glucagon and glp-1 co-agonists for the treatment of chronic kidney disease and diabetic kidney disease in type 2 diabetes
US20230104501A1 (en) * 2021-09-28 2023-04-06 Spitfire Pharma Llc Therapeutic Regimens and Methods for Lowering Blood Glucose and/or Body Weight using GLP-1R and GCGR Balanced Agonists
JP2023549126A (ja) * 2020-11-09 2023-11-22 レアルタ ライフ サイエンシズ インコーポレイテッド ペプチド製剤および使用方法
JP2024500324A (ja) * 2020-12-07 2024-01-09 スピットファイア ファーマ エルエルシー Glp-1rおよびgcgr均衡アゴニストを使用した血糖および/または体重を低下させるための治療レジメンおよび方法
WO2025169190A3 (en) * 2024-02-06 2025-11-06 Opko Biologics Ltd. Modified oxyntomodulin and methods of use thereof

Citations (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5900461A (en) 1993-11-12 1999-05-04 Shearwater Polymers, Inc. Isolatable, water soluble, and hydrolytically stable active sulfones of poly(ethylene glycol) and related polymers for modification of surfaces and molecules
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
US6436386B1 (en) 2000-11-14 2002-08-20 Shearwater Corporation Hydroxyapatite-targeting poly (ethylene glycol) and related polymers
US6448369B1 (en) 1997-11-06 2002-09-10 Shearwater Corporation Heterobifunctional poly(ethylene glycol) derivatives and methods for their preparation
US6515100B2 (en) 1996-09-26 2003-02-04 Shearwater Corporation Soluble, degradable poly (ethylene glycol) derivatives for controllable release of bound molecules into solution
WO2008076933A2 (en) 2006-12-14 2008-06-26 Bolder Biotechnology, Inc. Long acting proteins and peptides and methods of making and using the same
US20090298757A1 (en) 2005-06-13 2009-12-03 Imperial Innovations Limited Oxyntomodulin analogues and their effects on feeding behaviour
US20100016550A1 (en) 2006-05-26 2010-01-21 Zheng Xin Dong Methods for Site-Specific Pegylation
US7851491B2 (en) 2002-11-20 2010-12-14 Nof Corporation Modified bio-related substance, process for producing the same, and intermediate
US20110034374A1 (en) 2001-09-07 2011-02-10 Imperial Innovations Limited Oxyntomodulin for Preventing or Treating Excess Weight
US20110136737A1 (en) 2006-08-17 2011-06-09 Amylin Pharmaceuticals, Inc. DPP-IV Resistant GIP Hybrid Polypeptides with Selectable Properties
US20110152182A1 (en) 2009-12-22 2011-06-23 Eli Lilly And Company Oxyntomodulin peptide analogue
US20120183617A1 (en) 2009-09-23 2012-07-19 Biokier, Inc. Composition and method for treatment of diabetes
US8263084B2 (en) 2003-11-13 2012-09-11 Hanmi Science Co., Ltd Pharmaceutical composition for treating obesity-related disease comprising insulinotropic peptide conjugate
US20130059780A1 (en) 2004-07-13 2013-03-07 Biogenerix Ag Branched peg remodeling and glycosylation of glucagon-like peptide-1 [glp-1]
US20130085104A1 (en) 2008-06-27 2013-04-04 Duke University Therapeutic agents comprising elastin-like peptides
US8415926B2 (en) 2009-10-19 2013-04-09 Apple Inc. In-situ battery health detector and end-of-life indicator
US8415296B2 (en) 2009-12-22 2013-04-09 Eli Lilly And Company Oxyntomodulin peptide analogue
US20130137631A1 (en) 2005-02-11 2013-05-30 Amylin Pharmaceuticals, Llc Gip analog and hybrid polypeptides with selectable properties
US20140128318A1 (en) 2011-06-10 2014-05-08 Hanmi Science Co., Ltd. Novel oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same
US8729017B2 (en) 2011-06-22 2014-05-20 Indiana University Research And Technology Corporation Glucagon/GLP-1 receptor co-agonists
US20140142023A1 (en) 2011-07-19 2014-05-22 Sanofi Pharmaceutical Composition for Treating A Metabolic Syndrome
US20140249299A1 (en) 2004-02-11 2014-09-04 Astrazeneca Pharmaceuticals Lp Hybrid polypeptides with selectable properties
US20140349922A1 (en) 2011-06-02 2014-11-27 Udi Eyal Fima Long-acting glp-1/glucagon receptor agonists
US20150072924A1 (en) 2012-04-19 2015-03-12 Opko Biologics Ltd. Long-acting oxyntomodulin variants and methods of producing same
US20150111246A1 (en) 2012-04-24 2015-04-23 Astrazeneca Pharmaceuticals Lp Site-specific enzymatic modification of exendins and analogs thereof
US20150148289A1 (en) 2012-06-04 2015-05-28 Opko Biologics Ltd. Pegylated oxm variants
US20150182593A1 (en) 2012-07-25 2015-07-02 Hanmi Pharm. Co., Ltd. Composition for treating hyperlipidemia comprising oxyntomodulin derivative
US20150290324A1 (en) 2012-11-06 2015-10-15 Hanmi Pharm. Co., Ltd. Liquid formulation of protein conjugate comprising the oxyntomodulin and an immunoglobulin fragment
US20150299282A1 (en) 2012-11-06 2015-10-22 Hanmi Pharm. Co., Ltd. A composition for treating diabetes or diabesity comprising oxyntomodulin analog
WO2016045400A1 (zh) 2014-09-23 2016-03-31 蒋先兴 胃泌酸调节素类似物
US20160317623A1 (en) 2013-12-18 2016-11-03 The California Institute For Biomedical Research Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof
US20170128589A1 (en) 2014-03-31 2017-05-11 Hanmi Pharm. Co., Ltd. Method for improving solubility of protein and peptide by using immunoglogulin fc fragment linkage
US9663565B2 (en) 2013-01-03 2017-05-30 Hanmi Pharm. Co., Ltd. Insulinotropic peptide derivative with modified N-terminal charge
US9758562B2 (en) 2011-06-22 2017-09-12 Indiana University and Technology Corporation Glucagon/GLP-1 receptor co-agonists

Family Cites Families (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
NL154600B (nl) 1971-02-10 1977-09-15 Organon Nv Werkwijze voor het aantonen en bepalen van specifiek bindende eiwitten en hun corresponderende bindbare stoffen.
NL154598B (nl) 1970-11-10 1977-09-15 Organon Nv Werkwijze voor het aantonen en bepalen van laagmoleculire verbindingen en van eiwitten die deze verbindingen specifiek kunnen binden, alsmede testverpakking.
NL154599B (nl) 1970-12-28 1977-09-15 Organon Nv Werkwijze voor het aantonen en bepalen van specifiek bindende eiwitten en hun corresponderende bindbare stoffen, alsmede testverpakking.
US3901654A (en) 1971-06-21 1975-08-26 Biological Developments Receptor assays of biologically active compounds employing biologically specific receptors
US3853987A (en) 1971-09-01 1974-12-10 W Dreyer Immunological reagent and radioimmuno assay
US3867517A (en) 1971-12-21 1975-02-18 Abbott Lab Direct radioimmunoassay for antigens and their antibodies
NL171930C (nl) 1972-05-11 1983-06-01 Akzo Nv Werkwijze voor het aantonen en bepalen van haptenen, alsmede testverpakkingen.
US3850578A (en) 1973-03-12 1974-11-26 H Mcconnell Process for assaying for biologically active molecules
US3935074A (en) 1973-12-17 1976-01-27 Syva Company Antibody steric hindrance immunoassay with two antibodies
US3996345A (en) 1974-08-12 1976-12-07 Syva Company Fluorescence quenching with immunological pairs in immunoassays
US4034074A (en) 1974-09-19 1977-07-05 The Board Of Trustees Of Leland Stanford Junior University Universal reagent 2-site immunoradiometric assay using labelled anti (IgG)
US3984533A (en) 1975-11-13 1976-10-05 General Electric Company Electrophoretic method of detecting antigen-antibody reaction
US4098876A (en) 1976-10-26 1978-07-04 Corning Glass Works Reverse sandwich immunoassay
US4879219A (en) 1980-09-19 1989-11-07 General Hospital Corporation Immunoassay utilizing monoclonal high affinity IgM antibodies
US5011771A (en) 1984-04-12 1991-04-30 The General Hospital Corporation Multiepitopic immunometric assay
DE3421468A1 (de) 1984-06-08 1985-12-19 Dr. Rentschler Arzneimittel Gmbh & Co, 7958 Laupheim Lipidnanopellets als traegersystem fuer arzneimittel zur peroralen anwendung
US4666828A (en) 1984-08-15 1987-05-19 The General Hospital Corporation Test for Huntington's disease
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4801531A (en) 1985-04-17 1989-01-31 Biotechnology Research Partners, Ltd. Apo AI/CIII genomic polymorphisms predictive of atherosclerosis
WO1989010756A1 (fr) 1988-05-06 1989-11-16 Toray Industries, Inc. COMPOSITION D'INTERFERON beta STABLE
US5272057A (en) 1988-10-14 1993-12-21 Georgetown University Method of detecting a predisposition to cancer by the use of restriction fragment length polymorphism of the gene for human poly (ADP-ribose) polymerase
US5464764A (en) 1989-08-22 1995-11-07 University Of Utah Research Foundation Positive-negative selection methods and vectors
US5192659A (en) 1989-08-25 1993-03-09 Genetype Ag Intron sequence analysis method for detection of adjacent and remote locus alleles as haplotypes
JP3148298B2 (ja) 1991-09-02 2001-03-19 帝人株式会社 軽量複合成形物の製造法
US5281521A (en) 1992-07-20 1994-01-25 The Trustees Of The University Of Pennsylvania Modified avidin-biotin technique
US5643575A (en) 1993-10-27 1997-07-01 Enzon, Inc. Non-antigenic branched polymer conjugates
US5919455A (en) 1993-10-27 1999-07-06 Enzon, Inc. Non-antigenic branched polymer conjugates
US5605976A (en) 1995-05-15 1997-02-25 Enzon, Inc. Method of preparing polyalkylene oxide carboxylic acids
US5541110A (en) 1994-05-17 1996-07-30 Bristol-Myers Squibb Cloning and expression of a gene encoding bryodin 1 from Bryonia dioica
US5858975A (en) 1994-11-07 1999-01-12 Kyowa Hakko Kogyo Co., Ltd. Oxyntomodulin peptide having cardiotonic activity and insulin release-bromating activity
DE69624488T2 (de) 1995-08-10 2003-06-26 Kazunori Kataoka Blockcopolymere mit funktionellen gruppen an beiden kettenenden
IL119029A0 (en) 1996-08-07 1996-11-14 Yeda Res & Dev Long-acting drugs and pharamaceutical compositions comprising them
DE69939036D1 (de) 1998-04-28 2008-08-14 Serono Lab PEG Konjugate von LHRH Analogen
US6617276B1 (en) 2000-07-21 2003-09-09 Johnson Matthey Public Limited Company Hydrocarbon trap/catalyst for reducing cold-start emissions from internal combustion engines
IL139400A0 (en) 2000-11-01 2001-11-25 Yeda Res & Dev Long-acting cytokine derivatives and pharmaceutical compositions comprising them
EP2123293A3 (en) 2000-12-14 2010-09-08 Amylin Pharmaceuticals, Inc. Peptide YY and petide YY agonists for treatment of metabolic disorders
KR100870013B1 (ko) 2002-08-27 2008-11-21 삼성전자주식회사 박막 트랜지스터 어레이 기판 및 그 제조 방법
GB0300571D0 (en) 2003-01-10 2003-02-12 Imp College Innovations Ltd Modification of feeding behaviour
PL1620118T3 (pl) 2003-04-08 2014-11-28 Yeda Res & Dev Leki odwracalnie pegylowane
ATE553124T1 (de) 2005-06-13 2012-04-15 Imp Innovations Ltd Oxyntomodulinanaloga und ihre wirkungen auf das fressverhalten
CA2638800A1 (en) 2006-02-22 2007-09-07 Merck & Co., Inc. Oxyntomodulin derivatives
WO2010033240A2 (en) 2008-09-19 2010-03-25 Nektar Therapeutics Carbohydrate-based drug delivery polymers and conjugates thereof
CN102281865B (zh) 2008-10-15 2017-04-05 精达制药公司 高浓缩药物颗粒、制剂、混悬剂及其应用
MX2011009803A (es) 2009-03-20 2011-09-30 Hanmi Holdings Co Ltd Metodo para preparar un polipeptido conjugado fisiologicamente activo en un sitio especifico.
WO2012101619A1 (en) 2011-01-24 2012-08-02 Ben Gurion University Of The Negev Research And Development Authority A method for evaluating a mental disorder
US10166295B2 (en) 2011-06-02 2019-01-01 Opko Biologics Ltd. Pegylated OXM variants
RU2607365C2 (ru) 2011-06-17 2017-01-10 Ханми Сайенс Ко., Лтд. Конъюгат, содержащий оксинтомодулин и фрагмент иммуноглобулина, и его применение
EP3230309B1 (en) 2014-12-10 2023-03-29 OPKO Biologics Ltd. Methods of producing long acting ctp-modified growth hormone polypeptides
EP3468610A1 (en) 2016-06-09 2019-04-17 OPKO Biologics Ltd. Long-acting oxyntomodulin formulation and methods of producing and administering same

Patent Citations (44)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5900461A (en) 1993-11-12 1999-05-04 Shearwater Polymers, Inc. Isolatable, water soluble, and hydrolytically stable active sulfones of poly(ethylene glycol) and related polymers for modification of surfaces and molecules
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
US6515100B2 (en) 1996-09-26 2003-02-04 Shearwater Corporation Soluble, degradable poly (ethylene glycol) derivatives for controllable release of bound molecules into solution
US6448369B1 (en) 1997-11-06 2002-09-10 Shearwater Corporation Heterobifunctional poly(ethylene glycol) derivatives and methods for their preparation
US6436386B1 (en) 2000-11-14 2002-08-20 Shearwater Corporation Hydroxyapatite-targeting poly (ethylene glycol) and related polymers
US20150024066A1 (en) 2001-09-07 2015-01-22 Imperial Innovations Methods for preventing or treating excess weight using oxyntomodulin
US20110034374A1 (en) 2001-09-07 2011-02-10 Imperial Innovations Limited Oxyntomodulin for Preventing or Treating Excess Weight
US7851491B2 (en) 2002-11-20 2010-12-14 Nof Corporation Modified bio-related substance, process for producing the same, and intermediate
US8263084B2 (en) 2003-11-13 2012-09-11 Hanmi Science Co., Ltd Pharmaceutical composition for treating obesity-related disease comprising insulinotropic peptide conjugate
US20140249299A1 (en) 2004-02-11 2014-09-04 Astrazeneca Pharmaceuticals Lp Hybrid polypeptides with selectable properties
US20130059780A1 (en) 2004-07-13 2013-03-07 Biogenerix Ag Branched peg remodeling and glycosylation of glucagon-like peptide-1 [glp-1]
US20130137631A1 (en) 2005-02-11 2013-05-30 Amylin Pharmaceuticals, Llc Gip analog and hybrid polypeptides with selectable properties
US20090298757A1 (en) 2005-06-13 2009-12-03 Imperial Innovations Limited Oxyntomodulin analogues and their effects on feeding behaviour
US20100016550A1 (en) 2006-05-26 2010-01-21 Zheng Xin Dong Methods for Site-Specific Pegylation
US20110136737A1 (en) 2006-08-17 2011-06-09 Amylin Pharmaceuticals, Inc. DPP-IV Resistant GIP Hybrid Polypeptides with Selectable Properties
US20130281374A1 (en) 2006-08-17 2013-10-24 Astrazeneca Pharmaceuticals Lp Dpp-iv resistant gip hybrid polypeptides with selectable properties
US20100121032A1 (en) 2006-12-14 2010-05-13 Bolder Biotechnology, Inc. Long acting proteins and peptides and methods of making and using the same
WO2008076933A2 (en) 2006-12-14 2008-06-26 Bolder Biotechnology, Inc. Long acting proteins and peptides and methods of making and using the same
US20130085104A1 (en) 2008-06-27 2013-04-04 Duke University Therapeutic agents comprising elastin-like peptides
US20120183617A1 (en) 2009-09-23 2012-07-19 Biokier, Inc. Composition and method for treatment of diabetes
US9301938B2 (en) 2009-09-23 2016-04-05 Biokier, Inc. Composition and method for treatment of diabetes
US8415926B2 (en) 2009-10-19 2013-04-09 Apple Inc. In-situ battery health detector and end-of-life indicator
US8415296B2 (en) 2009-12-22 2013-04-09 Eli Lilly And Company Oxyntomodulin peptide analogue
US8367607B2 (en) 2009-12-22 2013-02-05 Eli Lilly And Company Oxyntomodulin peptide analogue
US20110152182A1 (en) 2009-12-22 2011-06-23 Eli Lilly And Company Oxyntomodulin peptide analogue
US20140349922A1 (en) 2011-06-02 2014-11-27 Udi Eyal Fima Long-acting glp-1/glucagon receptor agonists
US20140128318A1 (en) 2011-06-10 2014-05-08 Hanmi Science Co., Ltd. Novel oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same
US8729017B2 (en) 2011-06-22 2014-05-20 Indiana University Research And Technology Corporation Glucagon/GLP-1 receptor co-agonists
US20170349642A1 (en) 2011-06-22 2017-12-07 Indiana University Research And Technology Corporation Glucagon/glp-1 receptor co-agonists
US9758562B2 (en) 2011-06-22 2017-09-12 Indiana University and Technology Corporation Glucagon/GLP-1 receptor co-agonists
US20140142023A1 (en) 2011-07-19 2014-05-22 Sanofi Pharmaceutical Composition for Treating A Metabolic Syndrome
US20150072924A1 (en) 2012-04-19 2015-03-12 Opko Biologics Ltd. Long-acting oxyntomodulin variants and methods of producing same
US20170088598A1 (en) 2012-04-19 2017-03-30 Opko Biologics Ltd. Long-acting oxyntomodulin variants and methods of producing same
US20150111246A1 (en) 2012-04-24 2015-04-23 Astrazeneca Pharmaceuticals Lp Site-specific enzymatic modification of exendins and analogs thereof
US20150148289A1 (en) 2012-06-04 2015-05-28 Opko Biologics Ltd. Pegylated oxm variants
US20150182593A1 (en) 2012-07-25 2015-07-02 Hanmi Pharm. Co., Ltd. Composition for treating hyperlipidemia comprising oxyntomodulin derivative
US20150299282A1 (en) 2012-11-06 2015-10-22 Hanmi Pharm. Co., Ltd. A composition for treating diabetes or diabesity comprising oxyntomodulin analog
US20150290324A1 (en) 2012-11-06 2015-10-15 Hanmi Pharm. Co., Ltd. Liquid formulation of protein conjugate comprising the oxyntomodulin and an immunoglobulin fragment
US9663565B2 (en) 2013-01-03 2017-05-30 Hanmi Pharm. Co., Ltd. Insulinotropic peptide derivative with modified N-terminal charge
US20170226175A1 (en) 2013-01-03 2017-08-10 Hanmi Pharm. Co., Ltd. Insulinotropic peptide derivative with modified n-terminal charge
US20160317623A1 (en) 2013-12-18 2016-11-03 The California Institute For Biomedical Research Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof
US20170128589A1 (en) 2014-03-31 2017-05-11 Hanmi Pharm. Co., Ltd. Method for improving solubility of protein and peptide by using immunoglogulin fc fragment linkage
WO2016045400A1 (zh) 2014-09-23 2016-03-31 蒋先兴 胃泌酸调节素类似物
US20170183383A1 (en) 2014-09-23 2017-06-29 Xianxing JIANG Oxyntomodulin analogue

Non-Patent Citations (8)

* Cited by examiner, † Cited by third party
Title
BAGGIO ET AL., GASTROENTEROL, vol. 127, 2004, pages 546 - 558
CROKER, JOURNAL OF BIOMOLECULAR TECHNIQUES, vol. 11, no. 3, 2000, pages 135 - 141
DAVIES ET AL., JAMA, vol. 314, 2015, pages 687 - 699
KOSINSKI ET AL., OBESITY, vol. 20, 2012, pages 1566 - 1571
MAIDA ET AL., ENDOCRINOL, vol. 149, 2008, pages 5670 - 5678
SANTOPRETE ET AL., J. PEPT. SCI., vol. 17, 2011, pages 270 - 280
SOWDEN, AM J PHYSIOL. REG, INTEGR COMP. PHYSIOL., vol. 292, 2007, pages R962 - R970
WYNNE ET AL., CURR OPIN INVESTIG DRUGS, vol. 11, 2010, pages 1151 - 1157

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021140174A1 (en) * 2020-01-10 2021-07-15 Medimmune Limited Glucagon and glp-1 co-agonists for the treatment of chronic kidney disease and diabetic kidney disease in type 2 diabetes
JP2023549126A (ja) * 2020-11-09 2023-11-22 レアルタ ライフ サイエンシズ インコーポレイテッド ペプチド製剤および使用方法
JP2024500324A (ja) * 2020-12-07 2024-01-09 スピットファイア ファーマ エルエルシー Glp-1rおよびgcgr均衡アゴニストを使用した血糖および/または体重を低下させるための治療レジメンおよび方法
US20230104501A1 (en) * 2021-09-28 2023-04-06 Spitfire Pharma Llc Therapeutic Regimens and Methods for Lowering Blood Glucose and/or Body Weight using GLP-1R and GCGR Balanced Agonists
US12171806B2 (en) * 2021-09-28 2024-12-24 Spitfire Pharma Llc Therapeutic regimens and methods for lowering blood glucose and/or body weight using GLP-1R and GCGR balanced agonists
WO2025169190A3 (en) * 2024-02-06 2025-11-06 Opko Biologics Ltd. Modified oxyntomodulin and methods of use thereof

Also Published As

Publication number Publication date
AU2019387342A1 (en) 2021-06-24
US12441776B2 (en) 2025-10-14
MX2025015078A (es) 2026-02-03
MX2021006259A (es) 2021-09-30
CA3249297A1 (en) 2025-02-26
PH12021551243A1 (en) 2021-12-13
WO2020109526A8 (en) 2021-10-07
CN120514662A (zh) 2025-08-22
CA3120794A1 (en) 2020-06-04
EP3886807A2 (en) 2021-10-06
KR20210135476A (ko) 2021-11-15
JP2022513176A (ja) 2022-02-07
JP7798569B2 (ja) 2026-01-14
WO2020109526A3 (en) 2020-09-17
AU2019387342B2 (en) 2026-02-26
CN113365606A (zh) 2021-09-07
US20200262887A1 (en) 2020-08-20
IL283553A (en) 2021-07-29
CA3120794C (en) 2025-11-25

Similar Documents

Publication Publication Date Title
AU2019387342B2 (en) Oxyntomodulin peptide analog formulations
CN100374461C (zh) 胰高血糖素样肽-2及其治疗应用
AU2017322277A1 (en) Amylin analogues
CA2758264A1 (en) Neuromedin u derivative
CN104870009A (zh) 官能化的毒蜥外泌肽-4衍生物
Lee et al. Intrapulmonary potential of polyethylene glycol-modified glucagon-like peptide-1s as a type 2 anti-diabetic agent
WO2021175974A1 (en) Peptides as selective gip receptor agonists
AU2022339059A1 (en) New peptides as potent and selective gip receptor agonists
EP4262745B1 (en) Pharmaceutical composition of glp-1/glp-2 dual agonists
JP7751641B2 (ja) Glp-1/glp-2デュアルアゴニストの医薬組成物
KR20230121824A (ko) Glp-1/glp-2 이중 효능제의 약학적 조성물
EA052775B1 (ru) Составы на основе аналога пептида оксинтомодулина
HK40095698B (en) Pharmaceutical composition of glp-1/glp-2 dual agonists
HK40095698A (en) Pharmaceutical composition of glp-1/glp-2 dual agonists
WO2025141129A1 (en) Formulations of glucagon-like-peptide 2 (glp-2) analogues and their uses

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19820673

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3120794

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021531335

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2101003079

Country of ref document: TH

WWE Wipo information: entry into national phase

Ref document number: 283553

Country of ref document: IL

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019387342

Country of ref document: AU

Date of ref document: 20191129

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019820673

Country of ref document: EP

Effective date: 20210630