WO2020106708A1 - Split interleukin mimetics and their use - Google Patents

Split interleukin mimetics and their use

Info

Publication number
WO2020106708A1
WO2020106708A1 PCT/US2019/062198 US2019062198W WO2020106708A1 WO 2020106708 A1 WO2020106708 A1 WO 2020106708A1 US 2019062198 W US2019062198 W US 2019062198W WO 2020106708 A1 WO2020106708 A1 WO 2020106708A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
polypeptide
peptide
amino acid
residue
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/062198
Other languages
English (en)
French (fr)
Inventor
Alfredo QUIJANO RUBIO
Daniel Adriano SILVA MANZANO
David Baker
Umut ULGE
Marc Joseph LAJOIE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Washington
Original Assignee
University of Washington
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2021517768A priority Critical patent/JP2022511390A/ja
Priority to KR1020217014525A priority patent/KR20210094531A/ko
Priority to CN201980070569.6A priority patent/CN112912388A/zh
Priority to MX2021005593A priority patent/MX2021005593A/es
Priority to CN202510054463.4A priority patent/CN120040576A/zh
Priority to US17/294,807 priority patent/US12234572B2/en
Priority to BR112021008985-3A priority patent/BR112021008985A2/pt
Priority to EA202190593A priority patent/EA202190593A1/ru
Priority to AU2019384523A priority patent/AU2019384523B2/en
Application filed by University of Washington filed Critical University of Washington
Priority to SG11202103045SA priority patent/SG11202103045SA/en
Priority to EP19848950.2A priority patent/EP3883956A1/en
Priority to CA3119472A priority patent/CA3119472A1/en
Publication of WO2020106708A1 publication Critical patent/WO2020106708A1/en
Priority to IL283217A priority patent/IL283217A/en
Anticipated expiration legal-status Critical
Priority to JP2024175673A priority patent/JP2025013348A/ja
Priority to US19/016,343 priority patent/US20250179690A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C40COMBINATORIAL TECHNOLOGY
    • C40BCOMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
    • C40B40/00Libraries per se, e.g. arrays, mixtures
    • C40B40/04Libraries containing only organic compounds
    • C40B40/10Libraries containing peptides or polypeptides, or derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/55IL-2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5406IL-4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/2013IL-2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/2026IL-4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/2086IL-13 to IL-16
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5437IL-13
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5443IL-15
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • conditionally active receptor agonists comprising a first polypeptide component and a second polypeptide component, wherein the first polypeptide component and the second polypeptide component are not present in a fusion protein, wherein in total the first polypeptide component and the second polypeptide component comprise domains XI, X2, X3, and X4, wherein:
  • XI is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide (PKKKIQ)LHAEHALYDAL£MILNI) (SEQ ID NO:
  • X2 is any helical peptide domain at least 8 amino acids in length
  • X3 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide (LE)DYAFNFELI£LEEIARLFESG) (SEQ ID NO:5); and
  • X4 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%,
  • amino acid residues in parentheses may be present or absent;
  • the first polypeptide component comprises at least one of XI, X2, X3, and X4 but does not comprise each of XI, X2, X3, and X4;
  • the second polypeptide component comprises each of XI, X2, X3, and X4 that is not present in the first polypeptide component;
  • first polypeptide component and the second polypeptide component are not active receptor agonists individually, and wherein the first polypeptide component and the second polypeptide interact to form an active agonist of IL-2 receptor bg V heterodimer (IL-2RpY c ), IL-4 receptor ⁇ g cheterodimer (IL-4RaY e ), IL-13 alpha, or IL-
  • the first polypeptide component includes one of XI, X2, X3, and X4, and the second polypeptide component includes the three of XI, X2, X3, and X4 that are not present in the first polypeptide component; or
  • the first polypeptide component includes two of XI, X2, X3, and X4, and the second polypeptide component includes the two of XI, X2, X3, and X4 that are not present in the first polypeptide component.
  • the first polypeptide component includes two of XI, X2, X3, and X4
  • the second polypeptide component includes the two of XI, X2, X3, and X4 that are not present in the first polypeptide component.
  • the first polypeptide comprises XI and the second polypeptide comprises X2, X3, and X4;
  • the first polypeptide comprises X3 and the second polypeptide comprises XI
  • the first polypeptide comprises XI and X2, and the second polypeptide comprises X3 and X4;
  • the first polypeptide comprises XI and X3
  • the second polypeptide comprises X2 and X4;
  • the first polypeptide comprises XI and X4, and the second polypeptide comprises X2 and X3;
  • the first polypeptide comprises X2 and X3, and the second polypeptide comprises XI and X4;
  • the first polypeptide comprises X2 and X4, and the second polypeptide comprises XI and X3;
  • the first polypeptide comprises X3 and X4, and the second polypeptide comprises XI and X2;
  • the first polypeptide comprises XI, X2, and X3 and the second polypeptide comprises X4;
  • the first polypeptide comprises XI, X2, and X4 and the second polypeptide comprises X3;
  • the first polypeptide comprises XI, X3, and X4 and the second polypeptide comprises X2;
  • the first polypeptide comprises X2, X3, and X4 and the second polypeptide comprises XL
  • the first polypeptide component and the second polypeptide component may be non-covalently associated, and/or the first polypeptide component and the second polypeptide component may be indirectly bound to each other through a receptor.
  • the first polypeptide component further comprises a first targeting domain and/or the second polypeptide component further comprises a second targeting domain; in some embodiments, tire first targeting domain, when present, is a translational fusion with the first polypeptide, and wherein the second targeting domain, when present, is a translational fusion with the second polypeptide.
  • the targeting domains may bind to a cell surface protein.
  • polypeptides comprising 1, 2, or 3, but not all 4 domains XI, X2, X3, and X4, wherein:
  • XI when present, is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%,
  • X3 when present, is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%,
  • X4 when present, is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the full length of peptide (EDEQEEMANAI)ITILQSWIF(S) (SEQ ID NO:6);
  • amino acid residues in parentheses may be present or absent. Numerous
  • polypeptides are provided.
  • the polypeptide comprises:
  • the polypeptide further comprises a targeting domain, including but not limited to the targeting domain being a translational fusion with the polypeptide.
  • the targeting domains may bind to a cell surface protein.
  • the disclosure provides nucleic acids encoding the polypeptide, first polypeptide, or second polypeptide of any embodiment disclosed; expression vectors comprising the nucleic acids operatively linked to a promoter; host cells comprising the nucleic acids and/or expression vectors disclosed herein, and pharmaceutical composition, comprising the conditionally active receptor agonist, polypeptide, nucleic acid, expression vector, or host cell of any embodiment disclosed, and a pharmaceutically acceptable carrier.
  • the disclosure also provides methods for treating cancer, comprising administering to a subject in need thereof the conditionally active receptor agonist of any embodiment disclosed herein, under conditions wherein the first polypeptide component and the second polypeptide component interact at cells of the tumor to treat the cancer.
  • the disclosure provides the conditionally active receptor agonist, polypeptide, nucleic acid, expression vector, host cell, or pharmaceutical composition of any embodiment disclosed for use as a medicament for treating cancer and/or for modulating an immune response in a subject.
  • the disclosure provides methods for agonizing the IL-2 receptor or the IL-4 receptor, comprising administering to a subject the conditionally active receptor agonist of any embodiment disclosed herein, under conditions wherein the first polypeptide component and the second polypeptide component interact at the receptor.
  • FIG. 1A-1C Computational design of de novo cytokine mimetics.
  • FIG. 1A The designed non-split mimetics have four helices; three mimetic IL-2 interactions with hlL- 2Kbg 0 , while the fourth holds the first three in place.
  • Top in the first generation of designs, each of the core elements of IL-2 (helices H1-H4) were independently idealized using fragment-assembly from a clustered ideal fragment database (size: 4 a.a ); bottom ⁇ , in the second generation of designs the core elements were instead built using parametric equations that recapitulate the shape of each disembodied helix, allowing changes in the length of each helix by +/- 8 a.a.
  • FIG. IB Pairs of helices were reconnected using ideal loop fragments (size: 4 a.a. or 7 a. a., for gen-1 and gen-2 respectively, see Methods), representative examples are shown with newly built elements connecting each pair of helices;
  • FIG. 1C The helix hairpins generated in FIG. IB were assembled in all possible combinations to generate fully connected protein backbones.
  • FIG. 1 Characterization of neoIeukin-2/15. Binding experiments (Biolayer Interferometry) show that neoleukin-2/15 can be incubated for 2 hours at 80°C without any noticeable loss of binding, whereas human and murine IL-2 quickly lose activity.
  • FIG. 3A-3C Reengineering of neoleukin-2/15 into a human interleukin-4 (hlL- 4) mimetic (neoIeukin-4).
  • FIG. 3A Neo-2/15 structurally aligned into the structure of IL-4 in complex with IL-4Ra and ⁇ c (from PDB code 3BPL). Fourteen IL-4 residues that contact IL-4Ra and that were grafted into Neo-2/15 are labeled.
  • FIG. 3B Neoleukin-4 (Neo-4), a new protein with sixteen amino acid mutations compared to Neo-2/15.
  • FIG. 3C Biolayer interferometry data showing that Neo-4, like IL-4, binds to IL-4Ra alone, has no affinity for Y c alone, but binds to ⁇ c when IL-4Ra is present in solution.
  • Figure 4A-4D Overall sequence conservation in binding residues for each of the four common helices, combining information from three different de novo-designed IL- 2 mimics. Sequence logos were generated using combined data from binding experiments
  • Neo-2/15 34-55 is SEQ ID NO:05
  • IL-2 82-103 is SEQ ID NO:250
  • IL-15 59-80 is SEQ ID NO:251)
  • H2' (FIG. 4C; Neo-2/15 58-76 is SEQ ID NO:07, IL-2 50-68 is SEQ ID NO:252, IL-15 34-52 is SEQ ID NO:253) and H4 (FIG. 4D; Neo-2/15 80-100 is SEQ ID NO:06, IL-2 111-131 is SEQ ID NO:254, IL-15 93-113 is SEQ ID NO:255).
  • the logos show the combined information for each helix independently.
  • a line graph shows the probability score (higher means more conserved) for each amino acid in the Neo-2/15 sequence.
  • the solid horizontal line highlights positions where the Neo-2/15 amino acid has a probability score >30% (that is, these amino acids contribute mote generally to receptor binding as they are globally enriched in the binding populations across all of the de novo IL-2 mimics tested).
  • the topology of each helix in Neo-2/15 is shown left of each logo.
  • the sequences of the Neo-2/15 helices and those of the corresponding helices (structurally aligned) in human IL-2 and IL-15 are shown below the graphs, highlighting the distinctiveness of the Neo-2/15 helices and binding interfaces.
  • FIG. 5A-5D Experimental optimization of Gl_neo2_40.
  • FIG. 5A-5C Heatmaps for Gl_neo2_40 single-site mutagenesis library showing enrichment at specific positions after consecutive rounds of increasing selection with FIG. 5A) 50 nM, FIG. SB) 2 nM, and FIG. SC) 0.1 nM IL-2RpY c heterodimer. Based on these enrichment data, a combinatorial library was designed with nucleotide diversity 1.5 x 10 6 .
  • FIG. 5A-5C Heatmaps for Gl_neo2_40 single-site mutagenesis library showing enrichment at specific positions after consecutive rounds of increasing selection with FIG. 5A) 50 nM, FIG. SB) 2 nM, and FIG. SC) 0.1 nM IL-2RpY c heterodimer. Based on these enrichment data, a combinatorial library was designed with nucleotide diversity 1.5 x 10 6 .
  • FIG. 6A-6E Experimental optimization of G2_neo2_40_lF_seq27. Heatmaps for G2_neo2_40_lF_seq27 single-site mutagenesis library showing enrichment at specific positions after consecutive rounds of increasing selection with FIG. 6A) 10 nM, FIG. 6B) 1 nM, FIG. 6C) 0.1 nM, and FIG. 6D) 0.1 nM IE-2Kbg V heterodimer. Based on these enrichment data, a combinatorial library was designed with nucleotide diversity 5.3 * 10 6 .
  • FIG. 6E Amino acid residues available in the initial combinatorial library are depicted indicating residues predicted to be advantageous; black indicates residues in the starting sequence represented in the combinatorial library.
  • FIG. 7A-7E Experimental optimization of G2_neo2_40_lF_seq29. Heatmaps for G2_neo2_40_lF_seq29 single-site mutagenesis library showing enrichment at specific positions after consecutive rounds of increasing selection with FIG. 7A) 10 nM, FIG. 7B) 1 nM, FIG. 7C) 0.1 nM, and FIG. 7D) 0.1 nM IE-2Kbg V heterodimer. Based on these enrichment data, a combinatorial library was designed with nucleotide diversity 2.9 c 10 6 .
  • FIG. 8A-8E Experimental optimization of G2_neo2_40_lF_seq36. Heatmaps for G2_neo2_40_lF_seq36 single-site mutagenesis library showing enrichment at specific positions after consecutive rounds of increasing selection with FIG. 8A) 10 nM, FIG. 8B) 1 nM, FIG. 8C) 0.1 nM, and FIG. 8D) 0.1 nM IL-2RpY c heterodimer. Based on these enrichment data, a combinatorial library was designed with nucleotide diversity 2.7 c 10 6 . FIG. 8E) Amino acid residues available in the initial combinatorial library are depicted indicating residues predicted to be advantageous; black indicates residues in the starting sequence represented in the combinatorial library.
  • FIG. 9A-9B Circular Dichroism (CD) thermal denaturation experiments for multiple IL-2/IL-15 de novo designed mimetics, generation- 1.
  • FIG. 9 A Thermal denaturation curves and FIG. 9B) wavelength scans.
  • FIG. 10A-10B Circular Dichroism (CD) thermal denaturation experiments for multiple IL-2/IL-15 de novo designed mimetics, generation- 1 experimentally optimized.
  • FIG. 10A Thermal denaturation curves and FIG. 10B) wavelength scans.
  • FIG. 11A-11D Circular dichroism thermal melts for 1L-2/1L-15 mimetic designs generation-2.
  • FIG. 11A and FIG. 11C Thermal denaturation curves and
  • FIG. 11B and FIG. 11D wavelength scans.
  • Figure 12A-12C Expression, purification, and thermal denaturation
  • FIG. 12A SDS Tris-Tricine gel electrophoresis showing expression and purification over affinity column.
  • FIG. 12B Circular dichroism at 222 nm during thermal melting from 25°C to 95°C, showing robust temperature stability.
  • FIG. 12C Circular dichroism wavelength scans at 25°C, 95°C and then again 25°C, showing that neoleukin-2/15 does not fully melt at 95°C and refolds fully after cooling back to 25°C.
  • FIG. 13A-13B Robustness of neoleukin-2/15 to single-point cysteine mutants on non-binding interface positions.
  • FIG. 13A Schematic showing point mutant positions in neolukin-2/15 that can individually be mutated to cysteine without interfering with expression of the protein or binding to IL-2Rj3yc. Positions were chosen to avoid interference with receptor binding.
  • FIG. 13B Association kinetics of Neolukin-2/15 cysteine mutants with IL-2RJ3y c measured using biolayer interferometry. All of the variants associate with receptor approximately similarly to Neo-2/15.
  • FIG. 14A-14C Expression, purification, and thermal denaturation
  • FIG. 14A SDS Tris-Tricine gel electrophoresis showing expression and purification over affinity column.
  • FIG. 14B Circular dichroism at 222 nm during thermal melting from 25°C to 95°C, showing robust temperature stability.
  • FIG. 14C Circular dichroism wavelength scans at 25°C, 95°C and then again 25°C, showing that neoleukin-4 does not fully melt at 95 C and refolds fully after cooling back to 25°C.
  • FIG. 15A-C Split-Neo-2/15 variants can reconstitute Neoleukin-2/15 activity by binding to the human IL-2 receptor, a. Bio-Layer Interferometry binding assay of Neo- 2/15 split between helices HI + H3-H2’-H4 (Neo2Al and Neo2Bl respectively) to human IL-2 Receptor. Binding data were collected in an Octet RED96 (ForteBio) and processed using ForteBioTM Data Analysis Software version 9.0.0.10.
  • Biotinylated target receptor human yc was immobilized on streptavidin-coated biosensors (SA ForteBio) at 1 pg/ml in binding buffer (10 mM HEPES (pH 7.4), 150 rtiM NaCl, 3 rtiM EDTA, 0.05% surfactant P20, 0.5% non-fat dry milk) for 300 seconds.
  • binding buffer 10 mM HEPES (pH 7.4), 150 rtiM NaCl, 3 rtiM EDTA, 0.05% surfactant P20, 0.5% non-fat dry milk
  • analyte proteins i.e. Neoleukin-2/15, Neo2Al, Neo2Bl, and an equimolar ratio of Neo2Al+Neo2Bl
  • Neoleukin-2/15 i.e. Neoleukin-2/15, Neo2Al, Neo2Bl, and an equimolar ratio of Neo2Al+Neo2Bl
  • Human IT-2Kb was also added in solution at saturating concentration (250nM).
  • Neo-2/15 split into helixes H1-H3-H2’ + H4 (Neo2A3 and Neo2B3 respectively), following the aforementioned experimental protocol.
  • FIG. 16A-C Split-Neo-2/15 variants stimulate cell signaling by STATS phosphorylation in murine CTLL-2 cell lines
  • CTLL-2 cells were starved in cytokine- free media (RPMI, 10% FBS, + 1 mM sodium pyruvate, + 2 mM L-glutamine, 1 % P/S) for 2 hours before the assay.
  • RPMI cytokine- free media
  • Cells were plated in a 96-well plate and re-suspended in RPMI medium containing serial dilutions of protein samples: Neoleukin-2/15 , Neo2Al, Neo2Bl, and Neo2Al+Neo2B 1 at equimolar ratios.
  • Cells were stimulated for 15 min at 37 °C and immediately fixed by addition of formaldehyde to 1.5% and 10 min incubation at room temperature. Cells were permeabilized by resuspension in cold 100% methanol for 30 min at 4 °C. Fixed and permeabilized cells were washed twice with FACS buffer (PBS pH 7.2 containing 0.1% bovine serum albumin) and incubated with AlexaTM Fluor 647-conjugated anti-STAT5 pY694 (BD Biosciences) diluted 1 :50 in FACS buffer for 2 h at room temperature. Cells were then washed twice in FACS buffer and mean fluorescence intensity (MFI) was determined on a Guava easyCyteTM flow cytometer (Millipore).
  • FACS buffer PBS pH 7.2 containing 0.1% bovine serum albumin
  • Dose-response curves were fitted to a logistic model and half-maximal effective concentration (EC50 values) were calculated using GraphPad Prism data analysis software after subtraction of the MFI of unstimulated cells and normalization to the maximum signal intensity b. Bio-Layer
  • Neo-2/15 split into helixes H1-H3 + H2’-H4 (Neo2A3 and Neo2B3 respectively), following the aforementioned experimental protocol c.
  • Bio-Layer Interferometry binding assay of Neo-2/15 split into helixes H1-H3-H2’ + H4 (Neo2A2 and Neo2B2 respectively), following the aforementioned experimental protocol.
  • FIG 17A-B Fusions of split-Neo2/15 variants to targeting domains bind to the IL-2Receptor.
  • a. Neo2A and Neo2B split protein variants fused to anti-EGFR and anti-Her2 DARPin targeting domains
  • b. Bio-Layer Interferometry binding assay of split-Neo-2/15 protein fusions to mouse IL-2 Receptor. Binding data were collected in an Octet RED96 (ForteBio) and processed using ForteBioTM Data Analysis Software version 9.0.0.10.
  • Biotinylated target receptor human yc was immobilized on streptavidin-coated biosensors
  • binding buffer (10 mM HEPES (pH 7.4), 150 mM NaCl, 3 mM EDTA, 0.05% surfactant P20, 0.5% non-fat dry milk) for 300 seconds.
  • binding buffer 10 mM HEPES (pH 7.4), 150 mM NaCl, 3 mM EDTA, 0.05% surfactant P20, 0.5% non-fat dry milk
  • association step the binding kinetics were monitored by dipping the biosensors in wells containing the target protein (association step) and then dipping the sensors back into baseline/buffer (dissociation).
  • association step analyte proteins (i.e.
  • aHer2Neo2Al + Neo2Bl-aEGFR, aHer2Neo2A2 + Neo2B2-aEGFR, aHer2Neo2A3 + Neo2B3-aEGFR) were diluted in equimolar amounts from concentrated stocks into binding buffer to a final concentration of lOOnM.
  • Mouse IE-2Bb was also added in solution at saturating concentration (250nM).
  • Figure 18A-C Targeted reconstitution of split-Neoleukin-2/15 on the surface of K562 cells expressing Her2 and EGFR.
  • a. Neo2A and Neo2B split protein variants fused to anti-EGFR and anti-Her2 DARPin targeting domains
  • b. Engineered K562 tumor cell lines transduced for expression of Her2+/eGFP+, EGFR+/iRFP+ or Her2+/eGFP+ and
  • EGFR+/iRFP+ surface markers c. Functional reconstitution assay of Her2 -targeted Neo2A variants (aHer2Neo2Al, aHer2Neo2A2 and aHer2Neo2A3) and EGFR-targeted Neo2B variants (Neo2Bl-aEGFR, Neo2B2-aEGFR and Neo2B3-aEGFR) to the surface of the four aforementioned K562 cell lines. All cell lines were mixed in equivalent ratio (50,000 of each cell type per well) and transferred to a V-bottom plate at 200.000 cells/well .
  • the cells were incubated for 30 minutes at room temperature with an equimolar ratio of anti-Her2-Neo2, anti-Her2-Neo2A + anti-EGFR-Neo2B variants, to a final concentration of lOnM in FACS buffer (PBS (Gibco), 0.5% BSA).
  • the cells were then washed twice (PBS (Gibco), 0.5% BSA) and subsequently incubated for 5 minutes with the following components: 50 nM of biotinylated soluble human common gamma receptor, 50nM of soluble human IL-2RP and 15nM of strcptavidin-phycoerythrin conjugate (SAFE).
  • Figure 19A-C Both fragments of the split-Neo-2/15 variants are necessary to enable functional reconstitution on the surface of K562 cells expressing Her2 and EGFR.
  • Her2+/eGFP+/EGFR+/iRFP+ All cell lines were mixed in equivalent ratio (50,000 of each cell type per well) and transferred to a V-bottom plate at 200.000 cells/well. The cells were incubated for 30 minutes at room temperature with anti-Her2-Neo2Al, Neo2Bl-antiEGFR or anti-Her2-Neo2Al + Neo2B 1 -antiEGFR to a final concentration of 810nM in FACS buffer (PBS (Gibco), 0.5% BSA).
  • FACS buffer PBS (Gibco), 0.5% BSA
  • the cells were then washed twice (PBS (Gibco), 0.5% BSA) and subsequently incubated for 5 minutes with the following components: 50 nM of biotinylated soluble human common gamma receptor, 50nM of soluble human IL-2R$ and 15nM of streptavidin-phycoerythrin conjugate (SAFE).
  • Cells were washed again and analyzed by flow cytometry in a LSRII instrument.
  • Figure 20A-B Illustration of alternative modes of action of the splitNeo-2 platform for highly-specific activation of immune cell subtypes
  • a Selective targeting of splitNeo-2 to two surface markers to stimulate the expansion of a specific immune cell subtype (e.g. CD8+, CAR T cells or Regulatory' T cells)
  • b Simultaneous tumor and T cell targeting by the split Neoleukin-2/15 system to induce immune cell subset specific proliferation in the environment of target tumor cells.
  • Neoleukin-4 split fragments can reconstitute full activity when combined.
  • Biotinylated target receptor human yc was immobilized on streptavidin-coated biosensors (SA ForteBio) at 1 pg/ml in binding buffer (10 ttiM HEPES (pH 7.4), 150 mM NaCl, 3 mM EDTA, 0.05% surfactant P20, 0.5% non-fat dry milk) for 300 seconds.
  • binding buffer 10 ttiM HEPES (pH 7.4), 150 mM NaCl, 3 mM EDTA, 0.05% surfactant P20, 0.5% non-fat dry milk
  • Neoleukin-4, Neo4Al, Neo4Bl and an equimolar ratio ofNeo4Al+Neo4Bl) were diluted from concentrated stocks into binding buffer to a final concentration of lOOnM, human IL-4Ra was also added in solution at saturating concentration (250nM).
  • amino acid residues are abbreviated as follows: alanine (Ala; A), asparagine (Asn; N), aspartic acid (Asp; D), arginine (Arg; R), cysteine (Cys; C), glutamic acid (Glu; E), glutamine (Gin; Q), glycine (Gly; G), histidine (His; H), isoleucine (He; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Ihr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).
  • the disclosure provides non-naturally occurring conditionally active receptor agonists, comprising a first polypeptide component and a second polypeptide component, wherein the first polypeptide component and the second polypeptide component are not present in a fusion protein, wherein in total the first polypeptide component and the second polypeptide component comprise domains XI, X2, X3, and X4, wherein:
  • XI is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide (PKKKIQ)LHAEHALYDAL(MILNI) (SEQ ID NO: 4);
  • X2 is any helical peptide domain
  • X3 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide (LE)DYAFNFELILEE(IARLFESG) (SEQ ID NO:5); and
  • X4 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%,
  • amino acid residues in parentheses may be present or absent;
  • the first polypeptide component comprises at least one of XI, X2, X3, and X4 but does not comprise each of XI, X2, X3, and X4;
  • the second polypeptide component comprises each of XI, X2, X3, and X4 that is not present in the first polypeptide component;
  • first polypeptide component and the second polypeptide component are not active receptor agonists individually, and wherein the first polypeptide component and the second polypeptide interact to form an active agonist of IL-2 receptor bg V heterodimer (IL-2RPY c ), IL-4 receptor oY cheterodimer (IL-4RaY e ), IL- 13 alpha, or IL-
  • polypeptides that include all of X1-X4 were previously shown to be (a) mimetics of IL-2 and interleukin- 15 (IL-15) that bind to the IL-2 receptor bg V heterodimer (IL-2I3 ⁇ 41Y C ), but have no binding site for IL-2Ra or IL-15Ra, or (b) mimetics of IL-4 that bind to the IL-4 receptor ⁇ xY c heterodimer (IL-4RaY e ) or IL-13 receptor a subunit (IL-13Ra) (natural IL-4 and the IL-4 mimetics described herein cross-react with IL-13 receptor, forming an IL-4Ro/IL13Ra heterodimer).
  • the full length polypeptides were shown to be hyper-stable, bind to human and mouse II ⁇ -2Rbg V or IL-4RoY c with higher affinity than the natural cytokines, and elicit downstream cell signaling independent of IL-2Ra and IL- 15Ro, or independent of IL-13Ra.
  • the full length polypeptides can be used, for example, to treat cancer.
  • conditionally active receptor agonists comprising the recited separate first and second polypeptides that individually are not receptor agonists, but which can interact non-covalently to form an active agonist of IL-2 receptor bg 0 heterodimer (IL-2RbYc), IL-4 receptor aY c heterodimer (IL- 4RaYc), IL-13 alpha, or IL-4Ralpha/IL 13 Ralpha heterodimer.
  • the affinity of this non- covalent interaction between the“split components” i.e.: the first polypeptide and the second polypeptide
  • the affinity of this non- covalent interaction between the“split components” is such that the interaction only occurs in the presence of the appropriate receptor, and also only when both split components are co-localized.
  • conditionally active receptor agonists of the current disclosure can be used for any uses that the polypeptides that include all of X1-X4 can be used for. Furthermore, the conditionally active receptor agonists enable co-localization-dependent reconstitution of the agonist, and thus, conditional-activation of the receptor.
  • protein mimetic refers to a protein that imitates certain aspects of the function of another protein.
  • the two proteins typically have different amino acid sequence and/or different structures.
  • conditionally active mimetics of IL-2 and IL-15 Provided herein, among other things, conditionally active mimetics of IL-2 and IL-15.
  • the aspects of the function of IL-2 and IL-15 that these conditionally active mimetics imitate is the induction of heterodimerization of IL-2RPYc, leading to phosphorylation of STATS. Because IL-2 and IL-15 both signal through heterodimeiization of lL-2RPYc, these conditionally active mimetics imitate this biological function of both IL-2 and IL-15.
  • These conditionally active mimetics may be referred to herein as mimetics of IL-2, of IL-15, or of both IL-2 and IL-15.
  • conditionally active mimetics of IL-4 are capable of imitating certain functions of IL-4.
  • the function of IL-4 that these mimetics imitate is the induction of heterodimerization of IL-4RaY c (and/or
  • first polypeptide component and the second polypeptide interact to form an agonist of the IL-2 receptor bg 0 heterodimer (IL-2RPY C ).
  • tire first polypeptide component and tire second polypeptide interact to form an agonist of the IL-4 receptor aYcheterodimer (IL-4RaY c ), IL-13 alpha, or IL- 4Ralpha/IL13Ralpha heterodimer.
  • Native hIL-2 comprises four helices connected by long irregular loops.
  • the N- terminal helix (HI) interacts with both the beta and gamma subunits, the third helix (H3) interacts with the beta subunit, and the C-terminal helix (H4) with the gamma subunit;
  • the alpha subunit interacting surface is formed by the irregular second helix (H2) and two long loops, one connecting HI to H2 and the other connecting H3 and H4.
  • the polypeptides may comprise L amino acids and glycine, D- amino acids and glycine, or combinations thereof.
  • the idealized proteins can be split into two polypeptides that separately have negligible binding to the relevant receptor but when mixed together can reconstitute receptor activity.
  • the proteins are typically split at sites that won’t interfere with the function of the protein (e.g., linker sections in embodiments with linkers).
  • the split proteins can comprise any combination of the domains.
  • XI, X2, X3, and X4 may be in any order in the first and second polypeptide; in non-limiting embodiments:
  • the first polypeptide comprises X3 and the second polypeptide comprises XI
  • the first polypeptide comprises X4 and the second polypeptide comprises XI, X2, and X3;
  • the first polypeptide comprises XI and X2, and the second polypeptide comprises X3 and X4;
  • the first polypeptide comprises XI and X3
  • the second polypeptide comprises X2 and X4;
  • the first polypeptide comprises XI and X4, and the second polypeptide comprises X2 and X3;
  • the first polypeptide comprises X2 and X3, and the second polypeptide comprises XI and X4;
  • the first polypeptide comprises X2 and X4, and the second polypeptide comprises XI and X3;
  • the first polypeptide comprises X3 and X4, and the second polypeptide comprises XI and X2;
  • the first polypeptide comprises XI, X2, and X3 and the second polypeptide comprises X4;
  • the first polypeptide comprises XI, X2, and X4 and the second polypeptide comprises X3;
  • the first polypeptide comprises XI, X3, and X4 and the second polypeptide comprises X2;
  • the first polypeptide comprises X2, X3, and X4 and the second polypeptide comprises XL
  • the domains may in some embodiments be separated by amino acid linkers of any suitable length or amino acid composition. There is no requirement for linkers; in one embodiment there are no linkers present between any of the domains. In other embodiments, an amino acid linker may be present between 0, 1 , or 2 junctions between domains XI, X2, X3, and X4 in the first polypeptide and/or the second polypeptide.
  • the amino acid linkers may be of any length as deemed appropriate for an intended use
  • a linker is at the N terminus or C terminus and is referred to as a linker despite not linking two domains together.
  • the linker is referred to as a linker as it was present in a non-split protein linking two domains together.
  • XI, X3, and X4 may be any suitable length, meaning each domain may contain any suitable number of additional amino acids other than the peptides of SEQ ID NOS:4, 5, and 6, respectively.
  • the residues in parentheses are optional, and thus may be present or absent. As will be understood by those of skill in the art, this means, for example, that the N-terminal 6 amino acids and the C-terminal 5 amino acid residues of (PKKKIQ)LHAEHALYD AL(MILNI) (SEQ ID NO: 4) are optional.
  • N-terminal amino acid if one N-terminal amino acid is absent, it will be the N-terminal most amino acid (i.e.: the N-terminal P residue in SEQ ID NO:4); (fi) if two N-terminal amino acids are absent, it will be the two N-terminal most amino acids (i.e.: the N-terminal PK dipeptide in SEQ ID NO:4); (iii) if one C-terminal amino acid residue is absent, it will be the C-terminal most amino acid (i.e.: the C-terminal I residue in SEQ ID NO:4); (iv) if two C-terminal amino acid residues are absent, it will be the two C-terminal most amino acids (i.e.: the C-terminal NI dipeptide in SEQ ID NO:4), etc.
  • one or more optional amino acid residues may be absent, and that absent amino acids from the optional residues are
  • XI comprises a peptide with identity to the full length of peptide ((PKKKIQ)LHAEHALYD AL(MILN I) (SEQ ID NO: 4);
  • X3 comprises a peptide with identity to the foil length of peptide (LE)DYAFNFELILEE(LARLFESG) (SEQ ID NO:5);
  • X4 comprises a peptide with identity to the foil length of peptide to the foil length of peptide (EDEQEEMANAI)mLQS ⁇ IF(S) (SEQ ID NO:6), respectively, of at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100%.
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide ((PKKKIQ)LHAEHALYDAL£MILNI) (SEQ ID NO: 4) or (PKKKI)QLHAEHALYDALMILNI (SEQ ID NO:4)
  • X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide
  • X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide to the foil length of peptide (EDEQEEMANAI)ITILQSWIF(S) (SEQ ID NO:6) or (E)DEQEEMANAIITILQSWIFS (SEQ ID NO:6), respectively, of at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100%.
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide (PKKKIOILHAEHAL YD A LfMILND (SEQ ID NO: 4) or
  • X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide
  • X4 is a peptide comprising an amino acid sequence with identity to the foil length of peptide to the full length of peptide
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide (PKKKIQ)LHAEHALYDAL(MILNI) (SEQ ID NO: 4) or
  • X3 is a peptide comprising an amino acid sequence with identity to the foil length of peptide
  • X4 is a peptide comprising an amino acid sequence with identity to the foil length of peptide to the full length of peptide
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide (PKKKiOlLHAEHALYDALfMILND (SEQ ID NO: 4) or
  • X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide
  • X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide to the full length of peptide
  • XI is a peptide comprising an amino acid sequence with 100% identity to the full length of peptide (PKKKI Q)LHA EHALYD AL(MILNI) (SEQ ID NO: 4) or
  • X3 is a peptide comprising an amino acid sequence with 100% identity to the full length of peptide
  • X4 is a peptide comprising an amino acid sequence with 100%identity to the full length of peptide to the full length of peptide (EDEQEEMANAI)ITHJQSWIF(S) (SEQ ID NO:6) or (E)DEQEEMANAimLQSWIFS (SEQ ID NO:6);
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide (PKKKIQ)LHAEHALYDAL£MILNI) (SEQ ID NO: 4) of at least 85%
  • X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide (LE)DYAFNFELILEE(IARLFESG) (SEQ ID NO:5) of at least 85%
  • X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide to the full length of peptide (EDEQEEMANAI)ITTLQSWIF(S) (SEQ ID NO:6) of at least 85%; or
  • XI is a peptide comprising an amino acid sequence with 100% identity to the full length of peptide (PKKKIQ)LHAEHALYDAL£MILNI) (SEQ ID NO: 4)
  • X3 is a peptide comprising an amino acid sequence with 100% identity to the full length of peptide (LE)DYAFNFELILEE(IARLFESG) (SEQ ID NO:5)
  • X4 is a peptide comprising an amino acid sequence with 100%identity to the full length of peptide to the full length of peptide (EDEQEEMANAI)mLQSWIF(S) (SEQ ID NO:6).
  • XI is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide OLHAEHALYDALMILNI (SEQ ID NO:320);
  • X3 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide LEDYAFNFELILEEIARLFES (SEQ ID NO:321); and/or
  • X4 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide DEQEEMANAIITILQSWIF(S) (SEQ ID NO:322).
  • XI is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide PKKKIQLHAEHALYDALMILNI (SEQ ID NO: 4);
  • X3 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide LEDYAFNFELILEEIARLFESG (SEQ ID NO:5); and
  • X4 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide EDEQEEMANAIITIL£S>£IFS (SEQ ID NO:6).
  • XI is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide OLHAEHALYDALMILNI (SEQ ID NO:320);
  • X3 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide LEDYAFNFELILEEIARLFES (SEQ ID NO:321); and X4 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide or DEQEEMANAIITILQS ⁇ IF(S) (SEQ ID NO:322).
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide PKKKIQLHAEHALYDALMILNI (SEQ ID NO: 4)
  • X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide LEDYAFNFEULEEIARLFESG (SEQ ID NO:5) or LEDYAFNFELILEEIARLFES (SEQ ID NO:321)
  • X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide to the full length of peptide EDEQEEMANAHTILOSWIFIS) (SEQ ID NO:6) or DEQEEMANAIITILQSVyF(S) (SEQ ID NO:322), respectively, of at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%,
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide PKKKIQLHAEHALYDALMILNI (SEQ ID NO: 4) or
  • QLHAEHALYDALMILNI (SEQ ID NO:320) of at least 65%;
  • X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide
  • LEDYAFNFEULEEIARLFESG SEQ ID NO:5
  • LEDYAFNFELILEEIARLFES SEQ ID NO:321
  • X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide EDEQEEMANAIITILQSWIF(S) (SEQ ID NO:6) or DEQEEMANAimLQSWIF(S) (SEQ ID NO:322), of at least 65%;
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide PKKKIQLHAEHALYDALMILNI (SEQ ID NO: 4) or
  • QLHAEHALYDALMILNI (SEQ ID NO:320) of at least 75%;
  • X3 is a peptide comprising an amino acid sequence with identity to the foil length of peptide
  • LEDYAFNFEULEEIARLFESG SEQ ID NO:5
  • LEDYAFNFELILEEIARLFES SEQ ID NO:321
  • X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide EDEQEEMANAimLQS ⁇ IF(S) (SEQ ID NO:6) or DEQEEMANAIITILQSWIF(S) (SEQ ID NO:322), of at least 75%;
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide PKKKIQLHAEHALYDALMILNI (SEQ ID NO: 4) or
  • QLHAEHALYDALMILNI (SEQ ID NO:320) of at least 80%;
  • X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide
  • LEDYAFNFEULEEIARLFESG SEQ ID NO:5 or LEDYAFNFELILEEIARLFES (SEQ ID NO:321) of at least 80%
  • X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide EDEQEEMANAIITILQS ⁇ IF(S) (SEQ ID NO:6) or DEQEEMANAimLQSWIF(S) (SEQ ID NO:322), of at least 80%;
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide PKKKIOLHAEHALYDALMILNI (SEQ ID NO: 4) or
  • OLHAEHALYDALMILNI (SEQ ID NO:320) of at least 90%;
  • X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide
  • LEDYAFNFEULEEIARLFESG SEQ ID NO:5
  • LEDYAFNFELILEEIARLFES SEQ ID NO:321
  • X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide EDEQEEMANAIITILQS ⁇ £IF(S) (SEQ ID NO:6) or DEQEEMANAirnL£SWIF(S) (SEQ ID NO:322), of at least 90%;
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide PKKKIOLHAEHALYDALMILNI (SEQ ID NO: 4) or
  • OLHAEHALYDALMILNI (SEQ ID NO:320) of 100%;
  • X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide
  • LEDYAFNFEULEEIARLFESG SEQ ID NO:5
  • LEDYAFNFELILEEIARLFES SEQ ID NO:321
  • X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide EDEQEEMANAIITILQSJPF(S) (SEQ ID NO:6) or
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide PKKKIOLHAEHALYDALMILNI (SEQ ID NO: 4) of at least 80%; X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide LEDYAFNFEULEEIARLFESG (SEQ ID NO:5) of at least 80%; and X4 is a peptide comprising an amino acid sequence with identity to the foil length of peptide
  • EDEQEEMANAIITILQSWIF(S) (SEQ ID NO:6) of at least 80%;
  • XI is a peptide comprising an amino acid sequence with identity to the foil length of peptide PKKKIOLHAEHALYDALMILNI (SEQ ID NO: 4) of at least 90%;
  • X3 is a peptide comprising an amino acid sequence with identity to the foil length of peptide
  • LEDYAFNFEULEEIARLFESG (SEQ ID NO:5) of at least 90%; and X4 is a peptide comprising an amino acid sequence with identity to the foil length of peptide
  • EDEQEEMANAIITILQSWIF(S) (SEQ ID NO:6), of at least 90%;
  • XI is a peptide comprising an amino acid sequence with identity to the foil length of peptide PKKKIOLHAEHALYDALMILNI (SEQ ID NO: 4) of 100%; X3 is a peptide comprising an amino acid sequence with identity to the foil length of peptide LEDYAFNFEULEEIARLFESG (SEQ ID NO:5) of 100%; and X4 is a peptide comprising an amino acid sequence with identity to the foil length of peptide
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide OLHAEHALYDALMILNI (SEQ ID NO:320) of at least 80%
  • X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide LEDYAFNFELILEEIARLFES (SEQ ID NO:321) of at least 80%
  • X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide OLHAEHALYDALMILNI (SEQ ID NO:320) of at least 90%; X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide LEDYAFNFELILEEIARLFES (SEQ ID NO:321) of at least 90%; and X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide
  • XI is a peptide comprising an amino acid sequence with identity to the full length of peptide OLHAEHALYDALMILNI (SEQ ID NO:320) of 100%; X3 is a peptide comprising an amino acid sequence with identity to the full length of peptide
  • LEDYAFNFELILEEIARLFES (SEQ ID NO:321) of 100%; and X4 is a peptide comprising an amino acid sequence with identity to the full length of peptide
  • conditionally active receptor agonists are conditionally active receptor agonists IL-2/15 mimetics and
  • XI includes 1, 2, 3, 4, or all 5 of the following: L at residue 7, H at residue 8, H at residue 11, Y at residue 14; M at residue 18 wherein the numbering is relative to SEQ ID NO:4 based on the optional residues being present; and/or
  • X3 includes 1, 2, 3, 4, 5, 6, 7, or all 8 of the following: D at residue 3, Y at residue 4, F at residue 6, N at residue 7, L at residue 10, 1 at residue 11, E at residue 13, or E at residue 14 wherein the numbering is relative to SEQ ID NO:5 based on the optional residues being present.
  • X4 includes I at residue 19 wherein the numbering is relative to SEQ ID NO:6 based on the optional residues being present.
  • AA substitutions in X2 relative to the AA sequence of SEQ ID NO:7 do not occur at AA residues marked in bold font.
  • amino acid substitutions relative to the reference peptide domains do not occur at AA residues marked in bold font.
  • SEQ ID NOS:4, 5, and 6 each include residues in bold font that are involved in binding to the receptor:
  • amino acid residue W13 is invariant when X2 comprises is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the foil length of peptide KDEAEKAKRMKEWMKRIKfT) (SEQ ID NO:7) , wherein residues in parentheses are optional. In one embodiment, the optional residue is present; in another embodiment the optional residue is absent.
  • amino acid substitutions relative to the reference peptide domains do not occur at more than 3, 2, or 1 AA residues marked in bold font.
  • conditionally active receptor agonists are conditionally active receptor agonists IL-4/IL-13 mimetics.
  • XI is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical along its length to the peptide PKKKIQIMAEEALKDALSILNI (SEQ ID NO: 8);
  • X3 is a peptide comprising the amino acid sequence at least 37% 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical along its length the peptide LERFAKRFERNLWGIARLFESG (SEQ ID NO: 9); and
  • X4 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical along its length to the peptide EDEOEEMANAIITILOSWFFS (SEQ ID NO: 10).
  • XI includes I at residue 7, T or M at residue 8, E at residue 11, K at residue 14 and S at residue 18;
  • X3 includes R at residue 3, F at residue 4, K at residue 6, R at residue 7, R at residue 10, N at residue 11, W at residue 13, and G at residue 14.
  • X4 includes F at residue 19.
  • XI is a peptide comprising the amino acid sequence having identity to the full length of PKKKIQ1MAEEALKDALSILNI (SEQ ID NO:8)
  • X3 is a peptide comprising the amino acid sequence having identity to the full length of
  • LERFAKRFERNLWGIARLFESG (SEQ ID NO: 9)
  • X4 is a peptide comprising the amino acid sequence having identity to the full length of EDEOEEMANAIITILOSWFFS (SEQ ID NO: 10) that are each at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100%.
  • XI is a peptide comprising the amino acid sequence at least 65% identical along its length to the peptide PKKKIQIMAEEALKDALSILNI (SEQ ID NO:8); X3 is a peptide comprising the amino acid sequence at least 65% identical along its length the peptide LERFAKRFERNLWGIARLFESG (SEQ ID NO:9); and X4 is a peptide comprising the amino acid sequence at least 65% identical along its length to the peptide
  • XI is a peptide comprising the amino acid sequence at least 75% identical along its length to the peptide PKKKIQIMAEEALKDALSILNI (SEQ ID NO:8); X3 is a peptide comprising the amino acid sequence at least 75% identical along its length the peptide LERFAKRFERNLWG1ARLFESG (SEQ ID NO:9); and X4 is a peptide comprising the amino acid sequence at least 75% identical along its length to the peptide
  • XI is a peptide comprising the amino acid sequence at least 80% identical along its length to the peptide PKKKIQIMAEEALKDALSILNI (SEQ ID NO:8); X3 is a peptide comprising the amino acid sequence at least 80% identical along its length the peptide LERFAKRFERNLWGIARLFESG (SEQ ID NO:9); and X4 is a peptide comprising the amino acid sequence at least 80% identical along its length to the peptide
  • XI is a peptide comprising the amino acid sequence at least 90% identical along its length to the peptide PKKKIQIMAEEALKDALSILNI (SEQ ID NO:8); X3 is a peptide comprising the amino acid sequence at least 90% identical along its length the peptide LERFAKRFERNLWGIARLFESG (SEQ ID NO:9); and X4 is a peptide comprising the amino acid sequence at least 90% identical along its length to the peptide
  • XI includes I at residue 7, T or M at residue 8, E at residue 11, K at residue 14 and S at residue 18; and (B) X3 includes R at residue 3, F at residue 4, K at residue 6, R at residue 7, R at residue 10, N at residue 11, W at residue 13, and G at residue 14.
  • amino acid substitutions relative to the reference peptide domains do not occur at AA residues marked in bold font.
  • SEQ ID NOS:8, 9, and 10 each include residues in bold font:
  • PKKKIQIMAEEALKDALSILNI amino acid residues E10, El 1, A12, L13, K14, D15, A16, and L17 are invariant in this embodiment
  • LERFAKRFERNLWGIARLFESG amino acid residues F4, A5, K6, R7, F8, E9, R10, and N11 are invariant in this embodiment
  • EDEOEEMANAHTILOSWFFS amino acid residues II 1, 112, T13, 114, L15, Q16, S17, W18, F19, and F20 are invariant in this embodiment
  • amino acid residue W13 is invariant when X2 is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the fell length of peptide KDEAEKAKRMKE ⁇ £MKRIK(T) (SEQ HD NO:7).
  • amino acid substitutions relative to the reference peptide domains are conservative amino acid substitutions.
  • conservative amino acid substitution means a given amino acid can be replaced by a residue having similar physiochemical characteristics, e.g., substituting one aliphatic residue for another (such as lie, Val, Leu, or Ala for one another), or substitution of one polar residue for another (such as between Lys and Arg; Glu and Asp; or Gin and Asn). Other such conservative substitutions, e.g., substitutions of entire regions having similar hydrophobicity characteristics, are known. Polypeptides comprising conservative amino acid substitutions can be tested in any one of the assays described herein to confirm that a desired activity, e.g. antigen-binding activity and specificity of a native or reference polypeptide is retained. Amino acids can be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, in
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • Particular conservative substitutions include, for example; Ala into Gly or into Ser; Arg into Lys; Asn into Gin or into H is; Asp into Glu; Cys into Ser; Gin into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gin; He into Leu or into Val; Leu into He or into Val; Lys into Arg, into Gin or into Glu; Met into Leu, into Tyr or into He; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr; Tyr into Trp; and/or Phe into Val, into He or into Leu.
  • amino acid residues in XI relative to SEQ ID NO:4 are selected from the group consisting of:
  • conditionally active receptor agonists are conditionally active IL-4 mimetics, and position 7 is I, position 8 is M or T, position 11 is E, position 14 is K, and position 18 is S.
  • conditionally active receptor agonists are conditionally active IL-2 mimetics, and 1, 2, 3, 4, or 5 of the following are not true: position 7 is I, position 8 is M or T, position 11 is E, position 14 is K, and position 18 is S.
  • ammo acid residues in X3 relative to SEQ ID NO:5 are selected from the group consisting of:
  • conditionally active receptor agonists are conditionally active IL-4/IL-13 mimetics and position 3 is R, position 4 is F, position 6 is K, position 7 is R, position 10 is R, position 11 is N, position 13 is W, and position 14 is G.
  • conditionally active receptor agonists are conditionally active IL-2 mimetics and 1, 2, 3, 4, 5, 6, 7, or all 8 of the following are not true: position 3 is R, position 4 is F, position 6 is K, position 7 is R, position 10 is R, position 11 is N, position 13 is W, and position 14 is G.
  • conditionally active receptor agonists further allows for a cysteine at position 17 relative to SEQ ID NO:5 in addition to the amino acid residues of H, K, L, N and R, or at position 20 relative to SEQ ID NO:5 in addition to the amino acid residues of A, C, E, F, G, M, S, and Y.
  • amino acid residues in X3 relative to SEQ ID NO:5 can be selected from the group consisting of:
  • amino acid residues in X4 relative to SEQ ID NO:6 are N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N
  • conditionally active receptor agonists are conditionally active IL-4/IL-13 mimetics and position 19 is I. In another embodiment, the conditionally active receptor agonists are conditionally active IL-2 mimetics and position 19 is not I.
  • conditionally active receptor agonists further allows for a cysteine at position 3 relative to SEQ ID NO:6 in addition to the amino acid residues of E, G, H and K.
  • amino acid residues in X4 relative to SEQ ID NO:6 can be selected from the group consisting of:
  • domain X2 is a structural domain, and thus any amino acid sequence that connects (i.e.: in the same polypeptide or upon non-covalent interaction of the first and second polypeptide) the relevant other domains and allows them to fold can be used.
  • the length required will depend on the specifics of the first polypeptide and the second polypeptide being used and can be 8 amino acids or longer.
  • X2 is a peptide comprising the amino acid sequence at least 20%, 27%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%,
  • amino acid changes relative to the amino acid sequence of SEQ ID NO:7 are conservative amino acid substitutions.
  • the W13 amino acid residue is invariant.
  • amino acid residues in X2 relative to SEQ ID NO:7 are selected from the group consisting of:
  • polypeptides are IL-4/IL-13 mimetics and position 11 is I. In another embodiment, the polypeptides are IL-2 mimetics and position 11 is not I.
  • polypeptide further allows for a cysteine at positions 5 or 16 relative to SEQ ID NO:7.
  • polypeptide further allows for a cysteine at positions 1, 2, 5, 9 or 16 relative to SEQ ID NO:7
  • amino acid residues in X2 relative to SEQ ID NO:7 can be selected
  • X2 is a peptide comprising the amino acid sequence at least 70% identical along its length to KDEAEKAKRMKEWMKRIK(T) (SEQ ID NO:7);
  • ( ⁇ ) X2 is a peptide comprising the amino acid sequence at least 80% identical along its length to KDEAEKAKRMKEWMKRIK(T) (SEQ ID NO:7);
  • X2 is a peptide comprising the amino acid sequence at least 90% identical along its length to KDEAEKAKRMKEWMKRIK(T) (SEQ ID NO:7);
  • X2 is a peptide comprising the amino acid sequence having identity to the full length of peptide KDEAEKAKRMKEWMKRIK(T) (SEQ ID NO:7) of at least 65%;
  • XI is a peptide comprising the amino acid sequence having identity to the full length of peptide PKKKIOLHAEHALYDALMILNI (SEQ ID NO: 4) or OLHAEHALYDALMILNI (SEQ ID NO:320) of at least 65%;
  • X3 is a peptide comprising the amino acid sequence having identity to the full length of peptide LEDYAFNFELILEEIARLFESG (SEQ ID NO:5) or LEDYAFNFELILEEIARLFES (SEQ ID NO:321) of at least 65%; and
  • X4 is a peptide comprising the amino acid sequence having identity to the full length of peptide
  • X2 is a peptide comprising the amino acid sequence having identity to the full length of peptide KDEAEKAKRMKEWMKRIK(T) (SEQ ID NO:7) of at least 75%
  • XI is a peptide comprising the amino acid sequence having identity to the full length of peptide PKKKIOLHAEHALYDALMILNI (SEQ ID NO: 4) or OLHAEHALYDALMILNI (SEQ ID NO:320) of at least 75%
  • X3 is a peptide comprising the amino acid sequence having identity to the full length of peptide LEDYAFNFELILEEIARLFESG (SEQ ID NO:5) or LEDYAFNFELILEEIARLFES (SEQ ID NO:321) of at least 75%
  • X4 is a peptide comprising the amino acid sequence having identity to the full length of peptide
  • EDEQEEMANAIITILQSWIF(S) SEQ ID NO:6
  • DEQEEMANAIITILQSWIFS SEQ ID NO:322
  • X2 is a peptide comprising the amino acid sequence having identity to the full length of peptide KDEAEKAKRMKEWMKRIK(T) (SEQ ID NO:7) of at least 80%;
  • XI is a peptide comprising the amino acid sequence having identity to the full length of peptide PKKKIOLHAEHALYDALMILNI (SEQ ID NO: 4) or OLHAEHALYDALMILNI (SEQ ID NO:320) of at least 80%;
  • X3 is a peptide comprising the amino acid sequence having identity to the full length of peptide LEDYAFNFELILEEIARLFESG (SEQ ID NO:5) or LEDYAFNFELILEEIARLFES (SEQ ID NO:321) of at least 80%; and
  • X4 is a peptide comprising the amino acid sequence having identity to the full length of peptide EDEQEEMANAIITILQSWIF(S) (SEQ ID NO:6) or DEQEEMANAIITILQ
  • X2 is a peptide comprising the amino acid sequence having identity to the full length of peptide KDEAEKAKRMKEWMKRIK(T) (SEQ ID NO:7) of at least 90%;
  • XI is a peptide comprising the amino acid sequence having identity to the full length of peptide
  • X3 is a peptide comprising the amino acid sequence having identity to the full length of peptide LEDYAFNFELILEE1ARLFESG (SEQ ID NO:5) or LEDYAFNFELILEEIARLFES (SEQ ID NO:321) of at least 90%; and X4 is a peptide comprising the amino acid sequence having identity to the full length of peptide
  • EDEQEEMANAIITILQSWIF(S) SEQ ID NO:6
  • DEQEEMANAIITILQSWIFS SEQ ID NO:322
  • X2 is a peptide comprising the amino acid sequence having 100% identity to the full length of peptide KDEAEKAKRMKE ⁇ £MKRIK(T) (SEQ ID NO:7);
  • XI is a peptide comprising the amino acid sequence having 100% identity to the full length of peptide
  • PKKKIOLHAEHALYDALMILNI SEQ ID NO: 4
  • OLHAEHALYDALMILNI SEQ ID NO:320
  • X3 is a peptide comprising the amino acid sequence having 100% identity to the full length of peptide LEDYAFNFELILEEIARLFESG (SEQ ID NO:5) or
  • LEDYAFNFELILEEIARLFES (SEQ ID NO:321); and X4 is a peptide comprising the amino acid sequence having 100% identity to the full length of peptide
  • the listed optional amino acid residues in SEQ ID NO:7 are present.
  • the peptides for XI , X3, and X4 are shown in SEQ ID Nos. 4, 5, and 6.
  • the peptides for XI, X3, and X4 are shown in SEQ ID Nos. 320, 321, and 322.
  • the first polypeptide component includes one of XI, X2, X3, and X4, and the second polypeptide component includes the three of XI, X2, X3, and X4 that are not present in the first polypeptide component; or
  • the first polypeptide component includes two of XI, X2, X3, and X4, and the second polypeptide component includes the two of XI, X2, X3, and X4 that are not present in the first polypeptide component.
  • the first polypeptide component includes two of XI, X2, X3, and X4
  • the second polypeptide component includes the two of XI, X2, X3, and X4 that are not present in the first polypeptide component.
  • the first polypeptide comprises XI and excludes X2, X3, and X4; and the second polypeptide is a fusion protein comprising X3-Z1-X2-Z2-X4 and excluding XI;
  • the first polypeptide comprises X4 and excludes XI, X2, and X3; and the second polypeptide is a fusion protein comprising X1-Z1-X3-Z2-X2 and excluding X4; or
  • the first polypeptide is a fusion protein comprising X1-Z1-X3 and excluding X2 and X4; and the second polypeptide is a fusion protein comprising X2-Z1-X4 and excluding XI and X3;
  • each of Z1 and Z2 independently are an optional amino acid linker.
  • Z1 and/or Z2 may comprise any number of amino acid residues to separate domains within the first and/or second polypeptide as deemed appropriate for an intended use.
  • the 1 and/or Z2 linker may be of any suitable length and amino acid composition.
  • Z1 and Z2 are both absent; in another embodiment, 1 and 2 are both present; in a further embodiment, one of Z1 sand Z2 is present and the other is absent.
  • XI, X2, X3, and X4 respectively comprise a peptide at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical, respectively, to the full length of XI, X2, X3, and X4 domains shown below (SEQ ID NOS: 4-7), where residues in parentheses may be present or absent:
  • XI, X2, X3, and X4 are peptides comprising amino acid sequences at least 80% identical, respectively, to the full length of XI, X2, X3, and X4 domains shown below (SEQ ID NOS: 4-7), where residues in parentheses may be present or absent:
  • XI, X2, X3, and X4 are peptides comprising amino acid sequences at least 90% identical, respectively, to the full length of XI, X2, X3, and X4 domains shown below (SEQ ID NOS: 4-7), where residues in parentheses may be present or absent:
  • XI, X2, X3, and X4 respectively are 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical, respectively, to the foil length of XI, X2, X3, and X4 domains shown below, where residues in parentheses may be present or absent:
  • XI, X2, X3, and X4 respectively are peptides comprising amino acid sequences at least 80% identical, respectively, to the full length of XI, X2, X3, and X4 domains shown below, where residues in parentheses may be present or absent:
  • XI, X2, X3, and X4 respectively are peptides comprising amino acid sequences at least 90% identical, respectively, to the full length of XI, X2, X3, and X4 domains shown below, where residues in parentheses may be present or absent:
  • X4 DEQEEMANAIITILgSWIFS (SEQ ID NO:322) .
  • one or more or all of the optional amino acids are present; in another embodiment, one or more or all of the optional amino acids are absent. In other embodiments:
  • XI is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:4 or SEQ ID NO:320 of at least 55%;
  • X2 is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:7 of at least 55%
  • X3 is a peptide comprising the amino acid sequence having identity' to the full length of the amino acid sequence of SEQ ID NO:5 or SEQ P) NO:321 of at least 55%
  • X4 is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:6 or SEQ ID NO:322 ofat least 55%;
  • XI is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:4 or SEQ ID NO:320 of at least 75%
  • X2 is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:7 of at least 75%
  • X3 is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:5 or SEQ ID NO:321 of at least 75%
  • X4 is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:6 or SEQ ID NO:322 ofat least 75%
  • SEQ ID NO:6 is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:6 or SEQ ID NO:322 ofat least 75%
  • XI is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:4 or SEQ ID NO:320 of at least 80%;
  • X2 is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:7 of at least 80%,
  • X3 is a peptide comprising the ammo acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:5 or SEQ ID NO:321 of at least 80%;
  • X4 is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:6 or SEQ ID NO:322 of at least 80%;
  • XI is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:4 or SEQ ID NO:320 of at least 90%
  • X2 is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:7 of at least 90%
  • X3 is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:5 or SEQ ID NO:321 of at least 90%
  • X4 is a peptide comprising the amino acid sequence having identity to the full length of the amino acid sequence of SEQ ID NO:6 or SEQ ID NO:322 of at least 90%; or
  • XI is a peptide comprising the amino acid sequence having 100% identity to the full length of the amino acid sequence of SEQ ID NO:4 or SEQ ID NO:320;
  • X2 is a peptide comprising the amino acid sequence having 100% identity to the full length of the amino acid sequence of SEQ ID NO:7;
  • X3 is a peptide comprising the amino acid sequence having 100% identity to the full length of the amino acid sequence of SEQ ID NO:5 or SEQ ID NO:321; and
  • X4 is a peptide comprising the amino acid sequence having 100% identity to the full length of the amino acid sequence of SEQ ID NO:6 or SEQ ID NO:322.
  • the peptides for XI, X3, and X4 are shown in SEQ P) NOs. 4, 5, and 6.
  • the peptides for XI, X3, and X4 are shown in SEQ ID NOs. 320, 321, and 322.
  • the first polypeptide and the second polypeptide are at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%,
  • Second polypeptide X3-X2' -X4 (Neo2B)
  • Second polypeptide X-1 TTASEPEQEEMANAIITILQSWIFS (SEQ ID NO: 259);
  • Second polypeptide X3-X2' -X4 ⁇ Nec2B
  • Second polypeptide X4 XXXXXDEQEEMANAI ITILQSWIFS (SEQ ID NO: 266) ; (vii)
  • PKKKIQIMAEEALKDALSILNIVKTNSPPAEEQLERFAKRFERNLWGIARLFESGD SEQ ID NO: 312
  • Second polypeptide >Neo4_H2-H4 DQKDEAEKAKRMIEWMKRIKTTASEDEQEEMANAIITILQSWFFS (SEQ ID NO: 313)
  • PKKKIQIMAEEALKDALSILNIVKTNSPPAEEQLERFAKRFERNLWGIARLFESGDQKDEAEKAKRMI EWMKRIKTTA SEQ ID NO: 316
  • PKKKIQLHAEHALYDALMILNIVGGSS (SEQ ID NO: 323), or
  • PKLEDYAFNFELILEEIARLFESGDQKDEAEKAKRMKEWMKRIKTTASEDEQEEMANAIITILQSWI FS (SEQ ID NO: 326) ;
  • ILQSWIFS (SEQ ID NO:328).
  • the first polypeptide and the second polypeptide are peptides comprising an amino acid sequence at least 80% identical to a pair of first and second polypeptides shown in embodiments (i) - (viii) above (underlined residues or“X” residues’' are optional and each residue of the optional domain, when present, may comprise any amino acid).
  • the first polypeptide and the second polypeptide are peptides comprising an amino acid sequence at least 90% identical to a pair of first and second polypeptides shown in embodiments (i) - (viii) above (underlined residues or“X” residues” are optional and each residue of the optional domain, when present, may comprise any amino acid).
  • the first polypeptide and the second polypeptide are peptides comprising an amino acid sequence 100% identical to a pair of first and second polypeptides shown in embodiments (i) - (viii) above (underlined residues or“X” residues” are optional and each residue of the optional domain, when present, may comprise any amino acid).
  • XI, X2, X3, and X4, respectively comprise a peptide at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%,
  • XI, X2, X3, and X4 domains as defined in Table 1 (though listed as HI, H2, H3, and H4 domains) present within the amino acid sequence of SEQ ID NO: 11-94, 190-216, 247, and SEQ ID NOS:275-300.
  • Table 1 provides two SEQ ID NOs for many of the variants: a first SEQ ID NO: that lists the linker positions as optional and variable (shown by underlining in the table), and a second SEQ ID NO: that includes the linker positions as required.
  • Table 1 shows the domain arrangement for the polypeptide of SEQ ID NOS: 11-94, 190-216, 247, and SEQ ID NOS: 275-300(see the second column), while the sequence shows underlined amino acid linkers separating domains. See, for example, SEQ ID NO: 11, having the domain arrangement Hl- >H4->H2’->H3 (corresponding to an X1-X4-X2-X3 arrangement):
  • the XI domain is STKKWQLQAEHALLDWQMALNK (SEQ ID NO:271)
  • the X4 domain is ENLNRAITAAQSWIS (SEQ ID NO:272)
  • the X2 domain is
  • RDLISNAQVILLEAR (SEQ ID NO:274).
  • amino acid sequence of each XI, X2, X3, and X4 domains SEQ ID NOS: 11-94, 190-216, 247, and SEQ ID NOS: 275-300 will be clear to those of skill in the art based on the teachings herein.
  • the XI, X2, X3, and/or X4 amino acids may include additional (1, 2, 3, 4, 5, or more) amino acids at the N-terminus and/or the C-terminus relative to the XI, X2, X3, and X4 domains shown in SEQ ID NOS: 11-94, 190-216, 247, and SEQ ID NOS: 275-
  • XI, X2, X3, and X4, respectively are 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to, respectively, XI, X2, X3, and X4 domains (as defined in Table 1 (though listed as HI, H2, H3, and H4 domains) present within the amino acid sequence of SEQ ID NO:90 version 1 or 2, which have the same primary amino acid sequence but which differ slightly in optional/variable linker residues.
  • this embodiment may include variants of XI, X2, X3, and/or X4 domains present in SEQ ID NO:90 version 1 or 2 that incorporate the mutations relative to the SEQ ID NO:90 primary amino acid sequence shown in SEQ ID NOS:275-300.
  • XI, X2, X3, and X4 are alpha-helical domains.
  • the amino acid length of each of XI, X2, X3 and X4 is independently at least about 8, 10, 12, 14, 16, 19, or more amino acids in length.
  • the amino acid length of each of XI, X2, X3 and X4 is independently no more than 1000, 500, 400, 300, 200, 100, or 50 amino acids in length.
  • X3 and X4 is independently between about 8-1000, 8-500, 8-400, 8-300, 8-200, 8-100, 8-50, 10-1000, 10-500, 10-400, 10-300, 10-200, 10-100, 10-50, 12-1000, 12-500, 12-400, 12-300, 12-200, 12-100, 12-50, 14-1000, 14-500, 14-400, 14-300, 14-200, 14-100, 14-50, 16-1000, 16-500, 16-400, 16-300, 16-200, 16-100, 16-50, 19-1000, 19-500, 19-400, 19-300, 19-200,
  • the first polypeptide component and/or the second polypeptide component includes at least one disulfide bond.
  • first polypeptide component and the second polypeptide component are non-covalently associated.
  • the first polypeptide component and the second polypeptide component are not active receptor agonists individually, and wherein the first polypeptide component and the second polypeptide interact to form an active agonist of 1L-2 receptor bg 6 heterodimer (IL-2RpY c ), IL-4 receptor aY c heterodimer (IL-4RaYe), IL-13 alpha, or IL-4Ralpha/IL13Ralpha heterodimer.
  • the first polypeptide and the second polypeptide may interact to form an active agonist. This interaction may be any suitable interaction, such as a non-covalent interaction.
  • the interaction may comprise direct non-covalent binding of the first and second polypeptides, or an indirect interaction
  • the first polypeptide component and the second polypeptide component are indirectly bound to each other through a receptor, such as an IL-2 receptor bg e heterodimer (1E-2Kbg e ), an IL-4 receptor aYcheterodimer (IL-4RaY c ), IL-13 alpha, or an IL-4Ralpha/IL 13Ralpha heterodimer.
  • first polypeptide component and the second polypeptide when they interact at their intended receptor, they co-localize to bind to that receptor with a binding affinity of 1000 nm or less, 200 nm or less, 100 nm or less, 50 nM or less, or 25 nM or less.
  • a split IL-2 mimetic of the present invention will co-localize to bind to the IL-2 receptor bg V heterodimer (IL-2Rbg c ) with a binding affinity of 1000 nm or less, 200 nm or less, 100 nm or less, 50 nM or less, or 25 nM or less.
  • a split IL-4 mimetic of the present invention will colocalize to bind to the IL-4 receptor aYcheterodimer (IL-4RaY e ) with a binding affinity of 1000 nm or less, 200 nm or less, 100 nm or less, 50 nM or less, or 25 nM or less.
  • agonism of the receptor to which the split mimetics co-localize and bind is measured by STATS phosphorylation.
  • polypeptides comprising 1, 2, or 3, but not all 4 domains XI, X2, X3, and X4, wherein:
  • XI when present, is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the full length of peptide (PKKKIOlLHAEHALYDALiMILND: (SEQ ID NO: 4);
  • X3 when present, is a peptide comprising the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to the full length of peptide (LE)DYAFNFELILEE(IARLFESG) (SEQ ID NO:5); and (d) X4, when present, is a peptide comprising the amino acid sequence at least
  • amino acid residues in parentheses may be present or absent.
  • polypeptides of this aspect can be used, for example, to generate the
  • conditionally active receptor agonists of any embodiment or combination of embodiments disclosed herein i.e.: the polypeptides of this aspect are either the first polypeptide or the second polypeptide of the conditionally active receptor agonists of the disclosure.
  • the polypeptides of this aspect are either the first polypeptide or the second polypeptide of the conditionally active receptor agonists of the disclosure.
  • amino acid (AA) substitutions in XI relative to the AA sequence of SEQ ID NO:4 occur at no more than 3 AA residues marked in bold font, or occur at no more than 2
  • AA substitutions in X2 relative to the AA sequence of SEQ ID NO:7 do not occur at AA residues marked in bold font.
  • polypeptide may be selected from the group consisting of:
  • the polypeptide comprise the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to, a first polypeptide or a second polypeptide listed below (underlined residues are optional and each optional residue, when present, may comprise any amino acid):
  • Second polypeptide X3--X2' -X4 (Neo2B)
  • EWMKRIKTTAS SEQ ID NO: 25S
  • Second polypeptide X4 TTASEDEQEEMANAIITTLQSWIFS (SEQ ID NO: 259);
  • Second polypeptide X3-X2' -X4 (Neo2B)
  • Second polypeptide X4 XXXXXDEQEEMANAIITILQ3WIFS (SEQ ID NO: 266);
  • PKKKIQIMAEEALKDALSILNIVKTNSPPAEEQLERFAKRFERNLWGIARLFESGD SEQ ID NO: 312
  • Second polypeptide >Neo4_H2-H4 DQKDEAEKAKRMIEWMKRIKTTASEDEQEEMANAIITILQSWFFS (SEQ ID NO: 313)
  • PKKKIQIMAEEALKDALSILNIVKTNSPPAEEQLERFAKRFERNLWGIARLFESGDQKDEAEKAKRMI EWMKRIKTTA SEQ ID NO: 316
  • PKKKIQLHAEHALYDALMILNIVGGSS (SEQ ID NO: 323) , or
  • the polypeptide comprises an amino acid sequence at least 80% identical to a first or second polypeptides shown in embodiments (i) - (viii) above (underlined residues or“X” residues” are optional and each residue of the optional domain, when present, may comprise any amino acid).
  • the polypeptide comprises an amino acid sequence at least 90% identical to a first or second polypeptides shown in embodiments (i) - (viii) above (underlined residues or“X” residues” are optional and each residue of the optional domain, when present, may comprise any amino acid).
  • the polypeptide comprises an amino acid sequence at least 100% identical to a first or second polypeptides shown in embodiments (i) - (viii) above (underlined residues or“X” residues” are optional and each residue of the optional domain, when present, may comprise any amino acid).
  • XI, X2, X3, and X4 when present, comprise the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to, respectively, XI, X2, X3, and X4 domains (as defined in Table 1) present within the amino acid sequence selected from the group consisting of SEQ ID NO: 11-94, 190-216, 247, and SEQ ID NOS275-300.
  • XI, X2, X3, and X4 when present, comprise the amino acid sequence at least 25%, 27%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100% identical to, respectively, XI, X2, X3, and X4 domains (as defined in Table 1 (though listed as HI, H2, H3, and H4 domains) present within the amino acid sequence of SEQ ID NO:90 versions 1 or 2, which have the same primary amino acid sequence but which differ slightly in optional/variable linker residues.
  • this embodiment may include variants of XI, X2, X3, and/or X4 domains present SEQ ID NO:90 version 1 or 2 that incorporate the mutations relative to the SEQ ID NO:90 primary amino acid sequence shown SEQ ID NOS:275-300.
  • the first polypeptides, second polypeptides, and polypeptides described herein may be chemically synthesized or recombinantly expressed (when the polypeptide is genetically encodable).
  • the polypeptides may be linked to other compounds, such as stabilization compounds to promote an increased half-life in vivo, including but not limited to albumin, PEGylation (attachment of one or mote polyethylene glycol chains), HESylation,
  • PASylation, glycosylation, or may be produced as an Fc-fusion or in deimmunized variants.
  • linkage can be covalent or non-covalent.
  • PEG polyethylene glycol
  • PEG'-MAL maleimide group
  • PEG- MAL Suitable examples of PEG- MAL are methoxy PEG-MAL 5 kD; methoxy PEG- MAL 20 kD; methoxy (PEG)2-MAL 40 kD; methoxy PEG(MAL)2 5 kD; methoxy PEG(MAL)2 20 kD; methoxy PEG(MAL)240 kD; or any combination thereof. See also US Patent No. 8,148,109.
  • the PEG may comprise branched chain PEGs and/or multiple PEG chains.
  • the stabilization compound including but not limited to a PEG- containing moiety, is linked at a cysteine residue in the polypeptide.
  • the cysteine residue is present in the X2 domain.
  • the cysteine residue is present, for example, in any one of a number of positions in the X2 domain.
  • the X2 domain is at least 19 amino acids in length and the cysteine residue is at positions 1, 2, 5, 9 or 16 relative to those 19 amino acids.
  • the stabilization compound including but not limited to a PEG-containing moiety, is linked to the cysteine residue via a maleimide group.
  • first polypeptides In a further embodiment, the first polypeptides, second polypeptides, and
  • polypeptides may further comprise a targeting domain.
  • the conditionally receptor agonist can be directed to a target of interest.
  • the targeting domain may be covalently or non-covalently bound to the first polypeptide, second polypeptide, and/or polypeptide.
  • any suitable means for such non-covalent binding may be used, including but not limited to streptavidin-biotin linkers.
  • the targeting domain when present, is a translational fusion with the polypeptide.
  • the polypeptide and the targeting domain may directly abut each other in the translational fusion or may be linked by a polypeptide linker suitable for an intended purpose.
  • exemplary such linkers include, but are not limited, to those disclosed in WO2016178905, WO2018153865 (in particular, at page 13), and WO 2018170179 (in particular, at paragraphs [0316]-[0317]).
  • suitable linkers include, but are not limited to peptide linkers, such as GGGGG (SEQ ID NO: 95), GSGGG (SEQ ID NO: 96), GGGGGG (SEQ ID NO: 97), GGSGGG (SEQ ID NO: 98), GGSGGSGGGSGGSGSG (SEQ ID NO: 99), GSGGSGGGSGGSGSG (SEQ ID NO: 100), GGSGGSGGGSGGSGGGGSGGSGGGSGGGGS (SEQ ID NO: 101), and [GGGGX] place (SEQ ID NO: 102), where X is Q, E or S and n is 2-5.
  • peptide linkers such as GGGGGGG (SEQ ID NO: 95), GSGGG (SEQ ID NO: 96), GGGGGG (SEQ ID NO: 97), GGSGGG (SEQ ID NO: 98), GGSGGSGGGSGGSGSG (SEQ ID NO: 99), GSGGSGGGSGGSGSG (SEQ ID NO: 100), GGSGGSGGGS
  • the targeting domains are polypeptide domains or small molecules that bind to a target of interest.
  • the targeting domain binds to a cell surface protein; in this embodiment, the cell may be any cell type of interest that includes a surface protein that can be bound by a suitable targeting domain.
  • the cell surface proteins are present on the surface of cells selected from the group consisting of tumor cells, tumor vascular component cells, tumor microenvironment cells (e.g. fibroblasts, infiltrating immune cells, or stromal elements), other cancer cells and immune cells
  • tumor cell including but not limited to CD8+ T cells, T-regulatory cells, dendritic cells, NK cells, or macrophages.
  • the cell surface protein is on the surface of a tumor cell, vascular component cell, or tumor microenvironment cell (e.g. fibroblasts, infiltrating immune cells, or stromal elements), any suitable tumor cell, vascular component cell, or tumor
  • microenvironment cell surface marker may be targeted, including but not limited to EGFR, EGFRvlTI, Her2, HER3, EpCAM, MSLN, MUC16, PSMA, TROP2, ROR1, RON, PD-L1, CD47, CTLA-4.CD5, CD19, CD20, CD25, CD37, CD30, CD33, CD40, CD45, CAMPATH- 1, BCMA, CS-1, PD-L1, B7-H3, B7-DC, HLD-DR, carcinoembryonic antigen (CEA), TAG- 72, EpCAM, MUC1, folate-binding protein, A33, G250, prostate-specific membrane antigen (PSMA), ferritin, GD2, GD3, GM2, Le y , CA-125, CA 19-9, epidermal growth factor, pl85HER2, IL-2 receptor, EGFRvIII (de2-7 EGFR), fibroblast activation protein, tenascin, a metalloproteinase, endosialin
  • STEAP1 (six transmembrane epithelial antigen of prostate, Genbank accession no. NM 012449); 0772P (CA125, MUC 16, Genbank accession no. AF361486); MPF (MPF, MSLN, SMR, megakaryocyte potentiating factor, mesothelin, Genbank accession no. NM 005823); Napi3b (NAPI-3B, NPTllb, SLC34A2, solute carrier family 34 (sodium phosphate), member 2, type II sodium-dependent phosphate transporter 3b, Genbank accession no. NM 006424); Serna 5b (FU10372, KIAA1445, Mm.
  • CRIPTO CR, CR1, CRGF, CRIPTO, TDGF1, teratocarcinoma- derived growth factor, Genbank accession no. NP003203 or NM003212
  • CD21 CR2 (Complement receptor 2) or C3DR(C3d/Epstein Barr virus receptor) or Hs. 73792, Genbank accession no. M26004
  • CD79b IGb (immunoglobulin-associated beta), B29, Genbank accession no. NM 000626)
  • FcRH2 IFGP4, IRTA4, SPAP1A (SH2 domain containing phosphatase anchor protein la), SPAP1B, SPAP1C, Genbank accession no.
  • HER2 Genebank accession no. Ml 1730
  • NCA Genebank accession no. M18728
  • MDP Genebank accession no. BC017023
  • IL20R.alpha Genebank accession no. AF184971
  • CD79a CD79A, CD79.alpha., immunoglobulin-associated alpha, a B cell-specific protein that covalently interacts with Ig beta (CD79B) and forms a complex on the surface with lg M molecules, transduces a signal involved in B-cell differentiation, Gcnbank accession No. NP001774.1
  • CXCR5 Burldtt's lymphoma receptor 1, a G protein-coupled receptor that is activated by the CXCL13 chemokine, functions in lymphocyte migration and humoral defense, plays a role in HIV-2 infection and perhaps development of AIDS, lymphoma, myeloma, and leukemia, Genbank accession No.
  • NP001707.1 HLA-DOB (Beta subunit of MHC class II molecule (la antigen) that binds peptides and presents them to CD4+ T lymphocytes, Genbank accession No. NP002111.1); P2X5 (Purinergic receptor P2X ligand-gated ion channel 5, an ion channel gated by extracellular ATP, may be involved in synaptic transmission and neurogenesis, deficiency may contribute to the pathophysiology of idiopathic detrusor instability, Genbank accession No. NP002552.2); CD72 (B-cell differentiation antigen CD72, Lyb-2, Genbank accession No.
  • HLA-DOB Beta subunit of MHC class II molecule (la antigen) that binds peptides and presents them to CD4+ T lymphocytes, Genbank accession No. NP002111.1
  • P2X5 Purinergic receptor P2X ligand-gated ion channel 5, an ion channel gated
  • LY64 Lymphocyte antigen 64 (RP105), type 1 membrane protein of the leucine rich repeat (LRR) family, regulates B-cell activation and apoptosis, loss of function is associated with increased disease activity in patients with systemic lupus erythematosis, Genbank accession No. NP005573.1); FCRH1 (Fc receptor-like protein 1, a putative receptor for the immunoglobulin Fc domain that contains C2 type Ig-like and GGAM domains, may have a role in B-lymphocyte differentiation, Genbank accession No.
  • NP443170.1 a putative immunoreceptor with possible roles in B cell development and lymphomagenesis; deregulation of the gene by translocation occurs in some B cell malignancies, Genbank accession No. NPl 12571.1).
  • IRTA2 Immunoglobulin superfamily receptor translocation associated 2, a putative immunoreceptor with possible roles in B cell development and lymphomagenesis; deregulation of the gene by translocation occurs in some B cell malignancies, Genbank accession No. NPl 12571.1).
  • the targeting domain binds to immune cell surface markers.
  • the target may be cell surface proteins on any suitable immune cell, including but not limited to CD8+ T cells, T-regulatory cells, dendritic cells, NK cells or macrophages.
  • the targeting domain may target any suitable immune cell surface marker (whether an endogenous or an engineered immune cell, including but not limited to engineered CAR-T cells), including but not limited to CD3, CD4, CDS, CD 19, CD20, CD21, CD25, CD37, CD30, CD33, CD40, CD68, CD123, CD254, PD-1, B7-H3, and CTLA-4.
  • the targeting domain binds to PD-1, PDL-1, CTLA-4, TROP2, B7-H3, CD33, CD22, carbonic anhydrase IX, CD123, Nectin-4, tissue factor antigen, CD154, B7- H3, B7-H4, FAP (fibroblast activation protein) or MUC16, and/or wherein the targeting domain binds to PD-1, PDL-1, CTLA-4, TROP2, B7-H3, CD33, CD22, carbonic anhydrase IX, CD123, Nectin-4, tissue factor antigen, CD154, B7-H3, B7-H4, FAP (fibroblast activation protein) or MUC16.
  • the targeting domains can be any suitable polypeptides that bind to targets of interest and can be incorporated into the polypeptide of the disclosure.
  • the targeting domain may include but is not limited to an scFv, a F(ab), a F(ab’)2, a B cell receptor (BCR), a DARPin, an affibody, a monobody, a nanobody, diabody, an antibody (including a monospecific or bispecific antibody); a cell-targeting oligopeptide including but not limited to RGD integrin-binding peptides, de novo designed binders, aptamers, a bicycle peptide, conotoxins, small molecules such as folic acid, and a vims that binds to the cell surface.
  • the first polypeptides, second polypeptides, and polypeptides of the disclosure may include additional residues at the N-terminus, C -terminus, or both that are not present in the first polypeptides, second polypeptides, and polypeptides of the disclosure; these additional residues are not included in determining the percent identity of the polypeptides or peptide domains of the disclosure relative to the reference polypeptide.
  • Such residues may be any residues suitable for an intended use, including but not limited to detection tags (i.e.:
  • Residues suitable for attachment of such groups may include cysteine, lysine or p- acetylphenylalanine residues or can be tags, such as amino acid tags suitable for reaction with transglutaminases as disclosed in U.S. Patent Nos. 9,676,871 and 9,777,070.
  • the present invention provides nucleic acids, including isolated nucleic acids, encoding the first polypeptides, second polypeptides, and polypeptides of the present disclosure that can be genetically encoded.
  • the isolated nucleic acid sequence may comprise RNA or DNA.
  • Such isolated nucleic acid sequences may comprise additional sequences useful for promoting expression and/or purification of the encoded protein, including but not limited to polyA sequences, modified Kozak sequences, and sequences encoding epitope tags, export signals, and secretory signals, nuclear localization signals, and plasma membrane localization signals. It will be apparent to those of skill in the art, based on the teachings herein, what nucleic acid sequences will encode the polypeptides of the invention.
  • the present disclosure provides expression vectors comprising the nucleic acid of any aspect of the invention operatively linked to a suitable control sequence.
  • “Expression vector” includes vectors that operatively link a nucleic acid coding region or gene to any control sequences capable of effecting expression of the gene product.
  • “Control sequences” operably linked to the nucleic acid sequences of the invention are nucleic acid sequences capable of effecting the expression of the nucleic acid molecules.
  • the control sequences need not be contiguous with the nucleic acid sequences, so long as they function to direct the expression thereof. Thus, for example, intervening untranslated yet transcribed sequences can be present between a promoter sequence and the nucleic acid sequences and the promoter sequence can still be considered “operably linked" to the coding sequence.
  • control sequences include, but are not limited to, polyadenylation signals, termination signals, and ribosome binding sites.
  • expression vectors include but are not limited to, plasmid and viral-based expression vectors.
  • the control sequence used to drive expression of the disclosed nucleic acid sequences in a mammalian system may be constitutive (driven by any of a variety of promoters, including but not limited to, CMV, SV40, RSV, actin, EF) or inducible (driven by any of a number of inducible promoters including, but not limited to, tetracycline, ecdysone, steroid-responsive).
  • the expression vector must be replicable in the host organisms either as an episome or by integration into host chromosomal DNA.
  • the expression vector may comprise a plasmid, viral-based vector (including but not limited to a retroviral vector or oncolytic virus), or any other suitable expression vector.
  • the expression vector can be administered in the methods of the disclosure to express the polypeptides in vivo for therapeutic benefit.
  • the expression vectors can be used to transfect or transduce cell therapeutic targets (including but not limited to CAR-T cells or tumor cells) to effect the therapeutic methods disclosed herein.
  • the present disclosure provides host cells that comprise the expression vectors and/or nucleic acids disclosed herein, wherein the host cells can be either prokaryotic or eukaryotic.
  • the cells can be transiently or stably engineered to incorporate the expression vector of the invention, using techniques including but not limited to bacterial transformations, calcium phosphate co-precipitation, electroporation, or liposome mediated-, DEAE dextran mediated-, polycationic mediated-, or viral mediated transfection.
  • bacterial transformations calcium phosphate co-precipitation, electroporation, or liposome mediated-, DEAE dextran mediated-, polycationic mediated-, or viral mediated transfection.
  • a method of producing a polypeptide according to the invention is an additional part of the invention.
  • the method comprises the steps of (a) culturing a host according to this aspect of the invention under conditions conducive to the expression of the polypeptide, and (b) optionally, recovering the expressed polypeptide.
  • the expressed polypeptide can be recovered from the cell free extract, but preferably they are recovered from the culture medium.
  • the present disclosure provides pharmaceutical compositions, comprising one or more conditionally active receptor agonist, polypeptide, nucleic acids, expression vectors, and/or host cells of any aspect or embodiment of the disclosure and a pharmaceutically acceptable carrier.
  • the pharmaceutical compositions of the disclosure can be used, for example, in the methods of the disclosure described below.
  • the pharmaceutical composition may comprise in addition to the polypeptide of the disclosure (a) a lyoprotectant; (b) a surfactant; (c) a bulking agent; (d) a tonicity adjusting agent; (e) a stabilizer; (f) a preservative and/or (g) a buffer.
  • the buffer in the pharmaceutical composition is a Tris buffer, a histidine buffer, a phosphate buffer, a citrate buffer or an acetate buffer.
  • the pharmaceutical composition may also include a lyoprotectant, e.g. sucrose, sorbitol or trehalose.
  • the pharmaceutical composition includes a preservative e.g.
  • the pharmaceutical composition includes a bulking agent, like glycine.
  • the pharmaceutical composition includes a surfactant e.g., polysorbate-20, polysorbate-40, polysorbate- 60, polysorbate-65, polysorbate-80 polysorbate-85, poloxamer- 188, sorbitan monolaurate, sorbitan monopalmitate, sorbitan monostearate, sorbitan monooleate, sorbitan trilaurate, sorbitan tristearate, sorbitan trioleaste, or a combination thereof.
  • a surfactant e.g., polysorbate-20, polysorbate-40, polysorbate- 60, polysorbate-65, polysorbate-80 polysorbate-85, poloxamer- 188, sorbitan monolaurate, sorbitan monopalmitate, sorbitan monostearate, sorbitan monooleate, sorbitan trilaurate, sorbitan tristearate, sorbitan trioleaste, or a combination thereof.
  • composition may also include a tonicity adjusting agent, e.g., a compound that renders the formulation substantially isotonic or isoosmotic with human blood.
  • a tonicity adjusting agent e.g., a compound that renders the formulation substantially isotonic or isoosmotic with human blood.
  • Exemplary tonicity adjusting agents include sucrose, sorbitol, glycine, methionine, mannitol, dextrose, inositol, sodium chloride, arginine and arginine hydrochloride.
  • the pharmaceutical composition additionally includes a stabilizer, e.g., a molecule which, when combined with a protein of interest substantially prevents or reduces chemical and/or physical instability of the protein of interest in lyophilized or liquid form.
  • Exemplary stabilizers include sucrose, sorbitol, glycine, inositol, sodium chloride, methionine, arginine, and arginine hydrochloride.
  • conditionally active receptor agonists, polypeptides, nucleic acids, expression vectors, and/or host cells may be the sole active agent in the pharmaceutical composition, or the composition may further comprise one or more other active agents suitable for an intended use.
  • the present disclosure provides methods for treating cancer, comprising administering to a subject in need thereof a therapeutically effective amount of the conditionally active receptor agonist, polypeptide, nucleic acids, expression vectors, and/or host cells of any embodiment or combination of embodiments disclosed herein under conditions wherein the first polypeptide component and the second polypeptide component interact at cells of the tumor to treat the cancer.
  • the first and second polypeptide may be administered together, or may be administered in separate pharmaceutical formulations.
  • treat or “treating” means accomplishing one or more of the following: (a) reducing the size or volume of tumors and/or metastases in the subject; (b) limiting any increase in the size or volume of tumors and/or metastases in the subject; (c) increasing survival; (d) reducing the severity of symptoms associated with cancer; (e) limiting or preventing development of symptoms associated with cancer; and (f) inhibiting worsening of symptoms associated with cancer.
  • the methods can be used to treat any suitable cancer, including but not limited to colon cancer, melanoma, renal cell cancer, head and neck squamous cell cancer, gastric cancer, urothelial carcinoma, Hodgkin lymphoma, non-small cell lung cancer, small cell lung cancer, hepatocellular carcinoma, pancreatic cancer, Merkel cell carcinoma colorectal cancer, acute myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, non- Hodgkin lymphoma, multiple myeloma, ovarian cancer, cervical cancer, and any tumor types selected by a diagnostic test, such as microsatellite instability, tumor mutational burden, PD- L1 expression level, or the immunoscore assay (as developed by the Society for
  • the subject may be any subject that has cancer.
  • the subject is a mammal, including but not limited to humans, dogs, cats, horses, cattle, etc.
  • the first targeting domain binds to a cell marker and the second targeting domain binds to a second and distinct cell marker, and wherein co -expression of these two markers on the same or nearby cells occurs more commonly in the tumor than in other tissues, and wherein the first polypeptide and the second polypeptide interact only after binding of the first targeting domain to the first cell marker and binding of the second targeting domain to the second cell marker.
  • This embodiment employs two targeting domains that bind to separate markers that aren't themselves enriched on tumor cells, but for which the co-expression is enriched in the tumor.
  • the first polypeptide component comprises a first targeting domain and the second polypeptide component comprises a second targeting domain, wherein the first targeting domain binds to a first tumor cell marker and the second targeting domain binds to a second tumor cell marker which may be the same or different than the first tumor cell marker, and wherein the first polypeptide and the second polypeptide interact only after binding of the first targeting domain to the first tumor cell marker and binding of the second targeting domain to the second tumor cell marker.
  • the first polypeptide component comprises a first targeting domain and the second polypeptide component comprises a second targeting domain, wherein the first targeting domain binds to a tumor cell marker and the second targeting domain binds to an immune cell marker (including but not limited to CD8+ T cells, T- regulatory cells, dendritic cells, or macrophages), and wherein the first polypeptide and the second polypeptide interact only after binding of the first targeting domain to the tumor cell marker and binding of the second targeting domain to the immune cell marker.
  • an immune cell marker including but not limited to CD8+ T cells, T- regulatory cells, dendritic cells, or macrophages
  • the first targeting domain binds to a cell marker and the second targeting domain binds to a second and distinct cell marker, and wherein co-expression of these two markets occur mote commonly on tumor cells than on some other types of cells, and wherein the first polypeptide and the second polypeptide interact only after binding of the first targeting domain to the first cell marker and binding of the second targeting domain to the second cell marker on the same cell.
  • This embodiment employs two targeting domains that bind to separate markers that aren't themselves enriched on tumor cells, but for which the co-expression is enriched in the tumor
  • the first polypeptide component comprises a first targeting domain and the second polypeptide component comprises a second targeting domain, wherein the first targeting domain binds to a first immune cell marker (including but not limited to CD8+ T cells, T-regulatory cells, dendritic cells, or macrophages) and the second targeting domain binds to a second immune cell marker (including but not limited to CD8+ T cells, T-regulatory cells, dendritic cells, or macrophages) which may be the same or different than the first immune cell marker, and wherein the first polypeptide and the second polypeptide interact only after binding of the first targeting domain to the first immune cell marker and binding of the second targeting domain to the second immune cell marker.
  • a first immune cell marker including but not limited to CD8+ T cells, T-regulatory cells, dendritic cells, or macrophages
  • a second immune cell marker including but not limited to CD8+ T cells, T-regulatory cells, dendritic cells, or macrophages
  • the present disclosure provides methods for modulating an immune response in a subject by administering to a subject a conditionally active receptor agonist, polypeptide, nucleic acid, expression vector, host cell, or the pharmaceutical composition of the present disclosure.
  • the method comprises administering to a subject a conditionally active receptor agonist under conditions wherein the first polypeptide component and the second polypeptide component interact at immune cells to modulate an immune response.
  • an "immune response" being modulated refers to a response by a cell of the immune system, such as a B cell, T cell (CD4 or CDS), regulatory T cell, antigen- presenting cell, dendritic cell, monocyte, macrophage, NKT cell, NK cell, basophil, eosinophil, or neutrophil, to a stimulus.
  • the response is specific for a particular antigen (an "antigen-specific response”), and refers to a response by a CD4 T cell, CDS T cell, or B cell via their antigen-specific receptor.
  • an immune response is a T cell response, such as a CD4+ response or a CD8+ response.
  • Such responses by these cells can include, for example, cytotoxicity, proliferation, cytokine or chemokine production, trafficking, or phagocytosis, and can be dependent on the nature of the immune cell undergoing the response.
  • an immune response being modulated is T-cell mediated.
  • the immune response is an anti-cancer immune response.
  • a conditionally active IL-2 mimetic described herein is administered to a subject having cancer to modulate an anti-cancer immune response in the subject.
  • the immune response is a tissue reparative immune response.
  • a conditionally active IL-4 mimetic described here is administered to a subject in need thereof to modulate a tissue reparative immune response in the subject.
  • the immune response is a wound healing immune response.
  • a conditionally active IL-4 mimetic described here is administered to a subject in need thereof to modulate a wound healing immune response in the subject.
  • methods for modulating an immune response to a second therapeutic agent in a subject.
  • the method comprises administering a polypeptide of the present disclosure in combination with an effective amount of the second therapeutic agent to the subject.
  • the second therapeutic agent can be, for example, a chemotherapeutic agent or an antigen-specific immunotherapcutic agent.
  • the antigen-specific immunotherapeutic agent comprises chimeric antigen receptor T cells (CAR-T cells).
  • the polypeptide of the present disclosure enhances the immune response of the subject to the therapeutic agent.
  • the immune response can be enhanced, for example, by improving the T cell response (including CAR-T cell response), augmenting the innate T cell immune response, decreasing inflammation, inhibiting T regulatory cell activity, or combinations thereof.
  • a conditionally active cytokine mimetic of the present invention e.g., a conditionally active IL-4 mimetic as described herein, will be impregnated to or otherwise associated with a biomaterial and the biomaterial will be introduced to a subject.
  • the biomaterial will be a component of an implantable medical device and the device will be, for example, coated with the biomaterial.
  • Such medical devices include, for example, vascular and arterial grafts.
  • Conditionally active IL-4 and/or IL-4 associated biomaterials can be used, for example, to promote wound healing and/or tissue repair and regeneration.
  • the disclosure provides methods for agonizing the IL-2 receptor or the IL-4 receptor, comprising administering to a subject the conditionally active receptor agonist of any embodiment or combination of embodiments disclosed herein, under conditions wherein the first polypeptide component and the second polypeptide component interact at the receptor.
  • a“Therapeutically effective amount” refers to an amount of the conditionally active receptor agonist, polypeptide, nucleic acids, expression vectors, and/or host cells that is effective for treating and/or limiting the disease to be treated (e.g., cancer).
  • the conditionally active receptor agonist, polypeptides, nucleic acids, expression vectors, and/or host cells are typically formulated as a pharmaceutical composition, such as those disclosed above, and can be administered via any suitable route, including but not limited to orally, by inhalation spray, ocularly, intravenously, subcutaneously, intraperitoneally, and intravesicularly in dosage unit formulations containing conventional pharmaceutically acceptable carriers, adjuvants, and vehicles.
  • the polypeptides, nucleic acids, expression vectors, and/or host cells are administered mucosally, including but not limited to intraocular, inhaled, or intranasal administration.
  • the polypeptides, nucleic acids, expression vectors, and/or host cells are administered orally.
  • Such particular embodiments can be administered via droplets, nebulizers, sprays, or other suitable formulations.
  • any suitable dosage range may be used as determined by attending medical personnel. Dosage regimens can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response).
  • a suitable dosage range for the conditionally active receptor agonists or polypeptides may, for instance, be 0.1 ug/kg-100 mg/kg body weight; alternatively, it may be 0.5 ug/kg to 50 mg/kg; 1 ug/kg to 25 mg/kg, or 5 ug/kg to 10 mg/kg body weight.
  • the recommended dose could be lower than 0.1 mcg/kg, especially if administered locally. In other embodiments, the recommended dose could be based on weight/m 2 (i.e.
  • conditionally active receptor agonists, polypeptides, nucleic acids, expression vectors, and/or host cells can be delivered in a single bolus, or may be administered more than once (e.g., 2, 3, 4, 5, or more times) as determined by an attending physician.
  • conditionally active receptor agonists, polypeptides, nucleic acids, expression vectors, and/or host cells made be administered as the sole prophylactic or therapeutic agent, or may be administered together with (i.e.: combined or separately) one or more other prophylactic or therapeutic agents, including but not limited to tumor resection,
  • a computational approach for designing de novo cytokine mimetics is described that recapitulate the functional sites of the natural cytokines, but otherwise are unrelated in topology or amino acid sequence.
  • This strategy was used to design de novo non-split mimetics of 1L-2 and interleukin- 15 (1L- 15) that bind to tire IL-2 receptor bg 0 heterodimer (IL-2RPYc), but have no binding site for IL-2Ra or IL-15Ra.
  • the designs are hyper-stable, bind to human and mouse P,-2Kbg 0 with higher affinity than the natural cytokines, and elicit downstream cell signaling independent of IL-2Ra and IL-15Ra.
  • Neoleukin-2/15 Crystal structures of an experimentally optimized mimetic, neoleukin-2/15, are very close to the design model and provide the first structural information on the murine IL-2RpY c complex.
  • Neoleukin-2/15 has highly efficacious therapeutic activity compared to IL-2 in murine models of melanoma and colon cancer, with reduced toxicity and no signs of immunogenicity.
  • cytokines interact with multiple different receptor subunits, and like most naturally occurring proteins, contain non-ideal structural features that compromise stability but are important for function.
  • a computational protocol was developed in which the structural elements interacting with the desired receptor subunit(s) are fixed in space, and an idealized globular protein structure is built to support these elements.
  • Combinatorial fragment assembly was used to support short linear epitopes with parametric construction of disembodied helices coupled with knowledge-based loop closure (Figure la-b).
  • the approach was tested by attempting to de novo design stable idealized proteins with interaction surfaces mimicking those of human IL-2 (hIL-2) and human IL-15 (hIL-15) for the human IL-2RpY c (hIL-2Rf$Yc), but entirely lacking the IL-2 receptor alpha (IL-2Ra) interaction surface.
  • Native hIL-2 comprises four helices connected by long irregular loops.
  • the N- terminal helix (HI) interacts with both the beta and gamma subunits of the IL-2 receptor, the third helix (H3) interacts with the beta subunit, and the C-terminal helix (H4) with the gamma subunit;
  • the alpha subunit interacting surface is formed by the irregular second helix (H2) and two long loops, one connecting HI to H2 and the other connecting H3 and H4.
  • Optimized designs were expressed recombinantly in E. coli and found to elicit pSTATS signaling in vitro on IL-2-responsive murine cells at low- nanomolar or even picomolar concentrations (Table 3, see Silva et al., Nature 565, pg. 186, January 10, 2019), but had relatively low thermal stability (Tm ⁇ 45°C, see Figures 9 and 10).
  • the computational design protocol was repeated starting from the backbone of the highest affinity' first round design (Gl_neo2_40_lF, topology: H1->H4- >H2’->H3), coupling the loop building process with parametric variation in helix length (+/- 8 amino acids, see Figure la bottom panel).
  • Neo-2/15 (also referred to herein as Neo-2/15), is a 100 residue protein with a new topology and sequence quite different from human or murine IL-2 (29% sequence identity to hlL-2 over 89 residues, and 16% sequence identity to mIL-2 over 76 aligned residues, in structural topology-agnostic based alignment).
  • Neoleukin-2/15 binds with high affinity to human and mouse IL-2RPY C , but does not interact with IL-2Ra (see Silva et al., Nature 565, pg. 186, January 10, 2019).
  • the affinities of Neoleukin-2/15 for the human and mouse IL-2 receptors (P,-2Kb and IL-2RPY C ) are significantly higher than those of the corresponding native IL-2 cytokines.
  • Neoleukin-2/15 elicits IL- 2Ra-independent signaling in both human and murine IL-2-responsive cells, and in murine primary T cells (see Silva et al., Nature 565, pg.
  • neoleukin-2/15 drove T cell survival effectively after being boiled for 60 minutes at 95°C, while these conditions inactivated both IL-2 and Super-2 (see Silva et al., Nature 565, pg. 186, January 10, 2019).
  • Thermal denaturation studies were carried out on many other of the designed mimetics, demonstrating their thermal stability as well (see Figure 11). This unprecedented stability for a cytokine-like molecule, beyond eliminating the requirement for cold chain storage, suggests a robustness to mutations (see Figure 8 and 13), genetic fusions and chemical modification greatly exceeding that of native IL-2 (see Figure 3).
  • IL-2 neoleukin-2/15
  • the clinical use of IL-2 has been mainly limited by toxicity. Although the interactions responsible for IL-2 toxicity in humans are incompletely understood, in murine models toxicity is T cell independent and ameliorated in animals deficient in the lL-2Ra chain (CD25+). Thus, many efforts have been directed to reengineer IL-2 to weaken interactions with IL-2Ra, but mutations in the CD25 binding site can be highly destabilizing. The inherent low stability of IL-2 and its tightly evolved dependence on CD25 have been barriers to the translation of reengineered IL-2 compounds.
  • IL-15 is dependent on trans presentation by the IL-15a (CD215) receptor that is displayed primarily on antigen- presenting cells and natural killer cells.
  • IL-15a CD215
  • neoleukin-2/15 primarily drives expansion of CD8 + T cells and does not induce or minimally induces expansion of regulatory' T cells only at the highest dose tested.
  • neoleukin-2/15 produces an increase in Thy 1.2 ' CD44 + CD8 ⁇ T cells without increasing CD4 * Foxp3 + antigen-specific Tregs in the lymphoid organs (data not shown; see Silva et al., Nature 565, pg. 186, January 10, 2019).
  • neoleukin-2/15 The therapeutic efficacy of neoleukin-2/15 was tested in the poorly immunogenic B16F10 melanoma and the more immunogenic CT26 colon cancer mouse models.
  • Single agent treatment with neoleukin-2/15 led to dose-dependent delays in tumour growth in both cancer models.
  • CT26 colon cancer single agent treatment showed improved efficacy to that observed for recombinant mIL-2 (see Silva et al.. Nature 565, pg. 186, January 10, 2019).
  • TA99 anti-TRPl
  • neoleukin-2/15 in combination with TA99 showed substantially reduced toxicity and an overall superior therapeutic effect compared to mIL-2 (see Silva et al., Nature 565, pg. 186, January 10, 2019).
  • Mice treated with the combination mIL-2 and TA99 steadily lost weight and their overall health declined to the point of requiring euthanasia, whereas little decline was observed with the combination of neoleukin-2/15 and TA99 (see Silva et al., Nature 565, pg. 186, January 10, 2019).
  • neoleukin-2/15 treatment led to a significant increase in intratumoral CD8:T,e g ratios (see Silva et al., Nature 565, pg. 186, January 10, 2019), which has been previously correlated with effective antitumor immune responses 58 .
  • the increases of CD8:T t e g ratios by neoleukin-2/15 are dose and antigen dependent (see Silva et al.. Nature 565, pg. 186, January 10, 2019); optimum therapeutic effects were obtained at higher doses and in combination with other
  • neoleukin-2/15 exhibits the predicted homeostatic benefit derived from its IL- 2 like immunopotentiator activity, but without the adverse effects associated with CD25 * preferential binding.
  • the therapeutic efficacy of neoleukin-2/15 was tested in a CAR-T model.
  • mice inoculated with 0.5 c 10 6 RAJI tumor cells were left untreated, were treated with 0.8 x 10 6 anti-CD19 CAR-T cells (infused 7 days after inoculation of tumor cells), or were similarly treated with anti-CD 19 CAR-T cells plus 20 pg/day of either human IL-2 or neoleukin-2/15 on days 8-14 after tumor inoculation.
  • Neoleukin-2/15 was shown to significantly enhance the anti-tumor effect of CAR-T cell therapy, slowing growth of the tumor and extending the survival of the mouse ((see Silva et al., Nature 565, pg. 186, January 10, 2019)).
  • neoleukin-2/15 can be solubly expressed in E. coli (see Fig 17), retains activity- at high temperature, does not interact with IL-2Ra and is robust to substantial sequence changes that allow the engineering of new functions (Fig. 7).
  • Neoleukin-2/15 Disulfide-stapling and reengineering into an IL-4 mimetic: Neoleukin-2/15 is highly modular, allowing to easily tune its properties, such as increasing its stability or modify its binding preference. This modularity and robustness was taken advantage of by introducing, by computational design, stability enhancing single-disulfide staples that preserve the function of neoleukin-2/15. In one example, a disulfide bridge was introduced by searching pairs of positions with favorable introduced a single disulfide between residues 38 and 75, which stabilizes helices H3 and H2.
  • neoleukin-2/15 This strategy increased the stability of neoleukin-2/15 (Tm > 95°C), while retaining its sequence and function mostly unaffected (see Silva et al., Nature 565, pg. 186, January 10, 2019).
  • the modularity properties of neoleukin-2/15 were used to modify its binding preference. All cytokines in the interleukin-2 family interact with the Y c and share a common architecture. Therefore, it was hypothesized that neoleukin-2/15 could be transformed into another cytokine mimetic of the IL-2 family by changing only amino acids in the half of the binding-site that interacts with IL-2RP (helices HI and H3).
  • Neo-2/15 was modified to bind to the human IL-4 receptor (comprising IL-4Ra and Y c ) and not to the human IL-2 receptor (comprising IL-2R0 and Y c ) by aligning the Neo-2/15 model into the structure of human IL-4 bound to its IL-4 receptor, and mutating 14 residues in Neo-2/15 to match the amino-acids of IL-4 at those structural positions that mediate interactions between IL-4 and IL4r ( Figure 3).
  • Binding was further optimized by directed evolution using random mutagenesis and screening for high binding affinity variants, which introduced two additional amino acid substitutions and modified one of the fourteen original residues grafted from the IL-4 protein, thereby creating a new protein Neoleukin-4 with a total of sixteen mutations from Neoleukin- 2/15.
  • the resulting optimized design, neoleukin-4 (see Table 6), was recombinantly expressed and purified from E. coli and tested for binding.
  • Neoleukin-4 binds with high affinity to IL-4Ra receptor, binds cooperatively to IL-4RaY c (see Figure 3), and does not bind with any affinity to the IL-2 receptor (data not shown)
  • Neoleukin-4 retains the superior thermostable properties of neoleukin-2/15 (see Figure 14b, c), and binds to the IL-13 receptor as expected given the natural cross-reactivity of IL-4 to IL-13 receptor (data not shown).
  • RosettaScriptsTM compatible information for design Briefly, the mimetic building algorithm works as follows. For the first generation of designs, each of the core-elements was idealized by reconstruction using loops from a clustered database of highly-ideal fragments (fragment- size 4 amino acids). After idealization, the mimetic building protocol aims to reconnect the idealized elements by pairs in all possible combinations. To do this it uses combinatorial fragment assembly of sequence-agnostic fragments from the database, followed by cartesian- constrained backbone minimization for potential solutions (i.e. where the N- and C- ends of the built fragment are close enough to link the two secondary structures). After minimization, the solutions are verified to contain highly ideal fragments (i.e.
  • the mimetic design protocol in this second generation was similar to the one described for the first generation, but with two key differences. Firstly, the core-fragments were no longer built from fragments, but instead by discovering parametric equations of repetitive phi and psi angles (omega fixed to 180°) that result in repetitive secondary structures that recapitulated each of the target helices as close as possible, a“pitch” on the phi and psi angles was allowed every X-amino acids in order to allow the helices the possibility to have curvature (final parameters: HI :, H2:, H3, H4), the sue of these parametric equations allowed to change the size of each of the core-elements in the target structure at will (either increase or decrease the size), which was coupled (max/min 8.a.a.) with the loop building process, and reductions in the size of the core elements were not allowed to remove hotspots from the binding site.
  • the second difference in the second generation designs is that instead of reconnecting the secondary' structure core-elements we used a fragment-size of 7 amino acids, and no combinatorial assembly of more than one fragment was allowed (i.e. a single fragment has to be able to close a pair of secondary structures).
  • the rest of the design algorithm was in essence similar to the one followed in the generation one.
  • the RosettaTM energy functions used were“talaris2013” and“talaris2014”, for the first and second generation of designs, respectively.
  • Yeast display Yeast were transformed with genes encoding the proteins to be displayed together with linearized pETconS vector.
  • the vector was linearized by 100 fold overdigestion by Ndel and Xhol (New England Biolabs) and then purified by gel extraction (Qiagen).
  • the genes included 50 bases of overlap with the vector on both the 5’ and 3’ ends such that homologous recombination would place the genes in frame between the AGA2 gene and the myc tag on the vector.
  • Yeast were grown in C-Trp-Ura media prior to induction in SGCAA media as previously described.
  • Mutagenesis and affinity maturation For error-prone PCR based mutagenesis, the design to be mutated was cloned into pETcon3 vector and amplified using the MutaGeneTM II mutagenesis kit (Invitrogen) per manufacturer’s instructions to yield a mutation frequency of approximately 1% per nucleotide. 1 pg of this mutated gene was electroporated into EBY100 yeast together with 1 pg of linearized pETcon3 vector, with a transformation efficiency on the order of 10 8 . The yeast were induced and sorted multiple times in succession with progressively decreasing concentrations of receptor until convergence of the population. The yeast were regrown in C-Trp-Ura media between each sort.
  • SSM libraries were constructed from synthetic DNA from Genscript. For each amino acid on each design template, forward primers and reverse primers were designed such that PCR amplification would result in a 5’ PCR product with a degenerate NNK codon and a 3’ PCR product, respectively. Amplification of“left” and “right” products by COF and COR primers yielded a series of template products each consisting of a degenerate NNK codon at a different residue position. For each design, these products were pooled to yield the SSM library. SSM libraries were transformed by electroporation into conditioned Saccharomyces cerevisiae strain EBY100 cells, along with linearized pETCON3 vector, using the protocol previously described by Benatuil et al.
  • Combinatorial libraries were constructed from synthetic DNA from Genscript containing ambiguous nucleotides and similarly transformed into linearized pETCON3 vector.
  • Protein expression Genes encoding the designed protein sequences were synthesized and cloned into pET-28b(+) E. coli plasmid expression vectors (GenScript, N- terminal 6xHis tag and thrombin cleavage site). Plasmids were then transformed into chemically competent E. coli Lemo21 cells (NEB). Protein expression was performed using Terrific BrothTM and M salts, cultures were grown at 37°C until OD 600 reached approximately 0.8, then expression was induced with 1 mM of isopropyl b-D-thiogalactopyranoside
  • IPTG IPTG
  • a Microfluidics Ml 10P microfluidizer at 18,000 psi
  • the soluble fraction was clarified by centrifugation at 24,000 g for 20 minutes.
  • the soluble fraction was purified by Immobilized Metal Affinity Chromatograpy (Qiagen) followed by FPLC size-exclusion chromatography (SuperdexTM 75 10/300 GL, GE Healthcare).
  • the purified neoleukin-2/15 was characterized by Mass Spectrum (MS) verification of the molecular weight of the species in solution (Thermo Scientific ), Size Exclusion - Multi Angle Laser Light Scattering (SEC-MALLS) in order to verify monomeric state and molecular weight (Agilent, Wyatt), SDS-PAGE, and endotoxin levels (Charles River).
  • MS Mass Spectrum
  • Human and mouse IL-2 complex components including hIL-2 (a.a. 1-133), ML-2Ra (a.a. 1-217), ML-2RP (a.a. 1-214) ML-2Ry (a.a. 1-232), mIL-2 (a.a. 1-149), mlL-2Ra ectodomain (a.a. 1-213), mIL-2Rp ectodomain (a.a. 1-215), and my c ectodomain (a.a. 1-233) were secreted and purified using a baculovirus expression system, as previously described 1 '’ 49 .
  • Circular dichroism Far-ultraviolet CD measurements were carried out with an AVIV spectrometer model 420 in PBS buffer (pH 7.4) in a 1 mm path-length cuvette with protein concentration of ⁇ 0.20 mg/ml (unless otherwise mentioned in the text). Temperature melts where from 25 to 95 °C and monitored absorption signal at 222 nm (steps of 2 °C/min, 30 s of equilibration by step). Wavelength scans (195-260 nm) were collected at 25°C and 95°C, and again at 25°C after fast refolding ( ⁇ 5 min).
  • STATS phosphorylation studies In vitro studies: Approximately 2x10 s YT-1, IL- 2Ra + YT-1, or CTLL-2 cells are plated in each well of a 96-well plate and re-suspended in RPMI complete medium containing serial dilutions of hlL-2, mIL-2, Super-2, or engineered IL-2 mimetics. Cells are stimulated for 15 min at 37°C and immediately fixed by addition of formaldehyde to 1.5% and 10 min incubation at room temperature. Permeabilization of cells is achieved by resuspension in ice-cold 100% methanol for 30 min at 4°C.
  • FACS buffer phosphate-buffered saline [PBS] pH 7.2 containing 0.1% bovine serum albumin
  • Alexa Fluor® 647- conjugated anti-STAT5 pY694 BD Biosciences
  • MFI normalization to the maximum signal intensity.
  • Spleens and lymph nodes are harvested from wild-type C57BL/6J or B6;129S4-H2ra tmlDw (CD25KO) mice and made into a single cell suspension in sort buffer (2% Fetal Calf Serum in pH 7.2 phosphate-buffered saline).
  • CD4+ T cells are enriched through negative selection by staining the cell suspension with biotin-conjugated anti-B220, CDS, NK1.1 , CD1 lb, CD1 lc, Terl 19, and CD19 antibodies at 1 : 100 for 30 min on ice.
  • anti-biotin MicroBeadsTM (Miltenyi Biotec) is added to the cell suspension at 20 pL per 10 7 total cells and incubated on ice for 20 minutes. Cells are washed, resuspended and negative selection is then performed using EasySep 1M Magnets (STEMCELL Technologies). Approximately 1 xl 0 5 enriched cells are added to each well of a 96-well plate in RPMI complete medium with 5% FCS with 10-fold serial dilutions of mIL-2, Super-2, or
  • Neoleukin-2/15 Cells are stimulated for 20 minutes at 37°C in 5% CCh , fixed with 4% PFA and incubated for 30 minutes at 4°C. Following fixation, cells are harvested and washed twice with sort buffer and again fixed in 500 pL 90% ice-cold methanol in dH z O for 30 minutes on ice for permeabilization.
  • Cells are washed twice with Perm/Wash Buffer (BD Biosciences) and stained with anti-CD4-PerCP in Perm/Wash buffer (1 :300), anti-CD44-Alexa Fluor 700 (1:200), anti-CD25-PE-Cy7 (1 :200), and 5 pL per sample of anti-pSTAT5-PE pY694 for 45 min at room temperature in the dark. Cells are washed with Perm/Wash and re-suspended in sort buffer for analysis on a BD LSR P flow cytometer (BD Biosciences).
  • Perm/Wash Buffer BD Biosciences
  • Table 2 Amino acid sequences for the best twelve first-round designs. Ten of the designs were (Gl_neo2_35-44) were experimentally characterized by yeast display and all but two (Gl_neo2_35 and Gl_neo2_44) were found to bind fluorescently labeled chimeric ILRPY C at low nanomolar concentrations via flow cytometry screening of designed first-round protein binders. Designs indicated were expressed on yeast and incubated with 2 nM ML- 2Kbg 0 or 0 nM P,-2Kbg 0 (data not shown).
  • G2 neo2 40 I F seq02 to G2_neo2_40_lF_seq28 correspond to the 27 RosettaTM sequence redesigns of Gl_neo2_40_l F;
  • G2_neo2_40_lF_seq29 to G2_neo2_40_l F_seq42 represent the 14 new de novo mimetic designs.
  • Neoleukin-2/15-H8Y-K33E H1->H3->H2' ->H4
  • PKKKIQLYAEHALYDALMILNIVKTNSPPAEEELEDYAFNFELILEEIARLFESGDQKDEAEKAKRMKEWMKRIK TTASEDEQEEMANAIITILQSWIFS SEQ ID NO: 94
  • Neoleukin-2/15-H8Y -K33E Binding of Neoleukin-2/15-H8Y -K33E to the IL2 receptor was measured by biolayer interferometry, and it was found to have higher binding affinity than Neoleukin-2 for IL2- Rbeta, both when tested against lL2Rbeta alone and when tested against the IL2Rbeta- gamma complex. This increased affinity' was attributable mostly to an improved off-rate from 1L2-Rbeta.
  • Example 2 Split cytokine mimics for targeted immunotherapy
  • De novo proteins are designed following the rules of an ideal protein structure providing them with unusual biochemical properties, such as extreme thermostability and mutational robustness. Therefore, de novo designed proteins are ideal candidates to use for the development of conditionally active protein therapeutics.
  • IL-2 mimetic protein Neoleukin-2/15.
  • This system enables the delivery of conditionally active therapeutic proteins that reconstitute their activity by colocalization on the surface of target cells.
  • Neoleukin-2/15 In order to identify potential split sites of Neoleukin-2/15 (Neo2), we evaluated the protein structure to find split positions that would minimize detrimental effects on the function of the protein. As a result, we defined three exemplary split positions: (i) between the helical elements HI (Neo2Al) and H3’-H2-H4 (Neo2Bl), (ii) between the helical elements Hl-H3’(Neo2A2) and H2-H4 (Neo2B2), (iii) between the helical elements H1-H3’- H2 (Neo2A3) and H4 (Neo2B3)(Fig. 15).
  • split-Neo2 fragments were characterized by analyzing their binding capacity to human IL-2 Receptor (Fig. 15) and signaling on IL-2 responsive CTTL-2 cells (Fig. 16).
  • the individual split fragments were shown to have negligible binding to IL-2R ⁇ fy and signaling capacity in most cases, but potent activity upon equimolar combination of the complementary split fragments.
  • split-Neo2 enables co-localization-dependent reconstitution of the protein, and thus, conditional-activation of split-Neo2.
  • Neo2Al,Neo2A2 and Neo2A3 were fused to the C-terminus of a Her2-targeted designed ankyrin repeat protein (DARPin) by a 15-residue flexible linker (GSGGSGGGSGGSGSG; SEQ ID NO: 100).
  • DARPin Her2-targeted designed ankyrin repeat protein
  • Neo2Bl, Neo2B2 and Neo2B3 were fused to the N -terminus of an EGFR-targeted designed ankyrin repeat protein (DARPin) by a 15- residue flexible linker (GSGGSGGGSGGSGSG; SEQ ID NO: 100). Then, we evaluated their ability to reconstitute binding to IL-2Rffy after combination of the split fragments, demonstrating that the fusions did not interfere with their reconstitution capacity' of splitNeo- 2 (Fig. 17).
  • DARPin an EGFR-targeted designed ankyrin repeat protein
  • Neo-2 activity resultsed in fluorescent labelling with PE on the surface of target cells (Fig. 18c).
  • Fig. 18c We observed strong IL-2 Receptor binding on the surface of Her2+ and Her2+/EGFR+ when full Neo2 was targeted with a single anti-Her2 targeting domain (aHer2-Neo2). Similar binding was observed when Neo2Al and Neo2Bl split fragments were both targeted to Her2 (aHer2- Neo2Al + aHer2-Neo2Bl), demonstrating that both fragments could be delivered to the same cell surface marker if desired.
  • the applications of the split cytokine mimic technology are not only limited to targeting tumor associated antigens.
  • targeting specific subsets of immune cells to be selectively stimulated would be beneficial to direct the immune response to treat disease.
  • this application would be useful to specifically augment the expansion of CD8+ cytotoxic T cells, Natural Killer cells or engineered CAR T-cells to potentiate their anti-tumor response, but also, targeting to regulatory' T-cells to suppress a strong immune response (Fig. 20a).
  • mixed targeting approaches can be deployed, i.e . target one split fragment to the tumor cells or tumor microenvironment, while the other fragment is delivered to immune cells (Fig. 20b)
  • PKKKIQLHAEHALYDALMILNIVKTNSPPAEEKLEDYAFNFELILEEIARLFESGDQKDEAE KAKRMKEWMKRIKTTAS H4 (Neo2B3) TTASEDEQEEMANAIITILQSWIFS (SEQ ID NO: 259)
  • PKKKIQLHAEHALYDALMILNIVKTNSPPAEEKLEDYAFNFELILEEIARLFESGD (SEQ ID NO: 260)
  • H2'-H4 (Neo2B2) DQKDEAEKAKRMKEWMKRIKTTASEDEQEEMANAIITILQSWIFS (SEQ ID NO: 261)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Toxicology (AREA)
  • Biophysics (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biotechnology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2019/062198 2018-11-20 2019-11-19 Split interleukin mimetics and their use Ceased WO2020106708A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
AU2019384523A AU2019384523B2 (en) 2018-11-20 2019-11-19 Split interleukin mimetics and their use
CN201980070569.6A CN112912388A (zh) 2018-11-20 2019-11-19 分拆白介素模拟物和它们的用途
SG11202103045SA SG11202103045SA (en) 2018-11-20 2019-11-19 Split interleukin mimetics and their use
CN202510054463.4A CN120040576A (zh) 2018-11-20 2019-11-19 分拆白介素模拟物和它们的用途
US17/294,807 US12234572B2 (en) 2018-11-20 2019-11-19 Split interleukin mimetics and their use
BR112021008985-3A BR112021008985A2 (pt) 2018-11-20 2019-11-19 Agentes miméticos de interleucina divididos e seus usos
EA202190593A EA202190593A1 (ru) 2018-11-20 2019-11-19 Расщепленные миметики интерлейкина и их применение
JP2021517768A JP2022511390A (ja) 2018-11-20 2019-11-19 分割インターロイキン模倣体およびその使用
MX2021005593A MX2021005593A (es) 2018-11-20 2019-11-19 Miméticos de interleucina dividida y sus usos.
KR1020217014525A KR20210094531A (ko) 2018-11-20 2019-11-19 분할 인터루킨 모방체 및 이의 용도
EP19848950.2A EP3883956A1 (en) 2018-11-20 2019-11-19 Split interleukin mimetics and their use
CA3119472A CA3119472A1 (en) 2018-11-20 2019-11-19 Split interleukin mimetics and their use
IL283217A IL283217A (en) 2018-11-20 2021-05-16 Split interleukin mimetics and their use
JP2024175673A JP2025013348A (ja) 2018-11-20 2024-10-07 分割インターロイキン模倣体およびその使用
US19/016,343 US20250179690A1 (en) 2018-11-20 2025-01-10 Split interleukin mimetics and their use

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862770152P 2018-11-20 2018-11-20
US62/770,152 2018-11-20

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US17/294,807 A-371-Of-International US12234572B2 (en) 2018-11-20 2019-11-19 Split interleukin mimetics and their use
US19/016,343 Continuation US20250179690A1 (en) 2018-11-20 2025-01-10 Split interleukin mimetics and their use

Publications (1)

Publication Number Publication Date
WO2020106708A1 true WO2020106708A1 (en) 2020-05-28

Family

ID=69500815

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/062198 Ceased WO2020106708A1 (en) 2018-11-20 2019-11-19 Split interleukin mimetics and their use

Country Status (13)

Country Link
US (2) US12234572B2 (https=)
EP (1) EP3883956A1 (https=)
JP (2) JP2022511390A (https=)
KR (1) KR20210094531A (https=)
CN (2) CN112912388A (https=)
AU (1) AU2019384523B2 (https=)
BR (1) BR112021008985A2 (https=)
CA (1) CA3119472A1 (https=)
EA (1) EA202190593A1 (https=)
IL (1) IL283217A (https=)
MX (1) MX2021005593A (https=)
SG (1) SG11202103045SA (https=)
WO (1) WO2020106708A1 (https=)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11117944B2 (en) * 2018-06-25 2021-09-14 University Of Washington De novo design of potent and selective interleukin mimetics
WO2022170007A1 (en) * 2021-02-05 2022-08-11 Dharmacon, Inc. Fusion proteins for crispr-based transcriptional repression
WO2023044318A3 (en) * 2021-09-15 2023-04-20 Neoleukin Therapeutics, Inc. Interleukin-2 receptor βeta (il-2rβ) binding polypeptides
WO2023139293A1 (en) * 2022-01-24 2023-07-27 Novimmune Sa Composition and methods for the selective activation of cytokine signaling pathways
US11845797B2 (en) 2018-07-03 2023-12-19 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
US12152073B2 (en) 2018-03-14 2024-11-26 Marengo Therapeutics, Inc. Multifunctional molecules that bind to calreticulin and uses thereof
US12234572B2 (en) 2018-11-20 2025-02-25 University Of Washington Split interleukin mimetics and their use
US12247060B2 (en) 2018-01-09 2025-03-11 Marengo Therapeutics, Inc. Calreticulin binding constructs and engineered T cells for the treatment of diseases
US12358982B2 (en) 2019-02-21 2025-07-15 Marengo Therapeutics, Inc. Multifunctional molecules that bind to T cell related cancer cells and uses thereof
US12384842B2 (en) 2019-02-21 2025-08-12 Marengo Therapeutics, Inc. Antibody molecules that bind to NKP30 and uses thereof
WO2025212606A1 (en) * 2024-04-01 2025-10-09 Bio-Techne Corporation Synthetic il-2 polypeptides and conjugates, compositions, and uses thereof
KR20250157393A (ko) 2023-03-07 2025-11-04 추가이 세이야쿠 가부시키가이샤 스캐폴드 단백질 사용에 의한 조건부 활성화 수용체 신호전달
US12486326B2 (en) 2020-01-03 2025-12-02 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
WO2026039791A1 (en) * 2024-08-16 2026-02-19 Regeneron Pharmaceuticals, Inc. Tumor-targeted split il2 receptor agonists

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4722235A1 (en) * 2023-05-24 2026-04-08 Nantong Yichen Biopharma. Co. Ltd. Polypeptide, and conjugate and use thereof
IL325764A (en) * 2023-07-13 2026-03-01 Outpace Bio Inc Designed compositions of interleukin-2 cytokine and methods of use
WO2026078029A1 (en) * 2024-10-10 2026-04-16 F. Hoffmann-La Roche Ag Splitted interleukin-2 prodrugs and uses thereof

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002012337A1 (en) * 2000-08-09 2002-02-14 European Molecular Biology Laboratory Peptide mimetics
WO2002101629A1 (en) * 2001-06-07 2002-12-19 Wyeth Solution structure of il-13 and uses thereof
WO2016178905A1 (en) 2015-05-07 2016-11-10 Eli Lilly And Company Fusion proteins
US9676871B2 (en) 2010-11-05 2017-06-13 Pfizer Inc. Engineered polypeptide conjugates and methods for making thereof using transglutaminase
US9777070B2 (en) 2014-04-30 2017-10-03 Pfizer Inc Anti-PTK7 antibody-drug conjugates
WO2018153865A1 (en) 2017-02-24 2018-08-30 Philogen S.P.A. Immunoconjugates with optimized linkers and orientation
WO2018170179A1 (en) 2017-03-15 2018-09-20 Silverback Therapeutics, Inc. Benzazepine compounds, conjugates, and uses thereof
WO2020005819A1 (en) * 2018-06-25 2020-01-02 University Of Washington De novo design of potent and selective interleukin mimetics

Family Cites Families (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US1015080A (en) 1908-04-17 1912-01-16 George I Rockwood Apparatus for operating alarms or other devices.
US5229109A (en) 1992-04-14 1993-07-20 Board Of Regents, The University Of Texas System Low toxicity interleukin-2 analogues for use in immunotherapy
US6955807B1 (en) 1998-05-15 2005-10-18 Bayer Pharmaceuticals Corporation IL-2 selective agonists and antagonists
US6168785B1 (en) 1998-07-16 2001-01-02 Institut Pasteur Biological applications of new peptides of IL-2 and derivatives and use as therapeutic agents
CN1930300A (zh) * 2004-03-05 2007-03-14 希龙公司 预测患者治疗药物耐受性的体外试验系统
US20110020269A1 (en) 2007-05-08 2011-01-27 Beth Israel Deaconess Medical Center, Inc. Methods and compositions for modifying t cell immune responses and inflammation
CA2860170C (en) 2010-12-22 2022-06-14 The Board Of Trustees Of The Leland Stanford Junior University Superagonists and antagonists of interleukin-2
US9844582B2 (en) 2012-05-22 2017-12-19 Massachusetts Institute Of Technology Synergistic tumor treatment with extended-PK IL-2 and therapeutic agents
WO2015164815A1 (en) 2014-04-24 2015-10-29 The Board Of Trustees Of The Leland Stanford Junior University Superagonists, partial agonists and antagonists of interleukin-2
AU2015301936B2 (en) 2014-08-11 2019-03-07 Delinia, Inc. Modified IL-2 variants that selectively activate regulatory T cells for the treatment of autoimmune diseases
JP2022511390A (ja) 2018-11-20 2022-01-31 ユニバーシティ オブ ワシントン 分割インターロイキン模倣体およびその使用
US20220000921A1 (en) 2018-11-20 2022-01-06 Innovative Cellular Therapeutics Holdings, Ltd. Modified Cell Expressing Therapeutic Agent and Uses thereof
US20220370563A1 (en) 2019-10-25 2022-11-24 Neoleukin Therapeutics, Inc. Methods of administration of il-2 receptor agonists
AU2020414355A1 (en) 2019-12-24 2022-08-11 Neoleukin Therapeutics, Inc. Combination therapy using an IL-2 receptor agonist and an immune checkpoint inhibitor
CN111040981A (zh) 2019-12-26 2020-04-21 南昌大学 表达重组IL-2的重组大肠杆菌Nissle 1917及其功能验证方法
US20230340071A1 (en) 2020-03-16 2023-10-26 Neoleukin Therapeutics, Inc. Interleukin-2 Receptor Beta (IL-2RB) Binding Polypeptides

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002012337A1 (en) * 2000-08-09 2002-02-14 European Molecular Biology Laboratory Peptide mimetics
WO2002101629A1 (en) * 2001-06-07 2002-12-19 Wyeth Solution structure of il-13 and uses thereof
US9676871B2 (en) 2010-11-05 2017-06-13 Pfizer Inc. Engineered polypeptide conjugates and methods for making thereof using transglutaminase
US9777070B2 (en) 2014-04-30 2017-10-03 Pfizer Inc Anti-PTK7 antibody-drug conjugates
WO2016178905A1 (en) 2015-05-07 2016-11-10 Eli Lilly And Company Fusion proteins
WO2018153865A1 (en) 2017-02-24 2018-08-30 Philogen S.P.A. Immunoconjugates with optimized linkers and orientation
WO2018170179A1 (en) 2017-03-15 2018-09-20 Silverback Therapeutics, Inc. Benzazepine compounds, conjugates, and uses thereof
WO2020005819A1 (en) * 2018-06-25 2020-01-02 University Of Washington De novo design of potent and selective interleukin mimetics

Non-Patent Citations (15)

* Cited by examiner, † Cited by third party
Title
"Genbank", Database accession no. NP 112571.1
A. L. LEHNINGER: "Biochemistry", 1975, WORTH PUBLISHERS, pages: 73 - 75
AARON CHEVALIER ET AL: "Massively parallel de novo protein design for targeted therapeutics", NATURE, vol. 550, no. 7674, 27 September 2017 (2017-09-27), London, pages 74 - 79, XP055621081, ISSN: 0028-0836, DOI: 10.1038/nature23912 *
DANIEL-ADRIANO SILVA ET AL: "De novo design of potent and selective mimics of IL-2 and IL-15", NATURE, vol. 565, no. 7738, 1 January 2019 (2019-01-01), London, pages 186 - 191, XP055636971, ISSN: 0028-0836, DOI: 10.1038/s41586-018-0830-7 *
DARIO VENETZ: "ENGINEERED CYTOKINE DERIVATIVES FOR TARGETED CANCER IMMUNOTHERAPY", RESEARCH COLLECTION DOCTORAL THESIS, 1 January 2016 (2016-01-01), DE, pages 1 - 167, XP055447168, Retrieved from the Internet <URL:https://www.research-collection.ethz.ch/bitstream/handle/20.500.11850/156048/eth-50082-02.pdf> [retrieved on 20180202], DOI: 10.3929/ethz-a-010792885 *
DOMINGUES H ET AL: "RATIONAL DESIGN OF A GCN4-DERIVED MIMETIC OF INTERLEUKIN-4", NATURE STRUCTURAL BIOLOGY, NATURE PUBLISHING GROUP, NEW YORK, NY, US, vol. 6, no. 7, 1 July 1999 (1999-07-01), pages 652 - 656, XP000953440, ISSN: 1072-8368, DOI: 10.1038/10706 *
GLORIA RUIZ-GÓMEZ ET AL: "Rational Structure-Based Rescaffolding Approach to De Novo Design of Interleukin 10 (IL-10) Receptor-1 Mimetics", PLOS ONE, vol. 11, no. 4, 28 April 2016 (2016-04-28), pages e0154046, XP055620402, DOI: 10.1371/journal.pone.0154046 *
JENS M. MOLL ET AL: "Split 2 Protein-Ligation Generates Active IL-6-Type Hyper-Cytokines from Inactive Precursors", ACS SYNTHETIC BIOLOGY, vol. 6, no. 12, 15 December 2017 (2017-12-15), Washington, DC,USA, pages 2260 - 2272, XP055688708, ISSN: 2161-5063, DOI: 10.1021/acssynbio.7b00208 *
R.I. FRESHNEY: "Culture of Animal Cells: A Manual of Basic Technique", 1987, LISS, INC.
RAKEEB KURESHI ET AL: "Reprogramming immune proteins as therapeutics using molecular engineering", CURRENT OPINION IN CHEMICAL ENGINEERING, vol. 19, 27 December 2017 (2017-12-27), Netherlands, pages 27 - 34, XP055620751, ISSN: 2211-3398, DOI: 10.1016/j.coche.2017.12.003 *
RALPH ECKENBERG ET AL: "IL-2R[beta] Agonist P1-30 Acts in Synergy with IL-2, IL-4, IL-9, and IL-15: Biological and Molecular Effects", THE JOURNAL OF IMMUNOLOGY, vol. 165, no. 8, 15 October 2000 (2000-10-15), US, pages 4312 - 4318, XP055620207, ISSN: 0022-1767, DOI: 10.4049/jimmunol.165.8.4312 *
S. E. BOYKEN ET AL: "De novo design of protein homo-oligomers with modular hydrogen-bond network-mediated specificity", SCIENCE, vol. 352, no. 6286, 6 May 2016 (2016-05-06), US, pages 680 - 687, XP055428723, ISSN: 0036-8075, DOI: 10.1126/science.aad8865 *
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
SILVA ET AL., NATURE, vol. 565, 10 January 2019 (2019-01-10), pages 186
SUMAN MITRA ET AL: "Interleukin-2 Activity Can Be Fine Tuned with Engineered Receptor Signaling Clamps", IMMUNITY., vol. 42, no. 5, 1 May 2015 (2015-05-01), US, pages 826 - 838, XP055539278, ISSN: 1074-7613, DOI: 10.1016/j.immuni.2015.04.018 *

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12247060B2 (en) 2018-01-09 2025-03-11 Marengo Therapeutics, Inc. Calreticulin binding constructs and engineered T cells for the treatment of diseases
US12152073B2 (en) 2018-03-14 2024-11-26 Marengo Therapeutics, Inc. Multifunctional molecules that bind to calreticulin and uses thereof
US11401313B2 (en) * 2018-06-25 2022-08-02 University Of Washington De novo design of potent and selective interleukin mimetics
US11117944B2 (en) * 2018-06-25 2021-09-14 University Of Washington De novo design of potent and selective interleukin mimetics
US11655278B2 (en) 2018-06-25 2023-05-23 University Of Washington De novo design of potent and selective interleukin mimetics
US12227553B2 (en) 2018-06-25 2025-02-18 University Of Washington De novo design of potent and selective interleukin mimetics
US12240880B2 (en) 2018-06-25 2025-03-04 University Of Washington De novo design of potent and selective interleukin mimetics
US12351632B2 (en) 2018-07-03 2025-07-08 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
US12286477B2 (en) 2018-07-03 2025-04-29 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
US11845797B2 (en) 2018-07-03 2023-12-19 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
US11965025B2 (en) 2018-07-03 2024-04-23 Marengo Therapeutics, Inc. Method of treating solid cancers with bispecific interleukin-anti-TCRß molecules
US12234572B2 (en) 2018-11-20 2025-02-25 University Of Washington Split interleukin mimetics and their use
US12358982B2 (en) 2019-02-21 2025-07-15 Marengo Therapeutics, Inc. Multifunctional molecules that bind to T cell related cancer cells and uses thereof
US12384842B2 (en) 2019-02-21 2025-08-12 Marengo Therapeutics, Inc. Antibody molecules that bind to NKP30 and uses thereof
US12486326B2 (en) 2020-01-03 2025-12-02 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
WO2022170007A1 (en) * 2021-02-05 2022-08-11 Dharmacon, Inc. Fusion proteins for crispr-based transcriptional repression
WO2023044318A3 (en) * 2021-09-15 2023-04-20 Neoleukin Therapeutics, Inc. Interleukin-2 receptor βeta (il-2rβ) binding polypeptides
WO2023139293A1 (en) * 2022-01-24 2023-07-27 Novimmune Sa Composition and methods for the selective activation of cytokine signaling pathways
KR20250157393A (ko) 2023-03-07 2025-11-04 추가이 세이야쿠 가부시키가이샤 스캐폴드 단백질 사용에 의한 조건부 활성화 수용체 신호전달
WO2025212606A1 (en) * 2024-04-01 2025-10-09 Bio-Techne Corporation Synthetic il-2 polypeptides and conjugates, compositions, and uses thereof
WO2026039791A1 (en) * 2024-08-16 2026-02-19 Regeneron Pharmaceuticals, Inc. Tumor-targeted split il2 receptor agonists

Also Published As

Publication number Publication date
KR20210094531A (ko) 2021-07-29
JP2022511390A (ja) 2022-01-31
US20220017588A1 (en) 2022-01-20
MX2021005593A (es) 2021-08-11
CN112912388A (zh) 2021-06-04
BR112021008985A2 (pt) 2021-10-26
AU2019384523B2 (en) 2025-08-28
JP2025013348A (ja) 2025-01-24
AU2019384523A1 (en) 2021-04-22
EA202190593A1 (ru) 2021-11-18
IL283217A (en) 2021-06-30
US20250179690A1 (en) 2025-06-05
CN120040576A (zh) 2025-05-27
US12234572B2 (en) 2025-02-25
SG11202103045SA (en) 2021-04-29
EP3883956A1 (en) 2021-09-29
CA3119472A1 (en) 2020-05-28

Similar Documents

Publication Publication Date Title
US20250179690A1 (en) Split interleukin mimetics and their use
US12240880B2 (en) De novo design of potent and selective interleukin mimetics
EP4083073B1 (en) Novel chimeric antigen receptor and use thereof
CN110818802B (zh) 一种嵌合t细胞受体star及其应用
CN106459219B (zh) 白细胞介素15蛋白复合物及其用途
US10206980B2 (en) IL-15 heterodimeric protein and uses thereof
JP2016526915A (ja) 遺伝子操作された抗体遺伝子発現カセットを有するミニサークルdna組換え親プラスミド、その発現カセットを有するミニサークルdna及び使用[関連出願の参照] 本出願は、発明の名称を「遺伝子操作された抗体遺伝子発現カセットを有するミニサークルdna組換え親プラスミド、その発現カセットを有するミニサークルdna及び使用」とする、2013年8月06日に出願された中国特許出願201310339305.0号の優先権を主張し、そのすべての内容が本明細書に参照として組み込まれる。
US20170252435A1 (en) Combination
WO2024148369A1 (en) Targeted il-12 affinity variants
HK1231090B (zh) 白细胞介素15蛋白复合物及其用途

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19848950

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2021517768

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019384523

Country of ref document: AU

Date of ref document: 20191119

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3119472

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 20217014525

Country of ref document: KR

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021008985

Country of ref document: BR

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019848950

Country of ref document: EP

Effective date: 20210621

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112021008985

Country of ref document: BR

Free format text: COM BASE NA PORTARIA 405, DE 21/12/2020, SOLICITA-SE QUE SEJA APRESENTADO NOVO CONTEUDO DE LISTAGEM DE SEQUENCIAS, POIS O CONTEUDO APRESENTADO NA PETICAO 870210041912, DE 07/05/2021, POSSUI INFORMACOES DIVERGENTES AO PEDIDO (DIVERGENCIA DE DEPOSITANTE).

ENP Entry into the national phase

Ref document number: 112021008985

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210507

WWG Wipo information: grant in national office

Ref document number: 17294807

Country of ref document: US

WWW Wipo information: withdrawn in national office

Ref document number: 283217

Country of ref document: IL