WO2019217943A1 - Methods of editing single nucleotide polymorphism using programmable base editor systems - Google Patents

Methods of editing single nucleotide polymorphism using programmable base editor systems Download PDF

Info

Publication number
WO2019217943A1
WO2019217943A1 PCT/US2019/031898 US2019031898W WO2019217943A1 WO 2019217943 A1 WO2019217943 A1 WO 2019217943A1 US 2019031898 W US2019031898 W US 2019031898W WO 2019217943 A1 WO2019217943 A1 WO 2019217943A1
Authority
WO
WIPO (PCT)
Prior art keywords
base editor
cell
polynucleotide
domain
snp
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/031898
Other languages
English (en)
French (fr)
Inventor
David Bryson
John Evans
Michael Packer
Jason Michael GEHRKE
Natalie PETROSSIAN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Beam Therapeutics Inc
Original Assignee
Beam Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020207035000A priority Critical patent/KR20210023832A/ko
Priority to EP19799854.5A priority patent/EP3790595A4/en
Priority to US17/054,348 priority patent/US20230159956A1/en
Priority to JP2021513764A priority patent/JP2021523738A/ja
Priority to CN201980046479.3A priority patent/CN112469446B/zh
Priority to CA3100034A priority patent/CA3100034A1/en
Application filed by Beam Therapeutics Inc filed Critical Beam Therapeutics Inc
Priority to AU2019266326A priority patent/AU2019266326A1/en
Priority to CN202411723844.9A priority patent/CN119587720A/zh
Publication of WO2019217943A1 publication Critical patent/WO2019217943A1/en
Anticipated expiration legal-status Critical
Priority to JP2024095618A priority patent/JP2024147545A/ja
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/465Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/50Hydrolases (3) acting on carbon-nitrogen bonds, other than peptide bonds (3.5), e.g. asparaginase
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/55Protease inhibitors
    • A61K38/57Protease inhibitors from animals; from humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/0008Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
    • A61K48/0025Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/102Mutagenizing nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/111General methods applicable to biologically active non-coding nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0618Cells of the nervous system
    • C12N5/0619Neurons
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/067Hepatocytes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • C12N9/222Clustered regularly interspaced short palindromic repeats [CRISPR]-associated [CAS] enzymes
    • C12N9/226Class 2 CAS enzyme complex, e.g. single CAS protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/78Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y305/00Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
    • C12Y305/04Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amidines (3.5.4)
    • C12Y305/04004Adenosine deaminase (3.5.4.4)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/80Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00Applications; Uses
    • C12N2320/30Special therapeutic applications
    • C12N2320/34Allele or polymorphism specific uses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2506/00Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells
    • C12N2506/45Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells from artificially induced pluripotent stem cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/80Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites

Definitions

  • CRISPR clustered regularly interspaced short palindromic repeat
  • Alpha-1 Antitrypsin Deficiency is a genetic disease in which pathogenic mutations in the SERPINA1 gene that encodes the alpha-1 antitrypsin (A1AT) protein lead to diminished protein production in individuals having the disease.
  • A1AT is a particularly good inhibitor of neutrophil elastase and protects tissues and organs such as the lung from elastin degradation. Consequently, elastin in the lungs of patients having A1AD is degraded more readily by neutrophil elastase, and over time, the loss in lung elasticity develops into chronic obstructive pulmonary disease (COPD).
  • A1AT is produced by hepatocytes within the liver and is secreted into systemic circulation where the protein functions as a protease inhibitor. 1
  • the most common pathogenic A1AT variant is a Guanine to Adenine (G ®A) mutation in the SERPINA1 gene, which results in a glutamate to lysine substitution at amino acid 342 of the A1AT protein.
  • G ®A Guanine to Adenine
  • This substitution causes the protein to misfold and polymerize within hepatocytes, and ultimately, the toxic aggregates can lead to liver injury and cirrhosis.
  • the liver toxicity might potentially be addressed by a gene knockout (CRISPR/ZFN/TALEN) or gene knockdown (siRNA), neither of these approaches addresses the pulmonary pathology.
  • CRISPR/ZFN/TALEN gene knockout
  • siRNA gene knockdown
  • neither of these approaches addresses the pulmonary pathology.
  • pulmonary pathology may be addressed with protein replacement therapy, this therapy fails to address the liver toxicity.
  • Gene therapy also would be inadequate to address the A1AT genetic defect.
  • compositions and methods for the precise correction of pathogenic amino acids in a protein associated with a disease or disorder using a programmable nucleobase editor are provided.
  • the described compositions and methods are useful for the treatment of alpha-1 antitrypsin deficiency (A1AD).
  • A1AD alpha-1 antitrypsin deficiency
  • the described compositions and methods for treating A1AD utilize an adenosine (A) base editor (ABE-(NGC variant)) to precisely correct a deleterious, single nucleotide polymorphism (SNP) in the endogenous SERPINA1 gene.
  • compositions and methods correct the deleterious mutation, E342K, which affects the activity and function of the encoded alpha-1 antitrypsin (A1AT) protein. This correction simultaneously eliminates the pathogenic protein burden on the liver and restores functional protein to the lungs.
  • a method of editing a SERPINA1 polynucleotide containing a single nucleotide polymorphism (SNP) associated with Alpha1 Anti-Trypsin Deficiency (A1AD) in which the method involves contacting the SERPINA1 polynucleotide with a base editor in complex with one or more guide polynucleotides, where the base editor contains a polynucleotide programmable DNA binding domain and an adenosine deaminase domain, and where one or more of the guide polynucleotides target the base editor to effect an A•T to G•C alteration of the SNP in the SERPINA1 gene, which is associated with A1AD.
  • the method involves contacting a cell, e.g., a eukaryotic cell, a mammalian cell, or human cell.
  • the cell is in vivo or ex vivo.
  • the invention features a cell produced by introducing into the cell, or a progenitor thereof, a base editor, a polynucleotide encoding the base editor, where the base editor contains a polynucleotide programmable DNA binding domain and an adenosine deaminase domain; and one or more guide polynucleotides that target the base editor to effect an A•T to G•C alteration of the SNP in a gene, e.g., the SERPINA1 gene, associated with A1AD.
  • the cell produced is a hepatocyte.
  • the cell or progenitor thereof is an embryonic stem cell, induced pluripotent stem cell, or a hepatocyte.
  • the hepatocyte expresses an A1AT polypeptide.
  • the cell is from a subject having A1AD.
  • the cell is a mammalian cell or a human cell.
  • the invention features a method of treating A1AD in a subject containing administering to subject in need thereof a cell as described in the above delineated aspects and embodiments.
  • the cell is autologous or is allogeneic or xenogeneic to the subject.
  • the invention features aa isolated cell or population of cells propagated or expanded from the cell of any above-delineated aspect.
  • the invention features a method of treating A1AD in a subject, in which the method comprises administering to a subject in need thereof a base editor, or a polynucleotide encoding the base editor, where the base editor contains a polynucleotide programmable DNA binding domain and an adenosine deaminase domain; and one or more guide polynucleotides that target the base editor to effect an A•T to G•C alteration of the SNP in a gene, e.g., the SERPINA1 gene, associated with A1AD.
  • the subject is a mammal or a human.
  • the method involves delivering the base editor, or polynucleotide encoding the base editor, and the one or more guide polynucleotides to a cell of the subject.
  • the cell is a hepatocyte.
  • the cell is a progenitor of a hepatocyte.
  • the hepatocyte expresses an A1AT polypeptide containing a mutation.
  • the invention features a method of producing a hepatocyte or progenitor thereof, in which the method involves (a) introducing into an induced pluripotent stem cell or hepatocyte progenitor containing an SNP in a gene, e.g., the SERPINA1 gene, associated with A1AD, a base editor, or a polynucleotide encoding the base editor, where the base editor contains a polynucleotide-programmable nucleotide-binding domain and an adenosine deaminase domain; and one or more guide polynucleotides, where the one or more guide polynucleotides target the base editor to effect an A•T to G•C alteration of the SNP associated with A1AD; and (b) differentiating the induced pluripotent stem cell or hepatocyte progenitor into hepatocyte.
  • a gene e.g., the SERPINA1 gene, associated with A1AD
  • the method involves differentiating the induced pluripotent stem cell into a hepatocyte or progenitor thereof.
  • the induced pluripotent stem cell contains an E342K mutation.
  • the hepatocyte progenitor is obtained from a subject having A1AD.
  • the hepatocyte or hepatocyte progenitor is a mammalian cell or human cell.
  • the base editor (BE) used in the described compositions and methods comprises a polypeptide comprising the amino acid sequence: (i):
  • gRNA guide RNA
  • the invention features a protein nucleic acid complex containing the base editor and a guide RNA of any of the foregoing aspects or embodiments delineated herein.
  • the A•T to G•C alteration at the SNP associated with A1AD changes a lysine to a glutamic acid in the A1AT polypeptide.
  • the SNP associated with A1AD results in expression of an A1AT polypeptide having a lysine at amino acid position 342.
  • the base editor correction replaces the lysine at position 342 of an A1AT polypeptide associated with A1AD with a glutamic acid.
  • the polynucleotide programmable DNA binding domain is a modified Streptococcus pyogenes Cas9 (SpCas9), or variants thereof.
  • the polynucleotide programmable DNA binding domain contains a modified SpCas9 having an altered protospacer-adjacent motif (PAM) specificity.
  • PAM protospacer-adjacent motif
  • the modified SpCas9 has specificity for the nucleic acid sequence 5’-AGC-3’.
  • the modified SpCas9 comprises the amino acid substitution D1332A and one or more of D1135M, S1136Q, G1218K, E1219F, D1332A, R1335E, and T1337R, or corresponding amino acid substitutions thereof.
  • the polynucleotide programmable DNA binding domain contains a variant of SpCas9 having an altered protospacer-adjacent motif (PAM) specificity.
  • the variant of SpCas9 has specificity for the nucleic acid sequence 5’-NGC-3’.
  • the modified SpCas9 contains amino acid substitutions D1135M, S1136Q, G1218K, E1219F, A1322R, D1332A, R1335E, and T1337R, or corresponding amino acid substitutions thereof.
  • the polynucleotide programmable DNA binding domain is a nuclease inactive or nickase variant.
  • the nickase variant contains an amino acid substitution D10A or a corresponding amino acid substitution thereof.
  • the adenosine deaminase domain is capable of deaminating adenosine in deoxyribonucleic acid (DNA).
  • the adenosine deaminase is a modified adenosine deaminase that does not occur in nature.
  • the adenosine deaminase is a TadA deaminase (e.g., TadA*7.10).
  • the one or more guide RNAs contains a CRISPR RNA (crRNA) and a trans-encoded small RNA (tracrRNA), where the crRNA contains a nucleic acid sequence complementary to a SERPINA1 nucleic acid sequence containing the SNP associated with A1AD.
  • the base editor is in complex with a single guide RNA (sgRNA) containing a nucleic acid sequence complementary to an SERPINA1 nucleic acid sequence containing the SNP associated with A1AD.
  • a base editor system for correcting a pathogenic single nucleotide polymorphism (SNP) in a gene
  • the base editor system comprises (a) a base editor comprising: (i) a polynucleotide-programmable DNA-binding domain, and (ii) a deaminase domain capable of deaminating the pathogenic SNP or its complement nucleobase; and (b) a guide polynucleotide in conjunction with the polynucleotide-programmable DNA- binding domain, wherein the guide polynucleotide targets the base editor to a target
  • polynucleotide sequence at least a portion of which is located in the gene or its reverse complement; wherein deaminating the pathogenic SNP or its complement nucleobase results in a conversion of the pathogenic SNP to its wild-type allele, thereby correcting a pathogenic mutation, such as those listed in Tables 3A and 3B herein.
  • a method for correcting a pathogenic single nucleotide polymorphism (SNP) in a gene comprises: contacting a target nucleotide sequence, at least a portion of which is located in the gene or its reverse complement, with a base editor comprising: (i) a polynucleotide-programmable DNA-binding domain in conjunction with a guide polynucleotide that targets the base editor to the target polynucleotide sequence, at least a portion of which is located in the gene or its reverse complement, and (ii) a deaminase domain capable of deaminating the pathogenic SNP or its complement nucleobase; and editing the pathogenic SNP by deaminating the pathogenic SNP or its complement nucleobase upon targeting of the base editor to the target nucleotide sequence, wherein deaminating the pathogenic SNP or its complement nucleobase results in a conversion of the pathogenic SNP to its
  • a method of treating a genetic disorder in a subject by correcting a pathogenic single nucleotide polymorphism (SNP) in a gene comprises administering a base editor, or a polynucleotide encoding the base editor, to a subject in need thereof, wherein the base editor comprises: (i) a polynucleotide-programmable DNA-binding domain, and (ii) a deaminase domain capable of deaminating the pathogenic SNP or its complement nucleobase; and administering a guide polynucleotide to the subject, wherein the guide polynucleotide targets the base editor to a target nucleotide sequence, at least a portion of which is located in the gene or its reverse complement; and editing the pathogenic SNP by deaminating the pathogenic SNP or its complement nucleobase upon targeting of the base editor to the target nucleotide sequence, wherein deaminating
  • a method of producing a cell, tissue, or organ for treating a genetic disorder in a subject in need thereof by correcting a pathogenic single nucleotide polymorphism (SNP) in a gene of the cell, tissue, or organ in which the method comprises: contacting the cell, tissue, or organ with a base editor, wherein the base editor comprises: (i) a polynucleotide- programmable DNA-binding domain, and (ii) a deaminase domain capable of deaminating the pathogenic SNP or its complement nucleobase; and contacting the cell, tissue, or organ with a guide polynucleotide, wherein the guide polynucleotide targets the base editor to a target nucleotide sequence at least a portion of which is located in the gene or its reverse complement; and editing the pathogenic SNP by deaminating the pathogenic SNP or its complement nucleobase upon targeting of the base editor to the target nucleotide sequence
  • SNP single nucleot
  • the method further comprises administering the cell, tissue, or organ to the subject.
  • the cell, tissue, or organ is autologous to subject.
  • the cell, tissue, or organ is allogeneic to the subject.
  • the cell, tissue, or organ is xenogeneic to the subject
  • the pathogenic SNP is associated with Stargardt disease
  • the pathogenic SNP is in an ABCA4 gene; and optionally, the pathogenic mutation comprises A1038V, L541P, G1961E, or a combination thereof.
  • the pathogenic SNP is associated with pseudoxanthoma elasticum; optionally, the pathogenic SNP is in an ABCC6 gene; and optionally, the pathogenic mutation comprises R1141*.
  • the pathogenic SNP is associated with medium-chain acyl-CoA dehydrogenase deficiency; optionally, the pathogenic SNP is in an ACADM gene; and optionally, the pathogenic mutation comprises K329E.
  • the pathogenic SNP is associated with severe combined immunodeficiency; optionally, the pathogenic SNP is in an ADA gene; and optionally, the pathogenic mutation comprises G216R, Q3*, or a combination thereof.
  • the pathogenic SNP is associated with primary hypoxaluria; optionally, the pathogenic SNP is in an AGXT gene; and optionally, the pathogenic mutation comprises G170R.
  • the pathogenic SNP is associated with autosomal recessive hypercholesterolemia; optionally; optionally, the pathogenic SNP is in an ARH gene; optionally, the pathogenic mutation comprises Q136*.
  • the pathogenic SNP is associated with metachromatic leukodystrophy; optionally, the pathogenic SNP is in an ARSA gene; optionally, the pathogenic mutation comprises P426L, c.459+1G>A, or a combination thereof.
  • the pathogenic SNP is associated with Marteauz- Lamy Syndrome (MSPVI); optionally, the pathogenic SNP is in an ARSB gene; optionally, the pathogenic mutation comprises Y210C. In some embodiments, the pathogenic SNP is associated with Citrullinemia Type I; optionally, the pathogenic SNP is in an ASS gene;
  • the pathogenic mutation comprises G390R.
  • the pathogenic SNP is associated with Darier disease; optionally, the pathogenic SNP is in an ATP2A2 gene; optionally, the pathogenic mutation comprises N767S.
  • the pathogenic SNP is associated with classic homocysteinuria; optionally, the pathogenic SNP is in a CBS gene; optionally, the pathogenic mutation comprises G307S, T191M, or a combination thereof. In some embodiments, the pathogenic SNP is associated with cystic fibrosis; optionally, the pathogenic SNP is in a CFTR gene; optionally, the pathogenic mutation comprises G551D, W1282*, R553*, R117H, or a combination thereof.
  • the pathogenic SNP is associated with choroideremia; optionally, the pathogenic SNP is in a CHM gene; optionally, the pathogenic mutation comprises R293*, R270*, A117A, or a combination thereof.
  • the pathogenic SNP is associated with Neuronal ceroid lipofuscinosis (NCL); optionally, the pathogenic SNP is in a CLN2 gene; optionally, the pathogenic mutation comprises R208*.
  • the pathogenic SNP is associated with autosomal dominant deafness; optionally, the pathogenic SNP is in a COCH gene; optionally, the pathogenic mutation comprises G88E.
  • the pathogenic SNP is associated with carnitine palmitoyltransferase II deficiency; optionally, the pathogenic SNP is in a CPT2 gene; optionally, the pathogenic mutation comprises S113L.
  • the pathogenic SNP is associated with cystinosis; optionally, the pathogenic SNP is in a CTNS gene; optionally, the pathogenic mutation comprises W138*.
  • the pathogenic SNP is associated with autosomal recessive deafness; optionally, the pathogenic SNP is in a CX30 gene; optionally, the pathogenic mutation comprises T5M.
  • the pathogenic SNP is associated with autosomal recessive deafness; optionally, the pathogenic SNP is in an DFNB59 gene; and optionally, the pathogenic mutation comprises R183W.
  • the pathogenic SNP is associated with isolated agammaglobulinemia; optionally, the pathogenic SNP is in an E47 gene; and optionally, the pathogenic mutation comprises E555K. In some embodiments, the pathogenic SNP is associated with congenital factor XI deficiency; optionally, the pathogenic SNP is in an F11 gene; and optionally, the pathogenic mutation comprises E117*, F283L, or a combination thereof. In some embodiments, the pathogenic SNP is associated with congenital factor V deficiency; optionally, the pathogenic SNP is in an F5 gene; and optionally, the pathogenic mutation comprises R506Q, R534Q, or a combination thereof. In some
  • the pathogenic SNP is associated with congenital factor VII deficiency
  • the pathogenic SNP is in an F7 gene; and optionally, the pathogenic mutation comprises A294V, C310F, R304Q, Q100R, or a combination thereof.
  • the pathogenic SNP is associated with hemophilia A
  • the pathogenic SNP is in an F8 gene; and optionally, the pathogenic mutation comprises R2169H, R1985Q, R2178C, R550C, or a combination thereof.
  • the pathogenic SNP is associated with hemophilia B; optionally, the pathogenic SNP is in an F9 gene; and optionally, the pathogenic mutation comprises T342M, R294Q, R43Q, R191H, G106S, A279T, R75*, R294*, R379Q, or a combination thereof.
  • the pathogenic SNP is associated with tyrosinemia type 1; optionally, the pathogenic SNP is in a FAH gene; and optionally, the pathogenic mutation comprises P261L.
  • the pathogenic SNP is associated with autosomal dominant
  • the pathogenic SNP is in an FGF23 gene; and optionally, the pathogenic mutation comprises R176Q.
  • the pathogenic SNP is associated with von Gierke disease; optionally, the pathogenic SNP is in a G6PC gene; and optionally, the pathogenic mutation comprises Q347*.
  • the pathogenic SNP is associated with Mediterranean G6PD deficiency; optionally, the pathogenic SNP is in a G6PD gene; and optionally, the pathogenic mutation comprises S188D.
  • the pathogenic SNP is associated with Morquio Syndrome (MPSIVA); optionally, the pathogenic SNP is in a GALNS gene; and optionally, the pathogenic mutation comprises R386C.
  • the pathogenic SNP is associated with classic galactosemia; optionally, the pathogenic SNP is in an GALT gene; and optionally, the pathogenic mutation comprises Q188R.
  • the pathogenic SNP is associated with Gaucher disease
  • the pathogenic SNP is in an GBA gene; and optionally, the pathogenic mutation comprises N370S, L444P, or a combination thereof.
  • the pathogenic SNP is associated with glutaryl-CoA dehydrogenase deficiency; optionally, the pathogenic SNP is in a GCDH gene; and optionally, the pathogenic mutation comprises R138G, M263V, R402W, or a combination thereof.
  • the pathogenic SNP is associated with glycine encephalopathy; optionally, the pathogenic SNP is in a GLDC gene; and optionally, the pathogenic mutation comprises A389V, G771R, T269M, or a combination thereof.
  • the pathogenic SNP is associated with cone-rod dystrophy; optionally, the pathogenic SNP is in a GUCY2D gene; and optionally, the pathogenic mutation comprises R838C. In some embodiments, the pathogenic SNP is associated with Sly Syndrome (MPSVII); optionally, the pathogenic SNP is in a GUSB gene; and optionally, the pathogenic mutation comprises L175F.
  • the pathogenic SNP is associated with sickle cell disease
  • the pathogenic SNP is in a HBB gene; and optionally, the pathogenic mutation comprises E26K; E7K; c.-138C>T; IVS2, 654 C>T; or a combination thereof.
  • the pathogenic SNP is associated with intermittent porphyria; optionally, the pathogenic SNP is in a HMBS gene; and optionally, the pathogenic mutation comprises R173W.
  • the pathogenic SNP is associated with Lesch-Nyhan syndrome;
  • the pathogenic SNP is in a HPRT1 gene; and optionally, the pathogenic mutation comprises R51*, R170*, or a combination thereof.
  • the pathogenic SNP is associated with Hunter syndrome; optionally, the pathogenic SNP is in an IDS gene; and optionally, the pathogenic mutation comprises R88C, G374G, or a combination thereof.
  • the pathogenic SNP is associated with Hurler syndrome (MPS1); optionally, the pathogenic SNP is in an IDUA gene; and optionally, the pathogenic mutation comprises Q70*.
  • the pathogenic SNP is associated with retinitis pigmentosa; optionally, the pathogenic SNP is in an IMPDH1 gene; and optionally, the pathogenic mutation comprises D226N.
  • the pathogenic SNP is associated with Andersen– Tawil syndrome; optionally, the pathogenic SNP is in a KCNJ2 gene; and optionally, the pathogenic mutation comprises R218W.
  • the pathogenic SNP is associated with Meesmann epithelial corneal dystrophy; optionally, the pathogenic SNP is in a KRT12 gene; and optionally, the pathogenic mutation comprises L132P.
  • the pathogenic SNP is associated with Parkinson's disease; optionally, the pathogenic SNP is in a LRRK2 gene; and optionally, the pathogenic mutation comprises G2109S.
  • the pathogenic SNP is associated with Rett syndrome; optionally, the pathogenic SNP is in a MECP2 gene; and optionally, the pathogenic mutation comprises R106W, R133C, R306C, R168*, R255*, or a combination thereof.
  • the pathogenic SNP is associated with Sanfilippo syndrome B (MPSIIIB); optionally, the pathogenic SNP is in a NAGLU gene; and optionally, the pathogenic mutation comprises R297*, Y140C, or a combination thereof.
  • the pathogenic SNP is associated with CADASIL syndrome; optionally, the pathogenic SNP is in a NOTCH3 gene; and optionally, the pathogenic mutation comprises R90C, R141C, or a combination thereof.
  • the pathogenic SNP is associated with blue-cone monochromatism; optionally, the pathogenic SNP is in an
  • OPN1LW gene OPN1LW gene; and optionally, the pathogenic mutation comprises C203R.
  • the pathogenic mutation comprises C203R.
  • the pathogenic SNP is associated with phenylketonuria; optionally, the pathogenic SNP is in a PAH gene; and optionally, the pathogenic mutation comprises R408W, I65T, R261Q, IVS10-11G>A, or a combination thereof.
  • the pathogenic SNP is associated with Usher syndrome type 1F; optionally, the pathogenic SNP is in a
  • PCDH15 gene PCDH15 gene; and optionally, the pathogenic mutation comprises R245*.
  • the pathogenic mutation comprises R245*.
  • the pathogenic SNP is associated with retinitis pigmentosa; optionally, the pathogenic SNP is in a PDE6A gene; and optionally, the pathogenic mutation comprises V685M, D670G, or a combination thereof.
  • the pathogenic SNP is associated with Pendred syndrome; optionally, the pathogenic SNP is in a PDS gene; and optionally, the pathogenic mutation comprises L236P; c.1001+1G>A; IVS8, +1 G>A, or a combination thereof.
  • the pathogenic SNP is associated with variegate porphyria; optionally, the pathogenic SNP is in a PPOX gene; and optionally, the pathogenic mutation comprises R59W.
  • the pathogenic SNP is associated with neuronal ceroid lipofuscinosis 1; optionally, the pathogenic SNP is in a PPT1 gene; and optionally, the pathogenic mutation comprises R151*.
  • the pathogenic SNP is associated with Creutzfeldt- Jakob disease (CJD); optionally, the pathogenic SNP is in a PRNP gene; and optionally, the pathogenic mutation comprises M129V, P102L, D178N, or a combination thereof.
  • the pathogenic SNP is associated with retinitis pigmentosa; optionally, the pathogenic SNP is in a PRPF3 gene; and optionally, the pathogenic mutation comprises T494M.
  • the pathogenic SNP is associated with retinitis pigmentosa; optionally, the pathogenic SNP is in a PRPF8 gene; and optionally, the pathogenic mutation comprises H2309R.
  • the pathogenic SNP is associated with hereditary chronic pancreatitis; optionally, the pathogenic SNP is in a PRSS1 gene; and optionally, the pathogenic mutation comprises R122H.
  • the pathogenic SNP is associated with retinitis pigmentosa; optionally, the pathogenic SNP is in a RHO gene; and optionally, the pathogenic mutation comprises P347L, D190N, or a combination thereof.
  • the pathogenic SNP is associated with retinitis pigmentosa; optionally, the pathogenic SNP is in a RP1 gene; and optionally, the pathogenic mutation comprises R667*. In some embodiments, the pathogenic SNP is associated with Leber congenital amaurosis 2;
  • the pathogenic SNP is in a RPE65 gene; and optionally, the pathogenic mutation comprises R44*; IVS1, G-A, +5; or a combination thereof.
  • the pathogenic SNP is associated with Blackfan-Diamond anemia; optionally, the pathogenic SNP is in a RPS19 gene; and optionally, the pathogenic mutation comprises R62Q.
  • the pathogenic SNP is associated with X-linked retinoschisis; optionally, the pathogenic SNP is in a retinoschisin (RS1) gene; and optionally, the pathogenic mutation comprises R102W, R141C, or a combination thereof.
  • the pathogenic SNP is associated with A1AD; optionally, the pathogenic SNP is in a SERPINA1 gene; and optionally, the pathogenic mutation comprises E342K, R48C (R79C), or a
  • the pathogenic SNP is associated with Sanfilippo syndrome A (MPSIIIA); optionally, the pathogenic SNP is in a SGSH gene; and optionally, the pathogenic mutation comprises R74C.
  • the pathogenic SNP is associated with Neimann-Pick disease type A; optionally, the pathogenic SNP is in a SMPD1 gene; and optionally, the pathogenic mutation comprises L302P.
  • the pathogenic SNP is associated with autosomal dominant Parkinson’s disease; optionally, the pathogenic SNP is in a SNCA gene; and optionally, the pathogenic mutation comprises A53T.
  • the pathogenic SNP is associated with familial amyotrophic lateral sclerosis (ALS); optionally, the pathogenic SNP is in a superoxide dismutase 1 (SOD1) gene; and optionally, the pathogenic mutation comprises A4V, H46R, G37R, or a combination thereof.
  • the pathogenic SNP is associated with autosomal dominant deafness; optionally, the pathogenic SNP is in a TECTA gene; and optionally, the pathogenic mutation comprises Y1870C.
  • the pathogenic SNP is associated with autosomal recessive deafness; optionally, the pathogenic SNP is in a TMC1 gene; and optionally, the pathogenic mutation comprises Y182C. In some embodiments, the pathogenic SNP is associated with ATTR amyloidosis; optionally, the pathogenic SNP is in a TTR gene; and optionally, the pathogenic mutation comprises
  • the pathogenic SNP is associated with retinitis pigmentosa/Usher syndrome type 1C; optionally, the pathogenic SNP is in an USH1C gene; and optionally, the pathogenic mutation comprises V72V.
  • the pathogenic SNP is associated with retinitis pigmentosa
  • any of the base editor system or the methods provided herein can further comprise a second guide polynucleotide for editing of an additional nucleobase.
  • the additional nucleobase is not located in the gene.
  • the additional nucleobase is located in the gene.
  • additional nucleobase is located in a protein coding region.
  • the additional nucleobase is located in a protein non-coding region.
  • the protein non-coding region is a gene regulatory element.
  • the deaminase domain is a cytidine deaminase domain or an adenosine deaminase domain.
  • the deaminase domain is a cytidine deaminase domain.
  • the deaminase domain is an adenosine deaminase domain.
  • the adenosine deaminase domain is capable of deaminating adenosine in deoxyribonucleic acid (DNA).
  • the guide polynucleotide comprises ribonucleic acid (RNA), or deoxyribonucleic acid (DNA). In some embodiments, the guide polynucleotide comprises a CRISPR RNA (crRNA) sequence, a trans- activating CRISPR RNA (tracrRNA) sequence, or a combination thereof.
  • crRNA CRISPR RNA
  • tracrRNA trans- activating CRISPR RNA
  • any of the base editor system or the methods provided herein can further comprise a second guide polynucleotide.
  • the second guide polynucleotide comprises ribonucleic acid (RNA), or deoxyribonucleic acid (DNA).
  • the second guide polynucleotide comprises a CRISPR RNA (crRNA) sequence, a trans-activating CRISPR RNA (tracrRNA) sequence, or a combination thereof.
  • the second guide polynucleotide targets the base editor to a second target nucleotide sequence.
  • the polynucleotide-programmable DNA-binding domain comprises a Cas9 domain, a Cpf1 domain, a CasX domain, a CasY domain, a Cas12b/C2c1 domain or a Cas12c/C2c3 domain.
  • the polynucleotide-programmable DNA-binding domain is nuclease dead.
  • the polynucleotide-programmable DNA-binding domain is a nickase.
  • the polynucleotide-programmable DNA-binding domain comprises a Cas9 domain.
  • the Cas9 domain comprises a nuclease dead Cas9 (dCas9), a Cas9 nickase (nCas9), or a nuclease active Cas9. In some embodiments, the Cas9 domain comprises a Cas9 nickase.
  • the polynucleotide-programmable DNA- binding domain is an engineered or a modified polynucleotide-programmable DNA-binding domain.
  • any of the base editor system or the methods provided herein can further comprise a second base editor.
  • the second base editor comprises a different deaminase domain than the base editor.
  • the editing results in less than 20% indel formation. In some embodiments, the editing results in less than 15% indel formation. In some embodiments, the editing results in less than 10% indel formation. In some embodiments, the editing results in less than 5% indel formation. In some embodiments, the editing results in less than 4% indel formation. In some embodiments, the editing results in less than 3% indel formation. In some embodiments, the editing results in less than 2% indel formation.
  • the editing results in less than 1% indel formation. In some embodiments, the editing results in less than 0.5% indel formation. In some embodiments, the editing results in less than 0.1% indel formation. In some embodiments, the editing does not result in translocations.
  • the invention provides a method of editing a G6PC polynucleotide comprising a single nucleotide polymorphism (SNP) associated with glycogen storage disorder Type 1a (GSD1a), the method comprising contacting the G6PC polynucleotide with a base editor in complex with one or more guide polynucleotides, wherein the base editor comprises a polynucleotide programmable DNA binding domain and an adenosine deaminase domain, and wherein one or more of the guide polynucleotides target the base editor to effect an A•T to G•C alteration of the SNP associated with GSD1a.
  • SNP single nucleotide polymorphism
  • the A•T to G•C alteration at the SNP associated with glycogen storage disorder Type 1a changes a glutamine (Q) to a non-glutamine (X) amino acid.
  • the A•T to G•C alteration at the SNP associated with glycogen storage disorder Type 1a changes an arginine (R) to a non-arginine (X) in the G6PC polypeptide.
  • the SNP associated with GSD1a results in expression of an G6PC polypeptide having a non-glutamine (X) amino acid at position 347 or a non-arginine (X) amino acid at position 83.
  • the base editor correction replaces the glutamine at position 347 with a non-glutamine amino acid (X).
  • the base editor correction replaces the arginine at position 83 with a non-arginine amino acid (X).
  • the polynucleotide programmable DNA binding domain is a modified Streptococcus pyogenes Cas9 (SpCas9), or variants thereof.
  • the polynucleotide programmable DNA binding domain comprises a modified SpCas9 having an altered protospacer-adjacent motif (PAM) specificity.
  • the modified SpCas9 has specificity for the nucleic acid sequences 5’-NGA-3’ or 5’-NGG-3’.
  • the adenosine deaminase is ABE7.10.
  • a cell is produced by introducing into the cell, or a progenitor thereof: a base editor, a polynucleotide encoding the base editor, to the cell, wherein the base editor comprises a polynucleotide programmable DNA binding domain and an adenosine deaminase domain; and one or more guide polynucleotides that target the base editor to effect an A•T to G•C alteration of the SNP associated with glycogen storage disorder Type 1a (GSD1a).
  • the cell is a hepatocyte, a hepatocyte precursor, or an iPSc-derived hepatocyte.
  • the cell is from a subject having GSD1a.
  • the cell harbors a Q347X mutation.
  • the A•T to G•C alteration at the SNP associated with GSD1a changes a glutamine to a non-glutamine (X) amino acid.
  • the A•T to G•C alteration at the SNP associated with GSD1a changes an arginine to a non-arginine (X) amino acid in the G6PC polypeptide.
  • the SNP associated with GSD1a results in expression of an G6PC polypeptide having a non-glutamine (X) amino acid at position 347 or a non-arginine (X) amino acid at position 83.
  • the invention provides a method of treating glycogen storage disorder Type 1a (GSD1a) or von Gierke Disease in a subject in need thereof, the method comprising administering to the subject the cell of various embodiments of the above aspects or any other aspect of the invention delineated herein.
  • GSD1a glycogen storage disorder Type 1a
  • von Gierke Disease a glycogen storage disorder Type 1a
  • the method comprising administering to the subject the cell of various embodiments of the above aspects or any other aspect of the invention delineated herein.
  • the invention provides a method of producing a hepatocyte, or progenitor thereof, the method comprising: (a) introducing into an induced pluripotent stem cell or hepatocyte progenitor comprising an SNP associated with GSD1a, a base editor, or a polynucleotide encoding the base editor, wherein the base editor comprises a polynucleotide- programmable nucleotide-binding domain and an adenosine deaminase domain; and one or more guide polynucleotides, wherein the one or more guide polynucleotides target the base editor to effect an A•T to G•C alteration of the SNP associated with GSD1a; and (b) differentiating the induced pluripotent stem cell or hepatocyte progenitor into hepatocyte.
  • the method includes differentiating the induced pluripotent stem cell into a hepatocyte or progenitor
  • the hepatocyte progenitor is obtained from a subject having GSD1a.
  • the hepatocyte or hepatocyte progenitor is a mammalian cell or human cell.
  • the A•T to G•C alteration at the SNP associated with GSD1a changes a glutamine to a non-glutamine (X) amino acid or changes an arginine to a non-arginine (X) amino acid in the G6PC polypeptide.
  • the SNP associated with GSD1a results in expression of an G6PC polypeptide having a non-glutamine (X) amino acid at position 347. In various embodiments, the SNP associated with GSD1a results in expression of an G6PC polypeptide having a non-arginine (X) amino acid at position 83. In various embodiments, the SNP associated with GSD1a substitutes a glutamine with a non-glutamine (X) amino acid. In various embodiments, the SNP associated with GSD1a substitutes an arginine with a non- arginine (X) amino acid. In various embodiments of the above aspects or any other aspect of the invention delineated herein, the cell is selected for the A•T to G•C alteration of the SNP associated with GSD1a.
  • the invention provides a method of editing a IDUA polynucleotide comprising a single nucleotide polymorphism (SNP) associated with mucopolysaccharidosis type 1 (MPS1), the method comprising contacting the IDUA polynucleotide with a base editor in complex with one or more guide polynucleotides, wherein the base editor comprises a polynucleotide programmable DNA binding domain and an adenosine deaminase domain, and wherein one or more of the guide polynucleotides target the base editor to effect an A•T to G•C alteration of the SNP associated with MPS1.
  • the polynucleotide comprises a single nucleotide polymorphism (SNP) associated with mucopolysaccharidosis type 1 (MPS1)
  • the method comprising contacting the IDUA polynucleotide with a base editor in complex with one or more guide polynucleotides, wherein the
  • the programmable DNA binding domain is a modified Streptococcus pyogenes Cas9 (SpCas9), or variants thereof.
  • the polynucleotide programmable DNA binding domain comprises a modified SpCas9 having an altered protospacer-adjacent motif (PAM) specificity.
  • the modified SpCas9 has specificity for the nucleic acid sequence 5’-NGG-3’.
  • the adenosine deaminase is ABE7.10.
  • the guide polynucleotide comprises the human nucleic acid sequence ACTCTaGGCAGAGGTCTCAA AGG.
  • the guide polynucleotide comprises the mouse nucleic acid sequence
  • a cell is produced by introducing into the cell, or a progenitor thereof: a base editor, a polynucleotide encoding the base editor, to the cell, wherein the base editor comprises a polynucleotide programmable DNA binding domain and an adenosine deaminase domain; and one or more guide polynucleotides that target the base editor to effect an A•T to G•C alteration of the SNP associated with mucopolysaccharidosis type 1 (MPS1).
  • the cell is a stem cell, a stem cell precursor, or an induced pluripotent stem cell (iPSC).
  • the cell is from a subject having MPS1.
  • the invention provides a method of treating MPS1 in a subject in need thereof, the method comprising administering to the subject a cell of the above aspects or any other aspect of the invention delineated herein.
  • FIG.1 is schematic diagram comparing a healthy subject and a patient with antitrypsin deficiency (A1AD).
  • A1AT alpha-1 antitrypsin
  • the deficiency of normally functioning A1AT protein leads to lung tissue damage.
  • an accumulation of abnormal A1AT in hepatocytes leads to cirrhosis of the liver.
  • FIG.2 shows typical ranges of serum alpha-1 antitrypsin (A1AT) levels for different genotypes (normal (MM); heterozygous carriers of alpha-1 antitrypsin deficiency (MZ, SZ); and homozygous deficiency (SS, ZZ)).
  • Serum alpha-1 antitrypsin (AAT) concentration is expressed in ⁇ M in the left“y” axis, which is common in the literature.
  • the right“y” axis shows an approximate conversion of serum AAT concentration into mg/dL units, as commonly reported by clinical laboratories and by different measurement technologies (nephelometry or radial immunodiffusion)
  • FIGS.3A-3C present a base editing target sequence, and graphs related to precise corrections of pathogenic mutations in the SERPINA1 gene which encodes the A1AT protein.
  • FIG.3A shows a precise correction base editing strategy for a mutation in the SERPINA1 gene which encodes A1AT.
  • A7 (“Target A”) can be edited to restore wild-type (WT) phenotype.
  • “A” nucleobases A5/A7 can be edited to introduce amino acid D341G into the A1AT protein.
  • A7/A8 can be edited to introduce amino acid E342G into the A1AT protein.
  • FIG.3B provides a nucleic acid sequence showing the position of target A nucleobases within the SERPINA1 gene and the encoded amino acids, as well as a graph showing levels of A1AT (ng/ml) secreted from HEK293T cells that express wild-type (WT), or A1AT variants containing E342K, D341G, or E342G.
  • FIG.3C is a graph showing elastase activity in wild-type (WT) A1AT protein versus that in A1AT variants containing E342K or D341G.
  • FIG.4 is a schematic diagram showing a strategy to evolve a DNA deoxyadenosine deaminase starting from TadA tRNA deaminase. Shown are a library of E. coli harboring a plasmid library of mutant ecTadA (TadA*) genes fused to dCas9 and a selection plasmid requiring targeted A•T to G•C mutations to repair antibiotic resistance genes. Mutations from surviving TadA* variants were imported into an ABE architecture for base editing in human cells.
  • TadA* mutant ecTadA
  • FIG.5 provides a nucleic acid sequence showing the position of target“A”
  • nucleobases within the SERPINA1 gene and the encoded amino acids as well as a graph showing percent editing at positions A5 or A7 in the SERPINA1 gene as a function of guide RNA length.
  • FIGS.6A and 6B depict a library of SpCas9 mutants that were generated to enrich for mutations within the PAM-interacting (PI) domain of Cas9. This library can be screened for SpCas9s having altered PAM specificities.
  • FIG.7 is a schematic diagram showing a strategy for the correction of the Q347X mutation using a base editor to convert A>G at the targeted site (highlighted) using NGG and NGA PAM recognition sequences. A precise correction would yield the coversion TAG > CAG (stop codon > Glutamine).
  • FIGS.8A and 8B provide a transfection schedule based on the maturation cycle for GSD1a iPSc-derived hepatocytes.
  • FIG.8A provides a timeline of the transfection schedule showing representative time points for plating, transfection, and cell harvest.
  • FIG.8B shows images of maturing GSD1a iPSc-derived hepatocytes on Day 5 and Day 7.
  • FIGS.9A and 9B provide data showing base editing precise correction of G6PC Q347X for GSD1a.
  • FIG.9A provides nucleic acid sequences showing the positions of on target and bystander“A” nucleobases within the G6PC gene and corresponding NGG and NGA PAM sequences, as well as a graph showing the percentage of base editing efficiency of G6PC Q347X in HEK293T cells for ABE-On target, ABE-Bystander, Indels, and Nuclease-Indels using either NGA PAM or NGG PAM.
  • FIG.9B provides a graph showing the base editing efficiency in G6PC Q347X in patient iPSc-derived hepatocytes for ABE-On target, ABE-Bystander, Indels, and Nuclease-Indels using either NGA PAM or NGG PAM.
  • the solid line denotes mean of experiments.
  • FIG.10 provides a nucleic acid sequence showing the positions of on target and bystander“A” nucleobases within the G6PC gene and corresponding GGA PAM sequence, as well as a graph showing the percent of A>G base editing of G6PC Q347X in patient iPSc- derived hepatocyes for ABE-On target, ABE-Bystander, and Indel using mRNA variants.
  • FIG.11 provides a graph showing the percent of base editing efficiency in the mouse and human IDUA gene using an ABE7.10 base editor. DETAILED DESCRIPTION OF THE DISCLOSURE
  • the words“comprising” (and any form of comprising, such as“comprise” and“comprises”),“having” (and any form of having, such as “have” and“has”),“including” (and any form of including, such as“includes” and“include”) or “containing” (and any form of containing, such as“contains” and“contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. It is
  • compositions of the present disclosure can be used to achieve methods of the present disclosure.
  • the term“about” or“approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system.
  • “about” can mean within 1 or more than 1 standard deviation, per the practice in the art.
  • “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value.
  • the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2- fold, of a value.
  • adenosine deaminase is meant a polypeptide or fragment thereof capable of catalyzing the hydrolytic deamination of adenine or adenosine.
  • the deaminase or deaminase domain is an adenosine deaminase catalyzing the hydrolytic deamination of adenosine to inosine or deoxy adenosine to deoxyinosine.
  • the adenosine deaminase catalyzes the hydrolytic deamination of adenine or adenosine in deoxyribonucleic acid (DNA).
  • the adenosine deaminases e.g. engineered adenosine deaminases, evolved adenosine deaminases
  • the adenosine deaminases may be from any organism, such as a bacterium.
  • agent is meant any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof.
  • ameliorate is meant decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease.
  • alteration is meant a change (increase or decrease) in the expression levels or activity of a gene or polypeptide as detected by standard art known methods such as those described herein.
  • an alteration includes a 10% change in expression levels, preferably a 25% change, more preferably a 40% change, and most preferably a 50% or greater change in expression levels.
  • analog is meant a molecule that is not identical, but has analogous functional or structural features.
  • a polypeptide analog retains the biological activity of a corresponding naturally-occurring polypeptide, while having certain biochemical modifications that enhance the analog's function relative to a naturally occurring polypeptide. Such biochemical modifications could increase the analog's protease resistance, membrane permeability, or half-life, without altering, for example, ligand binding.
  • An analog may include an unnatural amino acid.
  • composition administration is referred to herein as providing one or more compositions described herein to a patient or a subject.
  • composition administration e.g., injection
  • s.c. sub-cutaneous injection
  • i.d. intradermal
  • i.p. intraperitoneal
  • intramuscular injection intramuscular injection.
  • Parenteral administration can be, for example, by bolus injection or by gradual perfusion over time.
  • administration can be by an oral route.
  • alpha-1 antitrypsin (A1AT) protein is meant a polypeptide or fragment thereof having at least about 95% amino acid sequence identity to the amino acid sequence of UniProt Accession No. P01009.
  • an A1AT protein comprises one or more alterations relative to the following reference sequence.
  • an A1AT protein associated with A1AD comprises an E342K mutation.
  • An exemplary A1AT amino acid sequence (>sp
  • base editor or “nucleobase editor (NBE)” is meant an agent that binds a polynucleotide and has nucleobase modifying activity.
  • the base editor comprises a nucleobase modifying polypeptide (e.g., a deaminase) and a polynucleotide programmable nucleotide binding domain in conjunction with a guide polynucleotide (e.g., guide RNA).
  • a nucleobase modifying polypeptide e.g., a deaminase
  • a guide polynucleotide e.g., guide RNA
  • the agent is a biomolecular complex comprising a protein domain having base editing activity, i.e., a domain capable of modifying a base (e.g., A, T, C, G, or U) within a nucleic acid molecule (e.g., DNA).
  • a protein domain having base editing activity i.e., a domain capable of modifying a base (e.g., A, T, C, G, or U) within a nucleic acid molecule (e.g., DNA).
  • the polynucleotide programmable DNA binding domain is fused or linked to a deaminase domain.
  • the agent is a fusion protein comprising a domain having base editing activity.
  • the protein domain having base editing activity is linked to the guide RNA (e.g., via an RNA binding motif on the guide RNA and an RNA binding domain fused to the deaminase).
  • the domain having base editing activity is capable of deaminating a base within a nucleic acid molecule.
  • the base editor is capable of deaminating a base within a DNA molecule.
  • the base editor is capable of deaminating a cytosine (C) or an adenosine (A) within DNA.
  • the base editor is a cytidine base editor (CBE).
  • the base editor is an adenosine base editor (ABE).
  • an adenosine deaminase is evolved from TadA.
  • the polynucleotide programmable DNA binding domain is a CRISPR associated (e.g., Cas or Cpf1) enzyme.
  • the base editor is a catalytically dead Cas9 (dCas9) fused to a deaminase domain.
  • the base editor is a Cas9 nickase (nCas9) fused to a deaminase domain.
  • the base editor is fused to an inhibitor of base excision repair (BER).
  • the inhibitor of base excision repair is a uracil DNA glycosylase inhibitor (UGI).
  • the inhibitor of base excision repair is an inosine base excision repair inhibitor.
  • the cytidine base editor CBE as used in the base editing compositions, systems and methods described herein has the following nucleic acid sequence (8877 base pairs), (Addgene, Watertown, MA.; Komor AC, et al., 2017, Sci Adv.,
  • the BE4 nucleic acid sequence is selected from one of the following:
  • base editing activity is meant acting to chemically alter a base within a polynucleotide.
  • a first base is converted to a second base.
  • the base editing activity is cytidine deaminase activity, e.g., converting target C•G to T•A.
  • the base editing activity is adenosine or adenine deaminase activity, e.g., converting A•T to G•C.
  • the term“base editor system” refers to a system for editing a nucleobase of a target nucleotide sequence.
  • the base editor (BE) system comprises (1) a polynucleotide programmable nucleotide binding domain and a deaminase domain for deaminating said nucleobase; and (2) a guide polynucleotide (e.g., guide RNA) in conjunction with the polynucleotide programmable nucleotide binding domain.
  • the base editor system comprises (1) a base editor (BE) comprising a polynucleotide programmable DNA binding domain and a deaminase domain for deaminating said nucleobase; and (2) a guide RNA in conjunction with the polynucleotide programmable DNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain.
  • the base editor is a cytidine base editor (CBE).
  • the base editor is an adenine or adenosine base editor (ABE).
  • “conservative amino acid substitution” or“conservative mutation” refers to the replacement of one amino acid by another amino acid with a common property.
  • a functional way to define common properties between individual amino acids is to analyze the normalized frequencies of amino acid changes between corresponding proteins of homologous organisms (Schulz, G. E. and Schirmer, R. H., Principles of Protein Structure, Springer-Verlag, New York (1979)). According to such analyses, groups of amino acids can be defined where amino acids within a group exchange preferentially with each other, and therefore resemble each other most in their impact on the overall protein structure (Schulz, G. E. and Schirmer, R. H., supra).
  • Non-limiting examples of conservative mutations include amino acid substitutions of amino acids, for example, lysine for arginine and vice versa such that a positive charge can be maintained; glutamic acid for aspartic acid and vice versa such that a negative charge can be maintained; serine for threonine such that a free–OH can be maintained; and glutamine for asparagine such that a free–NH 2 can be maintained.
  • coding sequence or“protein coding sequence” as used interchangeably herein refers to a segment of a polynucleotide that codes for a protein. The region or sequence is bounded nearer the 5’ end by a start codon and nearer the 3’ end with a stop codon. Coding sequences can also be referred to as open reading frames.
  • cytidine deaminase is meant a polypeptide or fragment thereof capable of catalyzing a deamination reaction that converts an amino group to a carbonyl group.
  • the cytidine deaminase converts cytosine to uracil or 5-methylcytosine to thymine.
  • PmCDA1 which is derived from Petromyzon marinus (Petromyzon marinus cytosine deaminase 1,“PmCDA1”)
  • AID Activation-induced cytidine deaminase; AICDA
  • AICDA Activation-induced cytidine deaminases
  • deaminase or“deaminase domain,” as used herein, refers to a protein or enzyme that catalyzes a deamination reaction.
  • the deaminase or deaminase domain is a cytidine deaminase, catalyzing the hydrolytic deamination of cytidine or deoxycytidine to uridine or deoxyuridine, respectively.
  • the deaminase or deaminase domain is a cytosine deaminase, catalyzing the hydrolytic deamination of cytosine to uracil.
  • the deaminase is an adenosine deaminase, which catalyzes the hydrolytic deamination of adenine to hypoxanthine.
  • the deaminase is an adenosine deaminase, which catalyzes the hydrolytic deamination of adenosine or adenine (A) to inosine (I).
  • the deaminase or deaminase domain is an adenosine deaminase, catalyzing the hydrolytic deamination of adenosine or deoxyadenosine to inosine or deoxyinosine, respectively.
  • the adenosine deaminase catalyzes the hydrolytic deamination of adenosine in deoxyribonucleic acid (DNA).
  • the adenosine deaminases e.g. engineered adenosine deaminases, evolved adenosine deaminases
  • the adenosine deaminases can be from any organism, such as a bacterium.
  • the adenosine deaminase is from a bacterium, such as E. coli, S. aureus, S. typhi, S. putrefaciens, H. influenzae, or C. crescentus.
  • the adenosine deaminase is a TadA deaminase.
  • the deaminase or deaminase domain is a variant of a naturally occurring deaminase from an organism, such as a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse. In some embodiments, the deaminase or deaminase domain does not occur in nature.
  • the deaminase or deaminase domain is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% identical to a naturally occurring deaminase.
  • deaminase domains are described in International PCT Application Nos. PCT/2017/045381 (WO2018/027078) and PCT/US2016/058344
  • detectable label is meant a composition that when linked to a molecule of interest renders the latter detectable, via spectroscopic, photochemical, biochemical, immunochemical, or chemical means.
  • useful labels include radioactive isotopes, magnetic beads, metallic beads, colloidal particles, fluorescent dyes, electron-dense reagents, enzymes (for example, as commonly used in an ELISA), biotin, digoxigenin, or haptens.
  • disease is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
  • diseases include retinitis pigmentosa, Usher syndrome, sickle cell disease, beta-thalassemia, alpha-1 antitrypsin deficiency (A1AD), hepatic porphyria, medium-chain acyl-CoA dehydrogenase (MCAD) deficiency, lysosomal acid lipase (LAL) deficiency, phenylketonuria, hemochromatosis, Von Gierke disease, Pompe disease, Gaucher disease, Hurler syndrome, cystic fibrosis, or chronic pain.
  • the disease is A1AD.
  • an “effective amount” is meant the amount of an agent or active compound, e.g., a base editor as described herein, that is required to ameliorate the symptoms of a disease relative to an untreated patient or an individual without disease, i.e., a healthy individual.
  • the effective amount of active compound(s) used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an“effective” amount.
  • an effective amount is the amount of a base editor of the invention sufficient to introduce an alteration in a gene of interest in a cell (e.g., a cell in vitro or in vivo).
  • an effective amount is the amount of a base editor required to achieve a therapeutic effect (e.g., to reduce or control retinitis pigmentosa, Usher syndrome, sickle cell disease, beta-thalassemia, alpha-1 antitrypsin deficiency (A1AD), hepatic porphyria, medium- chain acyl-CoA dehydrogenase (MCAD) deficiency, lysosomal acid lipase (LAL) deficiency, phenylketonuria, hemochromatosis, Von Gierke disease, Pompe disease, Gaucher disease, Hurler syndrome, cystic fibrosis, or chronic pain, or a symptom or condition thereof).
  • retinitis pigmentosa e.g., Usher syndrome, sickle cell disease, beta
  • Such therapeutic effect need not be sufficient to alter a pathogenic gene in all cells of a subject, tissue or organ, but only to alter the pathogenic gene in about 1%, 5%, 10%, 25%, 50%, 75% or more of the cells present in a subject, tissue or organ.
  • an effective amount is sufficient to ameliorate one or more symptoms of a disease (e.g., retinitis pigmentosa, Usher syndrome, sickle cell disease, beta-thalassemia, alpha-1 antitrypsin deficiency (A1AD), hepatic porphyria, medium-chain acyl-CoA dehydrogenase (MCAD) deficiency, lysosomal acid lipase (LAL) deficiency, phenylketonuria, hemochromatosis, Von Gierke disease, Pompe disease, Gaucher disease, Hurler syndrome, cystic fibrosis, or chronic pain).
  • a disease e.g., retinitis pigmentosa, Usher syndrome, sickle cell disease, beta-thalassemia, alpha-1 antitrypsin deficiency (A1AD), hepatic porphyria, medium-chain acyl-CoA dehydrogenase (MCAD) deficiency, lyso
  • fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, preferably, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide.
  • a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
  • Hybridization means hydrogen bonding, which may be Watson-Crick, Hoogsteen or reversed Hoogsteen hydrogen bonding, between complementary nucleobases.
  • adenine and thymine are complementary nucleobases that pair through the formation of hydrogen bonds.
  • the terms“inhibitor of base repair”,“base repair inhibitor”,“IBR” or their grammatical equivalents refer to a protein that is capable in inhibiting the activity of a nucleic acid repair enzyme, for example a base excision repair enzyme.
  • the IBR is an inhibitor of inosine base excision repair.
  • Exemplary inhibitors of base repair include inhibitors of APE1, Endo III, Endo IV, Endo V, Endo VIII, Fpg, hOGGl, hNEILl, T7 Endol, T4PDG, UDG, hSMUGl, and hAAG.
  • the base repair inhibitor is an inhibitor of Endo V or hAAG.
  • the IBR is an inhibitor of Endo V or hAAG.
  • the IBR is a catalytically inactive EndoV or a catalytically inactive hAAG.
  • the base repair inhibitor is a catalytically inactive EndoV or a catalytically inactive hAAG.
  • the base repair inhibitor is uracil glycosylase inhibitor (UGI).
  • UGI refers to a protein that is capable of inhibiting a uracil-DNA glycosylase base- excision repair enzyme.
  • a UGI domain comprises a wild-type UGI or a fragment of a wild-type UGI.
  • the UGI proteins provided herein include fragments of UGI and proteins homologous to a UGI or a UGI fragment.
  • the base repair inhibitor is an inhibitor of inosine base excision repair.
  • the base repair inhibitor is a“catalytically inactive inosine specific nuclease” or“dead inosine specific nuclease.”
  • catalytically inactive inosine glycosylases e.g., alkyl adenine glycosylase (AAG)
  • AAG alkyl adenine glycosylase
  • the catalytically inactive inosine specific nuclease can be capable of binding an inosine in a nucleic acid but does not cleave the nucleic acid.
  • Non-limiting exemplary catalytically inactive inosine specific nucleases include catalytically inactive alkyl adenosine glycosylase (AAG nuclease), for example, from a human, and catalytically inactive endonuclease V (EndoV nuclease), for example, from E. coli.
  • AAG nuclease catalytically inactive alkyl adenosine glycosylase
  • EndoV nuclease catalytically inactive endonuclease V
  • the catalytically inactive AAG nuclease comprises an E125Q mutation or a corresponding mutation in another AAG nuclease.
  • the terms“isolated,”“purified,” or“biologically pure” refer to material that is free to varying degrees from components which normally accompany it as found in its native state. “Isolate” denotes a degree of separation from original source or surroundings.“Purify” denotes a degree of separation that is higher than isolation. A“purified” or“biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
  • Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high-performance liquid chromatography.
  • the term“purified” can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel.
  • modifications for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
  • isolated polynucleotide is meant a nucleic acid (e.g., a DNA) that is free of the genes which, in the naturally-occurring genome of the organism from which the nucleic acid molecule of the invention is derived, flank the gene.
  • the term therefore includes, for example, a recombinant DNA that is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote; or that exists as a separate molecule (for example, a cDNA or a genomic or cDNA fragment produced by PCR or restriction endonuclease digestion) independent of other sequences.
  • the term includes an RNA molecule that is transcribed from a DNA molecule, as well as a recombinant DNA that is part of a hybrid gene encoding additional polypeptide sequence.
  • an“isolated polypeptide” is meant a polypeptide of the invention that has been separated from components that naturally accompany it.
  • the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
  • the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention.
  • An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
  • linker can refer to a covalent linker (e.g., covalent bond), a non-covalent linker, a chemical group, or a molecule linking two molecules or moieties, e.g., two components of a protein complex or a ribonucleocomplex, or two domains of a fusion protein, such as, for example, a polynucleotide programmable DNA binding domain (e.g., dCas9) and a deaminase domain (e.g., an adenosine deaminase or a cytidine deaminase).
  • a linker can join different components of, or different portions of components of, a base editor system.
  • a linker can join a guide polynucleotide binding domain of a polynucleotide programmable nucleotide binding domain and a catalytic domain of a deaminase.
  • a linker can join a CRISPR polypeptide and a deaminase.
  • a linker can join a Cas9 and a deaminase.
  • a linker can join a dCas9 and a deaminase.
  • a linker can join a nCas9 and a deaminase. In some embodiments, a linker can join a guide polynucleotide and a deaminase. In some embodiments, a linker can join a deaminating component and a polynucleotide programmable nucleotide binding component of a base editor system. In some embodiments, a linker can join a RNA-binding portion of a deaminating component and a polynucleotide programmable nucleotide binding component of a base editor system.
  • a linker can join a RNA-binding portion of a deaminating component and a RNA-binding portion of a polynucleotide programmable nucleotide binding component of a base editor system.
  • a linker can be positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond or non-covalent interaction, thus connecting the two.
  • the linker can be an organic molecule, group, polymer, or chemical moiety.
  • the linker can be a polynucleotide.
  • the linker can be a DNA linker.
  • the linker can be a RNA linker.
  • a linker can comprise an aptamer capable of binding to a ligand.
  • the ligand may be carbohydrate, a peptide, a protein, or a nucleic acid.
  • the linker may comprise an aptamer may be derived from a riboswitch.
  • the riboswitch from which the aptamer is derived may be selected from a theophylline riboswitch, a thiamine pyrophosphate (TPP) riboswitch, an adenosine cobalamin (AdoCbl) riboswitch, an S- adenosyl methionine (SAM) riboswitch, an SAH riboswitch, a flavin mononucleotide (FMN) riboswitch, a tetrahydrofolate riboswitch, a lysine riboswitch, a glycine riboswitch, a purine riboswitch, a GlmS riboswitch, or a pre-queosine1 (PreQ1) riboswitch.
  • TPP thiamine pyrophosphate
  • AdoCbl adenosine cobalamin
  • a linker may comprise an aptamer bound to a polypeptide or a protein domain, such as a polypeptide ligand.
  • the polypeptide ligand may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a sterile alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or a RNA recognition motif.
  • the polypeptide ligand may be a portion of a base editor system component.
  • a nucleobase editing component may comprise a deaminase domain and a RNA recognition motif.
  • the linker can be an amino acid or a plurality of amino acids (e.g., a peptide or protein).
  • the linker can be about 5-100 amino acids in length, for example, about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, or 90-100 amino acids in length.
  • the linker can be about 100-150, 150-200, 200-250, 250-300, 300-350, 350-400, 400-450, or 450- 500 amino acids in length. Longer or shorter linkers can be also contemplated.
  • a linker joins a gRNA binding domain of an RNA- programmable nuclease, including a Cas9 nuclease domain, and the catalytic domain of a nucleic-acid editing protein (e.g., cytidine or adenosine deaminase).
  • a linker joins a dCas9 and a nucleic-acid editing protein.
  • the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two.
  • the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein).
  • the linker is an organic molecule, group, polymer, or chemical moiety.
  • the linker is 5- 200 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 35, 45, 50, 55, 60, 60, 65, 70, 70, 75, 80, 85, 90, 90, 95, 100, 101, 102, 103, 104, 105, 110, 120, 130, 140, 150, 160, 175, 180, 190, or 200 amino acids in length. Longer or shorter linkers are also contemplated.
  • a linker comprises the amino acid sequence SGSETPGTSESATPES, which may also be referred to as the XTEN linker.
  • a linker comprises the amino acid sequence SGGS.
  • a linker comprises (SGGS) n , (GGGS) n , (GGGGS) n , (G) n, (EAAAK) n , (GGS) n ,
  • SGSETPGTSESATPES or (XP) n motif, or a combination of any of these, where n is independently an integer between 1 and 30, and where X is any amino acid.
  • n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15.
  • a linker comprises a plurality of proline residues and is 5-21, 5-14, 5-9, 5-7 amino acids in length, e.g., PAPAP, PAPAPA, PAPAPAP, PAPAPAPA, P(AP) 4 , P(AP) 7 , P(AP) 10 .
  • proline-rich linkers are also termed“rigid” linkers.
  • the domains of a base editor are fused via a linker that comprises the amino acid sequence of SGGSSGSETPGTSESATPESSGGS,
  • domains of the base editor are fused via a linker comprising the amino acid sequence
  • the linker is 24 amino acids in length. In some embodiments, the linker comprises the amino acid sequence SGGSSGGSSGSETPGTSESATPES. In some
  • the linker is 40 amino acids in length. In some embodiments, the linker comprises the amino acid sequence
  • the linker is 64 amino acids in length. In some embodiments, the linker comprises the amino acid sequence
  • the linker is 92 amino acids in length. In some embodiments, the linker comprises the amino acid sequence PGSPAGSPTSTEEGTSESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSTEPSEGSAP GTSTEPSEGSAPGTSESATPESGPGSEPATS.
  • mutation refers to a substitution of a residue within a sequence, e.g., a nucleic acid or amino acid sequence, with another residue, or a deletion or insertion of one or more residues within a sequence. Mutations are typically described herein by identifying the original residue followed by the position of the residue within the sequence and by the identity of the newly substituted residue. Various methods for making the amino acid substitutions (mutations) provided herein are well known in the art, and are provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)).
  • an intended mutation such as a point mutation
  • a nucleic acid e.g., a nucleic acid within a genome of a subject
  • an intended mutation is a mutation that is generated by a specific base editor (e.g., cytidine base editor or adenosine base editor) bound to a guide polynucleotide (e.g., gRNA), specifically designed to generate the intended mutation.
  • a specific base editor e.g., cytidine base editor or adenosine base editor
  • a guide polynucleotide e.g., gRNA
  • mutations made or identified in a sequence are numbered in relation to a reference (or wild type) sequence, i.e., a sequence that does not contain the mutations.
  • a reference sequence i.e., a sequence that does not contain the mutations.
  • the skilled practitioner in the art would readily understand how to determine the position of mutations in amino acid and nucleic acid sequences relative to a reference sequence.
  • non-conservative mutations involve amino acid substitutions between different groups, for example, lysine for tryptophan, or phenylalanine for serine, etc. In this case, it is preferable for the non-conservative amino acid substitution to not interfere with, or inhibit the biological activity of, the functional variant.
  • the non-conservative amino acid substitution can enhance the biological activity of the functional variant, such that the biological activity of the functional variant is increased as compared to the wild-type protein.
  • nuclear localization sequence refers to an amino acid sequence that promotes import of a protein into the cell nucleus.
  • Nuclear localization sequences are known in the art and described, for example, in Plank et al.,
  • an NLS comprises the amino acid sequence KRTADGSEFESPKKKRKV, KRPAATKKAGQAKKKK, KKTELQTTNAENKTKKL, KRGINDRNFWRGENGRKTR, RKSGKIAAIVVKRPRK, PKKKRKV, or
  • nucleobase refers to a nitrogen-containing biological compound that forms a nucleoside, which in turn is a component of a nucleotide.
  • RNA ribonucleic acid
  • DNA deoxyribonucleic acid
  • nucleobases adenine (A), cytosine (C), guanine (G), thymine (T), and uracil (U)– are called primary or canonical.
  • Adenine and guanine are derived from purine, and cytosine, uracil, and thymine are derived from pyrimidine.
  • DNA and RNA can also contain other (non-primary) bases that are modified.
  • Non-limiting exemplary modified nucleobases can include hypoxanthine, xanthine, 7-methylguanine, 5,6-dihydrouracil, 5- methylcytosine (m5C), and 5-hydromethylcytosine.
  • Hypoxanthine and xanthine can be created through mutagen presence, both of them through deamination (replacement of the amine group with a carbonyl group). Hypoxanthine can be modified from adenine.
  • Xanthine can be modified from guanine. Uracil can result from deamination of cytosine.
  • A“nucleoside” consists of a nucleobase and a five carbon sugar (either ribose or deoxyribose). Examples of a nucleoside include adenosine, guanosine, uridine, cytidine, 5-methyluridine (m5U),
  • nucleoside with a modified nucleobase examples include inosine (I), xanthosine (X), 7-methylguanosine (m7G), dihydrouridine (D), 5-methylcytidine (m5C), and pseudouridine (Y).
  • A“nucleotide” consists of a nucleobase, a five carbon sugar (either ribose or deoxyribose), and at least one phosphate group.
  • nucleic acid and“nucleic acid molecule,” as used herein, refer to a compound comprising a nucleobase and an acidic moiety, e.g., a nucleoside, a nucleotide, or a polymer of nucleotides.
  • polymeric nucleic acids e.g., nucleic acid molecules comprising three or more nucleotides are linear molecules, in which adjacent nucleotides are linked to each other via a phosphodiester linkage.
  • “nucleic acid” refers to individual nucleic acid residues (e.g. nucleotides and/or nucleosides).
  • nucleic acid refers to an oligonucleotide chain comprising three or more individual nucleotide residues.
  • the terms“oligonucleotide”,“polynucleotide”, and“polynucleic acid” can be used interchangeably to refer to a polymer of nucleotides (e.g., a string of at least three nucleotides).
  • “nucleic acid” encompasses RNA as well as single and/or double-stranded DNA.
  • Nucleic acids can be naturally occurring, for example, in the context of a genome, a transcript, mRNA, tRNA, rRNA, siRNA, snRNA, a plasmid, cosmid, chromosome, chromatid, or other naturally occurring nucleic acid molecules.
  • a nucleic acid molecule can be a non-naturally occurring molecule, e.g., a recombinant DNA or RNA, an artificial chromosome, an engineered genome, or fragment thereof, or a synthetic DNA, RNA, DNA/RNA hybrid, or including non-naturally occurring nucleotides or nucleosides.
  • nucleic acid examples include nucleic acid analogs, e.g., analogs having other than a phosphodiester backbone.
  • Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, and backbone modifications. A nucleic acid sequence is presented in the 5’ to 3’ direction unless otherwise indicated.
  • a nucleic acid is or comprises natural nucleosides (e.g.
  • nucleoside analogs e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolopyrimidine, 3-methyl adenosine, 5- methylcytidine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5- propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7- deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, O 6 -methylguanine, and 2- thiocy
  • nucleic acid programmable DNA binding protein or "napDNAbp” may be used interchangably with“polynucleotide programmable nucleotide binding domain” to refer to a protein that associates with a nucleic acid (e.g., DNA or RNA), such as a guide nucleic acid, that guides the napDNAbp to a specific nucleic acid sequence.
  • a Cas9 protein can associate with a guide RNA that guides the Cas9 protein to a specific DNA sequence that is complementary to the guide RNA.
  • the napDNAbp is a Cas9 domain, for example a nuclease active Cas9, a Cas9 nickase (nCas9), or a nuclease inactive Cas9 (dCas9).
  • nucleic acid programmable DNA binding proteins include, without limitation, Cas9 (e.g., dCas9 and nCas9), Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, and Cas12i.
  • nucleic acid programmable DNA binding proteins are also within the scope of this disclosure, although they may not be specifically listed in this disclosure. See, e.g., Makarova et al.“Classification and Nomenclature of CRISPR-Cas Systems: Where from Here?” CRISPR J.2018 Oct;1:325-336. doi: 10.1089/crispr.2018.0033; Yan et al.,“Functionally diverse type V CRISPR-Cas systems” Science.2019 Jan 4;363(6422):88-91. doi: 10.1126/science.aav7271, the entire contents of each are hereby incorporated by reference.
  • nucleobase editing domain or“nucleobase editing protein”, as used herein, refers to a protein or enzyme that can catalyze a nucleobase modification in RNA or DNA, such as cytosine (or cytidine) to uracil (or uridine) or thymine (or thymidine), and adenine (or adenosine) to hypoxanthine (or inosine) deaminations, as well as non-templated nucleotide additions and insertions.
  • cytosine or cytidine
  • uracil or uridine
  • thymine or thymidine
  • adenine or adenosine
  • hypoxanthine or inosine
  • the nucleobase editing domain is a deaminase domain (e.g., a cytidine deaminase, a cytosine deaminase, an adenine deaminase, or an adenosine deaminase).
  • the nucleobase editing domain can be a naturally occurring nucleobase editing domain.
  • the nucleobase editing domain can be an engineered or evolved nucleobase editing domain from the naturally occurring nucleobase editing domain.
  • the nucleobase editing domain can be from any organism, such as a bacterium, human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse.
  • nucleobase editing proteins are described in International PCT Application Nos. PCT/2017/045381
  • “obtaining” as in“obtaining an agent” includes synthesizing, purchasing, or otherwise acquiring the agent.
  • A“patient” or“subject” as used herein refers to a mammalian subject or individual diagnosed with, at risk of having or develping, or suspected of having or developing a disease or a disorder.
  • the term“patient” refers to a mammalian subject with a higher than average likelihood of developing a disease or a disorder.
  • Exemplary patients can be humans, non-human primates, cats, dogs, pigs, cattle, cats, horses, camels, llamas, goats, sheep, rodents (e.g., mice, rabbits, rats, or guinea pigs) and other mammalians that can benefit from the therapies disclosed herein.
  • Exemplary human patients can be male and/or female.
  • “Patient in need thereof” or“subject in need thereof” is referred to herein as a patient diagnosed with or suspected of having a disease or disorder, for instance, but not restricted to alpha-1 antitrypsin deficiency (A1AD).
  • the terms“pathogenic mutation”,“pathogenic variant”,“disease casing mutation”, “disease causing variant”,“deleterious mutation”, or“predisposing mutation” refers to a genetic alteration or mutation that increases an individual’s susceptibility or predisposition to a certain disease or disorder.
  • the pathogenic mutation comprises at least one wild- type amino acid substituted by at least one pathogenic amino acid in a protein encoded by a gene.
  • the terms“protein”,“peptide”,“polypeptide”, and their grammatical equivalents are used interchangeably herein, and refer to a polymer of amino acid residues linked together by peptide (amide) bonds.
  • the terms refer to a protein, peptide, or polypeptide of any size, structure, or function. Typically, a protein, peptide, or polypeptide will be at least three amino acids long.
  • a protein, peptide, or polypeptide can refer to an individual protein or a collection of proteins.
  • One or more of the amino acids in a protein, peptide, or polypeptide can be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modifications, etc.
  • a protein, peptide, or polypeptide can also be a single molecule or can be a multi-molecular complex.
  • a protein, peptide, or polypeptide can be just a fragment of a naturally occurring protein or peptide.
  • a protein, peptide, or polypeptide can be naturally occurring, recombinant, or synthetic, or any combination thereof.
  • fusion protein refers to a hybrid polypeptide which comprises protein domains from at least two different proteins.
  • One protein can be located at the amino-terminal (N-terminal) portion of the fusion protein or at the carboxy- terminal (C-terminal) protein thus forming an amino-terminal fusion protein or a carboxy- terminal fusion protein, respectively.
  • a protein can comprise different domains, for example, a nucleic acid binding domain (e.g., the gRNA binding domain of Cas9 that directs the binding of the protein to a target site) and a nucleic acid cleavage domain, or a catalytic domain of a nucleic acid editing protein.
  • a protein comprises a proteinaceous part, e.g., an amino acid sequence constituting a nucleic acid binding domain, and an organic compound, e.g., a compound that can act as a nucleic acid cleavage agent.
  • a protein is in a complex with, or is in association with, a nucleic acid, e.g., RNA or DNA.
  • Any of the proteins provided herein can be produced by any method known in the art.
  • the proteins provided herein can be produced via recombinant protein expression and purification, which is especially suited for fusion proteins comprising a peptide linker.
  • Polypeptides and proteins disclosed herein can comprise synthetic amino acids in place of one or more naturally-occurring amino acids.
  • synthetic amino acids are known in the art, and include, for example, aminocyclohexane carboxylic acid, norleucine, a-amino n-decanoic acid, homoserine, S-acetylaminomethyl-cysteine, trans-3- and trans-4-hydroxyproline, 4- aminophenylalanine, 4-nitrophenylalanine, 4-chlorophenylalanine, 4-carboxyphenylalanine, b- phenylserine b-hydroxyphenylalanine, phenylglycine, a-naphthylalanine, cyclohexylalanine, cyclohexylglycine, indoline-2-carboxylic acid, 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid, aminomal
  • polypeptides and proteins can be associated with post-translational modifications of one or more amino acids of the polypeptide constructs.
  • post-translational modifications include phosphorylation, acylation including acetylation and formylation, glycosylation (including N-linked and O-linked), amidation, hydroxylation, alkylation including methylation and ethylation, ubiquitylation, addition of pyrrolidone carboxylic acid, formation of disulfide bridges, sulfation, myristoylation, palmitoylation, isoprenylation, farnesylation, geranylation, glypiation, lipoylation and iodination.
  • polynucleotide programmable nucleotide binding domain refers to a protein that associates with a nucleic acid (e.g., DNA or RNA), such as a guide polynucleotide (e.g., guide RNA), that guides the polynucleotide programmable DNA binding domain to a specific nucleic acid sequence.
  • a nucleic acid e.g., DNA or RNA
  • guide polynucleotide e.g., guide RNA
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable RNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a Cas9 protein.
  • a Cas9 protein can associate with a guide RNA that guides the Cas9 protein to a specific DNA sequence that has complementary to the guide RNA.
  • the polynucleotide programmable nucleotide binding domain is a Cas9 domain, for example a nuclease active Cas9, a Cas9 nickase (nCas9), or a nuclease inactive Cas9 (dCas9).
  • Non-limiting examples of nucleic acid programmable DNA binding proteins include Cas9 (e.g., dCas9 and nCas9), Cas12a/Cpfl, Cas12b/C2cl, and Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, and Cas12i.
  • Cas enzymes include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t, Cas5h, Cas5a, Cas6, Cas7, Cas8, Cas8a, Cas8b, Cas8c, Cas9 (also known as Csn1 or Csx12), Cas10, Cas10d, Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i, Csy1 , Csy2, Csy3, Csy4, Cse1, Cse2, Cse3, Cse4, Cse5e, Csc1, Csc2, Csa5, Csn1, Csn2, Csm1, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3,
  • programmable DNA binding proteins are also within the scope of this disclosure, though they are not specifically listed in this disclosure.
  • a recombinant protein or nucleic acid molecule comprises an amino acid or nucleotide sequence that comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations as compared to any naturally occurring sequence.
  • reference is meant a standard or control condition.
  • the reference is a wild-type or healthy cell.
  • A“reference sequence” is a defined sequence used as a basis for sequence comparison.
  • a reference sequence may be a subset of or the entirety of a specified sequence; for example, a segment of a full-length cDNA or gene sequence, or the complete cDNA or gene sequence.
  • the length of the reference polypeptide sequence will generally be at least about 16 amino acids, preferably at least about 20 amino acids, more preferably at least about 25 amino acids, and even more preferably about 35 amino acids, about 50 amino acids, or about 100 amino acids.
  • the length of the reference nucleic acid sequence will generally be at least about 50 nucleotides, preferably at least about 60 nucleotides, more preferably at least about 75 nucleotides, and even more preferably about 100 nucleotides or about 300 nucleotides or any integer thereabout or therebetween.
  • RNA-programmable nuclease and "RNA-guided nuclease” are used with (e.g., binds or associates with) one or more RNA(s) that is not a target for cleavage.
  • an RNA-programmable nuclease when in a complex with an RNA, may be referred to as a nuclease:RNA complex.
  • the bound RNA(s) is referred to as a guide RNA (gRNA).
  • gRNAs can exist as a complex of two or more RNAs, or as a single RNA molecule.
  • gRNAs that exist as a single RNA molecule may be referred to as single-guide RNAs (sgRNAs), though "gRNA” is used interchangeably to refer to guide RNAs that exist as either single molecules or as a complex of two or more molecules.
  • gRNAs that exist as single RNA species comprise two domains: (1) a domain that shares homology to a target nucleic acid (e.g., and directs binding of a Cas9 complex to the target); and (2) a domain that binds a Cas9 protein.
  • domain (2) corresponds to a sequence known as a tracrRNA, and comprises a stem-loop structure.
  • domain (2) is identical or homologous to a tracrRNA as provided in Jinek et al., Science 337:816- 821(2012), the entire contents of which is incorporated herein by reference.
  • gRNAs e.g., those including domain 2
  • a gRNA comprises two or more of domains (1) and (2), and may be referred to as an "extended gRNA.”
  • an extended gRNA will, e.g., bind two or more Cas9 proteins and bind a target nucleic acid at two or more distinct regions, as described herein.
  • the gRNA comprises a nucleotide sequence that complements a target site, which mediates binding of the nuclease/RNA complex to said target site, providing the sequence specificity of the nuclease:RNA complex.
  • the RNA-programmable nuclease is the (CRISPR-associated system) Cas9 endonuclease, for example, Cas9 (Csnl) from Streptococcus pyogenes (See, e.g., "Complete genome sequence of an Ml strain of Streptococcus pyogenes.” Ferretti J.J., McShan W.M., Ajdic D.J., Savic D.J., Savic G., Lyon K., Primeaux C, Sezate S., Suvorov A.N., Kenton S., Lai H.S., Lin S.P., Qian Y., Jia H.G., Najar F.Z., Ren Q., Zhu H., Song L., White J., Yuan X., Clifton S.W., Roe B.A., McLaughlin R.E., Proc. Natl. Acad. Sci. U.S.
  • CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III “CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III.” Deltcheva E., Chylinski K., Sharma CM., Gonzales K., Chao Y., Pirzada Z.A., Eckert M.R., Vogel J., Charpentier E., Nature 471:602-607(2011).
  • SNP single nucleotide polymorphism
  • SNPs can fall within coding regions of genes, non-coding regions of genes, or in the intergenic regions (regions between genes). In some embodiments, SNPs within a coding sequence do not necessarily change the amino acid sequence of the protein that is produced, due to degeneracy of the genetic code. SNPs in the coding region are of two types: synonymous and nonsynonymous SNPs. Synonymous SNPs do not affect the protein sequence, while nonsynonymous SNPs change the amino acid sequence of protein. The nonsynonymous SNPs are of two types:
  • SNPs that are not in protein-coding regions can still affect gene splicing, transcription factor binding, messenger RNA degradation, or the sequence of noncoding RNA. Gene expression affected by this type of SNP is referred to as an eSNP (expression SNP) and can be upstream or downstream from the gene.
  • eSNP expression SNP
  • a single nucleotide variant (SNV) is a variation in a single nucleotide without any limitations of frequency and can arise in somatic cells.
  • a somatic single nucleotide variation (e.g., caused by cancer) can also be called a single-nucleotide alteration.
  • SERPINA1 polynucleotide is meant a nucleic acid molecule encoding an A1AT protein or fragment thereof.
  • sequence of an exemplary SERPINA1 polynucleotide which is available at NCBI Accession NO. NM_000295, is provided below:
  • the PAM sequence is shown in italics and double underlining, and the correct sequence after adenosine base editing is shown.
  • nucleic acid molecule e.g., a nucleic acid programmable DNA binding domain and guide nucleic acid
  • compound e.g., a nucleic acid programmable DNA binding domain and guide nucleic acid
  • molecule that recognizes and binds a polypeptide and/or nucleic acid molecule of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample.
  • Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having“substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double- stranded nucleic acid molecule. Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having
  • substantially identical to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule.
  • hybridize is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
  • complementary polynucleotide sequences e.g., a gene described herein
  • stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
  • Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
  • Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C. Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art.
  • SDS sodium dodecyl sulf
  • hybridization will occur at 30° C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS. In a more preferred embodiment, hybridization will occur at 37° C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 ⁇ g/ml denatured salmon sperm DNA (ssDNA). In a most preferred embodiment, hybridization will occur at 42° C in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 mg/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
  • washing steps that follow hybridization will also vary in stringency. Wash stringency conditions can be defined by salt concentration and by
  • wash stringency can be increased by decreasing salt concentration or by increasing temperature.
  • stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
  • Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C. In a preferred embodiment, wash steps will occur at 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS.
  • wash steps will occur at 42 C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art. Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Hogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al.
  • substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
  • a reference amino acid sequence for example, any one of the amino acid sequences described herein
  • nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
  • such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
  • Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis.53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e -3 and e -100 indicating a closely related sequence.
  • sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Bio
  • COBALT is used, for example, with the following parameters:
  • EMBOSS Needle is used, for example, with the following parameters:
  • subject is meant a mammal, including, but not limited to, a human or non-human mammal, such as a bovine, equine, canine, ovine, or feline.
  • target site refers to a sequence within a nucleic acid molecule that is modified by a nucleobase editor.
  • the target site is deaminated by a deaminase or a fusion protein comprising a deaminase (e.g., a cytidine or an adenine
  • RNA-programmable nucleases e.g., Cas9
  • Cas9 RNA:DNA hybridization to target DNA cleavage sites
  • Methods of using RNA-programmable nucleases, such as Cas9, for site-specific cleavage (e.g., to modify a genome) are known in the art (see e.g., Cong, L. et ah, Multiplex genome engineering using CRISPR/Cas systems. Science 339, 819-823 (2013); Mali, P. et ah, RNA-guided human genome engineering via Cas9. Science 339, 823-826 (2013);
  • the terms“treat,” treating,”“treatment,” and the like refer to reducing or ameliorating a disorder and/or symptoms associated therewith or obtaining a desired pharmacologic and/or physiologic effect. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated. In some embodiments, the effect is therapeutic, i.e., without limitation, the effect partially or completely reduces, diminishes, abrogates, abates, alleviates, decreases the intensity of, or cures a disease and/or adverse symptom attributable to the disease.
  • the effect is preventative, i.e., the effect protects or prevents an occurrence or reoccurrence of a disease or condition.
  • the presently disclosed methods comprise administering a therapeutically effective amount of a compositions as described herein.
  • uracil glycosylase inhibitor is meant an agent that inhibits the uracil-excision repair system.
  • the agent is a protein or fragment thereof that binds a host uracil-DNA glycosylase and prevents removal of uracil residues from DNA.
  • Ranges provided herein are understood to be shorthand for all of the values within the range.
  • a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
  • any compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
  • DNA editing has emerged as a viable means to modify disease states by correcting pathogenic mutations at the genetic level.
  • all DNA editing platforms have functioned by inducing a DNA double strand break (DSB) at a specified genomic site and relying on endogenous DNA repair pathways to determine the product outcome in a semi- stochastic manner, resulting in complex populations of genetic products.
  • DSB DNA double strand break
  • HDR homology directed repair
  • a base editor or a nucleobase editor for editing, modifying or altering a target nucleotide sequence of a polynucleotide. Described herein is a nucleobase editor or a base editor comprising a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain.
  • a polynucleotide programmable nucleotide binding domain when in conjunction with a bound guide polynucleotide (e.g., gRNA), can specifically bind to a target polynucleotide sequence (i.e., via complementary base pairing between bases of the bound guide nucleic acid and bases of the target polynucleotide sequence) and thereby localize the base editor to the target nucleic acid sequence desired to be edited.
  • the target polynucleotide sequence comprises single-stranded DNA or double-stranded DNA.
  • the target polynucleotide sequence comprises RNA.
  • the target polynucleotide sequence comprises a DNA-RNA hybrid.
  • polynucleotide programmable nucleotide binding domain refers to a protein that associates with a nucleic acid (e.g., DNA or RNA), such as a guide polynucleotide (e.g., guide RNA), that guides the polynucleotide programmable nucleotide binding domain to a specific nucleic acid sequence.
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable RNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a Cas9 protein.
  • the polynucleotide programmable nucleotide binding domain is a Cpf1 protein.
  • polynucleotide programmable nucleotide binding domains can also include nucleic acid programmable proteins that bind RNA.
  • the polynucleotide programmable nucleotide binding domain can be associated with a nucleic acid that guides the polynucleotide programmable nucleotide binding domain to an RNA.
  • Other nucleic acid programmable DNA binding proteins are also within the scope of this disclosure, though they are not specifically listed in this disclosure.
  • a polynucleotide programmable nucleotide binding domain of a base editor can itself comprise one or more domains.
  • a polynucleotide programmable nucleotide binding domain can comprise one or more nuclease domains.
  • the nuclease domain of a polynucleotide programmable nucleotide binding domain can comprise an endonuclease or an exonuclease.
  • an endonuclease refers to a protein or polypeptide capable of digesting a nucleic acid (e.g., RNA or DNA) from free ends
  • the term“endonuclease” refers to a protein or polypeptide capable of catalyzing (e.g. cleaving) internal regions in a nucleic acid (e.g., DNA or RNA).
  • an endonuclease can cleave a single strand of a double-stranded nucleic acid.
  • an endonuclease can cleave both strands of a double-stranded nucleic acid molecule.
  • a polynucleotide programmable nucleotide binding domain can be a
  • a polynucleotide programmable nucleotide binding domain can be a ribonuclease.
  • a nuclease domain of a polynucleotide programmable nucleotide binding domain can cut zero, one, or two strands of a target polynucleotide.
  • the polynucleotide programmable nucleotide binding domain can comprise a nickase domain.
  • nickase refers to a polynucleotide programmable nucleotide binding domain comprising a nuclease domain that is capable of cleaving only one strand of the two strands in a duplexed nucleic acid molecule (e.g. DNA).
  • a nickase can be derived from a fully catalytically active (e.g. natural) form of a polynucleotide programmable nucleotide binding domain by introducing one or more mutations into the active polynucleotide
  • a polynucleotide programmable nucleotide binding domain comprises a nickase domain derived from Cas9
  • the Cas9-derived nickase domain can include a D10A mutation and a histidine at position 840.
  • the residue H840 retains catalytic activity and can thereby cleave a single strand of the nucleic acid duplex.
  • a Cas9-derived nickase domain can comprise an H840A mutation, while the amino acid residue at position 10 remains a D.
  • a nickase can be derived from a fully catalytically active (e.g.
  • a polynucleotide programmable nucleotide binding domain comprises a nickase domain derived from Cas9
  • the Cas9-derived nickase domain can comprise a deletion of all or a portion of the RuvC domain or the HNH domain.
  • amino acid sequence of an exemplary catalytically active Cas9 is as follows:
  • a base editor comprising a polynucleotide programmable nucleotide binding domain comprising a nickase domain is thus able to generate a single-strand DNA break (nick) at a specific polynucleotide target sequence (e.g. determined by the complementary sequence of a bound guide nucleic acid).
  • a specific polynucleotide target sequence e.g. determined by the complementary sequence of a bound guide nucleic acid.
  • the strand of a nucleic acid duplex target polynucleotide sequence that is cleaved by a base editor comprising a nickase domain e.g.
  • Cas9-derived nickase domain is the strand that is not edited by the base editor (i.e., the strand that is cleaved by the base editor is opposite to a strand comprising a base to be edited).
  • a base editor comprising a nickase domain e.g. Cas9-derived nickase domain
  • base editors comprising a polynucleotide programmable nucleotide binding domain which is catalytically dead (i.e., incapable of cleaving a target polynucleotide sequence).
  • catalytically dead and“nuclease dead” are used interchangeably to refer to a polynucleotide programmable nucleotide binding domain which has one or more mutations and/or deletions resulting in its inability to cleave a strand of a nucleic acid.
  • a catalytically dead polynucleotide programmable nucleotide binding domain base editor can lack nuclease activity as a result of specific point mutations in one or more nuclease domains.
  • the Cas9 can comprise both a D10A mutation and an H840A mutation. Such mutations inactivate both nuclease domains, thereby resulting in the loss of nuclease activity.
  • a catalytically dead polynucleotide programmable nucleotide binding domain can comprise one or more deletions of all or a portion of a catalytic domain (e.g.
  • a catalytically dead polynucleotide programmable nucleotide binding domain comprises a point mutation (e.g. D10A or H840A) as well as a deletion of all or a portion of a nuclease domain.
  • mutations capable of generating a catalytically dead polynucleotide programmable nucleotide binding domain from a previously functional version of the polynucleotide programmable nucleotide binding domain.
  • dCas9 catalytically dead Cas9
  • variants having mutations other than D10A and H840A are provided, which result in nuclease inactivated Cas9.
  • Such mutations include other amino acid substitutions at D10 and H840, or other substitutions within the nuclease domains of Cas9 (e.g., substitutions in the HNH nuclease subdomain and/or the RuvC1 subdomain).
  • nuclease-inactive dCas9 domains can be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A/H840A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology.2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference).
  • Non-limiting examples of a polynucleotide programmable nucleotide binding domain which can be incorporated into a base editor include a CRISPR protein-derived domain, a restriction nuclease, a meganuclease, TAL nuclease (TALEN), and a zinc finger nuclease (ZFN).
  • a base editor comprises a polynucleotide programmable nucleotide binding domain comprising a natural or modified protein or portion thereof which via a bound guide nucleic acid is capable of binding to a nucleic acid sequence during CRISPR (i.e., Clustered Regularly Interspaced Short Palindromic Repeats)-mediated modification of a nucleic acid.
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • Such a protein is referred to herein as a“CRISPR protein”.
  • a base editor comprising a polynucleotide programmable nucleotide binding domain comprising all or a portion of a CRISPR protein (i.e. a base editor comprising as a domain all or a portion of a CRISPR protein, also referred to as a“CRISPR protein-derived domain” of the base editor).
  • a CRISPR protein-derived domain incorporated into a base editor can be modified compared to a wild-type or natural version of the CRISPR protein.
  • a CRISPR protein-derived domain can comprise one or more mutations, insertions, deletions, rearrangements and/or recombinations relative to a wild-type or natural version of the CRISPR protein.
  • CRISPR is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids).
  • CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids.
  • CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA).
  • crRNA CRISPR RNA
  • type II CRISPR systems correct processing of pre-crRNA requires a trans-encoded small RNA
  • tracrRNA endogenous ribonuclease 3
  • Cas9 protein a protein that is synthesized by endogenous ribonuclease 3 (rnc) and a Cas9 protein.
  • the tracrRNA serves as a guide for ribonuclease 3-aided processing of pre-crRNA.
  • Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer.
  • the target strand not complementary to crRNA is first cut endonucleolytically, and then trimmed 3 - 5 exonucleolytically.
  • DNA-binding and cleavage typically requires protein and both RNAs.
  • single guide RNAs (“sgRNA”, or simply“gNRA”) can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M., Chylinski K., Fonfara I., Hauer M., Doudna J. A., Charpentier E. Science 337:816- 821(2012), the entire contents of which is hereby incorporated by reference.
  • Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self.
  • the methods described herein can utilize an engineered Cas protein.
  • a guide RNA is a short synthetic RNA composed of a scaffold sequence necessary for Cas-binding and a user-defined ⁇ 20 nucleotide spacer that defines the genomic target to be modified.
  • gRNA guide RNA
  • a skilled artisan can change the genomic target of the Cas protein specificity is partially determined by how specific the gRNA targeting sequence is for the genomic target compared to the rest of the genome.
  • a CRISPR protein-derived domain incorporated into a base editor is an endonuclease (e.g., deoxyribonuclease or ribonuclease) capable of binding a target polynucleotide when in conjunction with a bound guide nucleic acid.
  • a CRISPR protein-derived domain incorporated into a base editor is a nickase capable of binding a target polynucleotide when in conjunction with a bound guide nucleic acid.
  • a CRISPR protein-derived domain incorporated into a base editor is a
  • a target polynucleotide bound by a CRISPR protein derived domain of a base editor is DNA. In some embodiments, a target polynucleotide bound by a CRISPR protein-derived domain of a base editor is RNA.
  • Cas proteins that can be used herein include class 1 and class 2.
  • Non-limiting examples of Cas proteins include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t, Cas5h, Cas5a, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 or Csx12), Cas10, Csy1 , Csy2, Csy3, Csy4, Cse1, Cse2, Cse3, Cse4, Cse5e, Csc1, Csc2, Csa5, Csn1, Csn2, Csm1, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx1S, C
  • An unmodified CRISPR enzyme can have DNA cleavage activity, such as Cas9, which has two functional endonuclease domains: RuvC and HNH.
  • a CRISPR enzyme can direct cleavage of one or both strands at a target sequence, such as within a target sequence and/or within a complement of a target sequence.
  • a CRISPR enzyme can direct cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence.
  • a vector that encodes a CRISPR enzyme that is mutated to with respect, to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence can be used.
  • Cas9 can refer to a polypeptide with at least or at least about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity and/or sequence homology to a wild type exemplary Cas9 polypeptide (e.g., Cas9 from S. pyogenes).
  • Cas9 can refer to a polypeptide with at most or at most about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity and/or sequence homology to a wild type exemplary Cas9 polypeptide (e.g., from S. pyogenes).
  • Cas9 can refer to the wild type or a modified form of the Cas9 protein that can comprise an amino acid change such as a deletion, insertion, substitution, variant, mutation, fusion, chimera, or any combination thereof.
  • a CRISPR protein-derived domain of a base editor can include all or a portion of Cas9 from Corynebacterium ulcerans (NCBI Refs: NC_015683.1,
  • NC_017317.1 Corynebacterium diphtheria (NCBI Refs: NC_016782.1, NC_016786.1);
  • NCBI Ref NC_021284.1
  • Prevotella intermedia NCBI Ref:
  • NCBI Ref NC_017861.1
  • Spiroplasma taiwanense NCBI Ref: NC_021846.1
  • Streptococcus iniae NCBI Ref: NC_021314.1
  • Belliella baltica NCBI Ref: NC_018010.1
  • Psychroflexus torquis NCBI Ref: NC_018721.1
  • Streptococcus thermophilus NCBI Ref: YP_820832.1
  • Listeria innocua NCBI Ref: NP_472073.1
  • Campylobacter jejuni NCBI Ref: YP_002344900.1
  • Neisseria meningitidis NCBI Ref: YP_002342100.1
  • Streptococcus pyogenes or
  • Cas9 or“Cas9 domain” refers to an RNA guided nuclease comprising a Cas9 protein, or a fragment thereof (e.g., a protein comprising an active, inactive, or partially active DNA cleavage domain of Cas9, and/or the gRNA binding domain of Cas9).
  • a Cas9 nuclease is also referred to sometimes as a casnl nuclease or a CRISPR (clustered regularly interspaced short palindromic repeat) associated nuclease.
  • An exemplary Cas9 is Streptococcus pyogenes Cas9 (spCas9), the amino acid sequence of which is provided below.:
  • Cas9 nuclease sequences and structures are well known to those of skill in the art (See, e.g.,“Complete genome sequence of an Ml strain of Streptococcus pyogenes.” Ferretti et al., J.J., McShan W.M., Ajdic D.J., Savic D.J., Savic G., Lyon K., Primeaux C, Sezate S., Suvorov A.N., Kenton S., Lai H.S., Lin S.P., Qian Y., Jia H.G., Najar F.Z., Ren Q., Zhu H., Song L., White J., Yuan X., Clifton S.W., Roe B.A., McLaughlin R.E., Proc.
  • Cas9 orthologs have been described in various species, including, but not limited to, S. pyogenes and S. thermophilus. Additional suitable Cas9 nucleases and sequences will be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier,“The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference.
  • a nucleic acid programmable DNA binding protein is a Cas9 domain.
  • the Cas9 domain may be a nuclease active Cas9 domain, a nuclease inactive Cas9 domain, or a Cas9 nickase.
  • the Cas9 domain is a nuclease active domain.
  • the Cas9 domain may be a Cas9 domain that cuts both strands of a duplexed nucleic acid (e.g., both strands of a duplexed DNA molecule).
  • the Cas9 domain comprises any one of the amino acid sequences as set forth herein. In some embodiments the Cas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth herein.
  • the Cas9 domain comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more mutations compared to any one of the amino acid sequences set forth herein.
  • the Cas9 domain comprises an amino acid sequence that has at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or at least 1200 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth herein.
  • proteins comprising fragments of Cas9 are provided.
  • a protein comprises one of two Cas9 domains: (1) the gRNA binding domain of Cas9; or (2) the DNA cleavage domain of Cas9.
  • proteins comprising Cas9 or fragments thereof are referred to as“Cas9 variants.”
  • a Cas9 variant shares homology to Cas9, or a fragment thereof.
  • a Cas9 variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to wild type Cas9.
  • the Cas9 variant may have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more amino acid changes compared to wild type Cas9.
  • the Cas9 variant comprises a fragment of Cas9 (e.g., a gRNA binding domain or a DNA-cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to the corresponding fragment of wild type Cas9.
  • a fragment of Cas9 e.g., a gRNA binding domain or a DNA-cleavage domain
  • the fragment is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% of the amino acid length of a corresponding wild type Cas9.
  • the fragment is at least 100 amino acids in length.
  • the fragment is at least 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, or at least 1300 amino acids in length.
  • Cas9 fusion proteins as provided herein comprise the full-length amino acid sequence of a Cas9 protein, e.g., one of the Cas9 sequences provided herein. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length Cas9 sequence, but only one or more fragments thereof. Exemplary amino acid sequences of suitable Cas9 domains and Cas9 fragments are provided herein, and additional suitable sequences of Cas9 domains and fragments will be apparent to those of skill in the art.
  • a Cas9 protein can associate with a guide RNA that guides the Cas9 protein to a specific DNA sequence that has complementary to the guide RNA.
  • the polynucleotide programmable nucleotide binding domain is a Cas9 domain, for example a nuclease active Cas9, a Cas9 nickase (nCas9), or a nuclease inactive Cas9 (dCas9).
  • nucleic acid programmable DNA binding proteins include, without limitation, Cas9 (e.g., dCas9 and nCas9), CasX, CasY, Cpf1, Cas12b/C2C1, and Cas12c/C2C3.
  • wild type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCBI Reference Sequence: NC_017053.1, nucleotide and amino acid sequences as follows).
  • wild type Cas9 corresponds to, or comprises the following nucleotide and/or amino acid sequences:
  • wild type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCBI Reference Sequence: NC_002737.2 (nucleotide sequence as follows); and Uniprot Reference Sequence: Q99ZW2 (amino acid sequence as follows):
  • Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs: NC_016782.1, NC_016786.1); Spiroplasma syrphidicola (NCBI Ref: NC_021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma taiwanense (NCBI Ref: NC_021846.1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquisI (NCBI Ref: NC_018721.1); Streptococcus thermophilus (NCBI Ref: YP_820
  • YP_002344900.1 or Neisseria meningitidis (NCBI Ref: YP_002342100.1) or to a Cas9 from any other organism.
  • Cas9 proteins e.g., a nuclease dead Cas9 (dCas9), a Cas9 nickase (nCas9), or a nuclease active Cas9), including variants and homologs thereof, are within the scope of this disclosure.
  • Exemplary Cas9 proteins include, without limitation, those provided below.
  • the Cas9 protein is a nuclease dead Cas9 (dCas9).
  • the Cas9 protein is a Cas9 nickase (nCas9).
  • the Cas9 protein is a nuclease active Cas9.
  • the Cas9 domain is a nuclease-inactive Cas9 domain (dCas9).
  • the dCas9 domain may bind to a duplexed nucleic acid molecule (e.g., via a gRNA molecule) without cleaving either strand of the duplexed nucleic acid molecule.
  • the nuclease-inactive dCas9 domain comprises a D10X mutation and a H840X mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid change.
  • the nuclease-inactive dCas9 domain comprises a D10A mutation and a H840A mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein.
  • a nuclease-inactive Cas9 domain comprises the amino acid sequence set forth in Cloning vector pPlatTET-gRNA2 (Accession No. BAV54124).
  • a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain, that is, the Cas9 is a nickase, referred to as an“nCas9” protein (for“nickase” Cas9).
  • a nuclease-inactivated Cas9 protein may interchangeably be referred to as a“dCas9” protein (for nuclease-“dead” Cas9) or catalytically inactive Cas9.
  • the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvC1 subdomain.
  • the HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvC1 subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9.
  • the mutations D10A and H840A completely inactivate the nuclease activity of S.
  • the dCas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the dCas9 domains provided herein.
  • the Cas9 domain comprises an amino acid sequences that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more or more mutations compared to any one of the amino acid sequences set forth herein.
  • the Cas9 domain comprises an amino acid sequence that has at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or at least 1200 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth herein.
  • dCas9 corresponds to, or comprises in part or in whole, a Cas9 amino acid sequence having one or more mutations that inactivate the Cas9 nuclease activity.
  • a dCas9 domain comprises D10A and an H840A mutation or corresponding mutations in another Cas9.
  • the dCas9 comprises the amino acid sequence of dCas9 (D10A and H840A):
  • SQLGGD single underline: HNH domain; double underline: RuvC domain.
  • the Cas9 domain comprises a D10A mutation, while the residue at position 840 remains a histidine in the amino acid sequence provided above, or at
  • dCas9 variants having mutations other than D10A and H840A are provided, which, e.g., result in nuclease inactivated Cas9 (dCas9).
  • Such mutations include other amino acid substitutions at D10 and H840, or other substitutions within the nuclease domains of Cas9 (e.g., substitutions in the HNH nuclease subdomain and/or the RuvC1 subdomain).
  • variants or homologues of dCas9 are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical.
  • variants of dCas9 are provided having amino acid sequences which are shorter, or longer, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids or more.
  • the Cas9 domain is a Cas9 nickase.
  • the Cas9 nickase may be a Cas9 protein that is capable of cleaving only one strand of a duplexed nucleic acid molecule (e.g., a duplexed DNA molecule).
  • the Cas9 nickase cleaves the target strand of a duplexed nucleic acid molecule, meaning that the Cas9 nickase cleaves the strand that is base paired to (complementary to) a gRNA (e.g., an sgRNA) that is bound to the Cas9.
  • a gRNA e.g., an sgRNA
  • a Cas9 nickase comprises a D10A mutation and has a histidine at position 840.
  • the Cas9 nickase cleaves the non-target, non-base-edited strand of a duplexed nucleic acid molecule, meaning that the Cas9 nickase cleaves the strand that is not base paired to a gRNA (e.g., an sgRNA) that is bound to the Cas9.
  • a Cas9 nickase comprises an H840A mutation and has an aspartic acid residue at position 10, or a corresponding mutation.
  • the Cas9 nickase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 nickases provided herein. Additional suitable Cas9 nickases will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • nCas9 nickase (nCas9)
  • Cas9 refers to a Cas9 from archaea (e.g. nanoarchaea), which constitute a domain and kingdom of single-celled prokaryotic microbes.
  • the programmable nucleotide binding protein may be a CasX or CasY protein, which have been described in, for example, Burstein et al., "New CRISPR-Cas systems from uncultivated microbes.” Cell Res.2017 Feb 21. doi: 10.1038/cr.2017.21, the entire contents of which is hereby incorporated by reference.
  • CRISPR-Cas system In bacteria, two previously unknown systems were discovered, CRISPR- CasX and CRISPR-CasY, which are among the most compact systems yet discovered.
  • Cas9 in a base editor system described herein Cas9 is replaced by CasX, or a variant of CasX.
  • Cas9 in a base editor system described herein Cas9 is replaced by CasY, or a variant of CasY. It should be appreciated that other RNA-guided DNA binding proteins may be used as a nucleic acid programmable DNA binding protein (napDNAbp), and are within the scope of this disclosure.
  • the nucleic acid programmable DNA binding protein [0184] In some embodiments, the nucleic acid programmable DNA binding protein
  • napDNAbp of any of the fusion proteins provided herein may be a CasX or CasY protein.
  • the napDNAbp is a CasX protein.
  • the napDNAbp is a CasY protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally- occurring CasX or CasY protein.
  • the programmable nucleotide binding protein is a naturally-occurring CasX or CasY protein.
  • the programmable nucleotide binding protein comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any CasX or CasY protein described herein. It should be appreciated that CasX and CasY from other bacterial species may also be used in accordance with the present disclosure.
  • the nucleic acid programmable DNA binding protein [0189] In some embodiments, the nucleic acid programmable DNA binding protein
  • napDNAbp is a single effector of a microbial CRISPR-Cas system.
  • Single effectors of microbial CRISPR-Cas systems include, without limitation, Cas9, Cpf1, Cas12b/C2c1, and Cas12c/C2c3.
  • microbial CRISPR-Cas systems are divided into Class 1 and Class 2 systems. Class 1 systems have multisubunit effector complexes, while Class 2 systems have a single protein effector.
  • Cas9 and Cpf1 are Class 2 effectors.
  • Cas12c/C2c3 contain RuvC-like endonuclease domains related to Cpf1.
  • a third system contains an effector with two predicated HEPN RNase domains. Production of mature CRISPR RNA is tracrRNA-independent, unlike production of CRISPR RNA by Cas12b/C2c1.
  • Cas12b/C2c1 depends on both CRISPR RNA and tracrRNA for DNA cleavage.
  • AcC2c1 The crystal structure of Alicyclobaccillus acidoterrastris Cas12b/C2c1 (AacC2c1) has been reported in complex with a chimeric single-molecule guide RNA (sgRNA). See e.g., Liu et al.,“C2c1-sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism”, Mol. Cell, 2017 Jan.19; 65(2):310-322, the entire contents of which are hereby incorporated by reference. The crystal structure has also been reported in Alicyclobacillus acidoterrestris C2c1 bound to target DNAs as ternary complexes.
  • sgRNA chimeric single-molecule guide RNA
  • the nucleic acid programmable DNA binding protein [0191] In some embodiments, the nucleic acid programmable DNA binding protein
  • napDNAbp of any of the fusion proteins provided herein may be a Cas12b/C2c1, or a
  • the napDNAbp is a Cas12b/C2c1 protein. In some embodiments, the napDNAbp is a Cas12c/C2c3 protein. In some embodiments, the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally-occurring Cas12b/C2c1 or Cas12c/C2c3 protein.
  • the napDNAbp is a naturally-occurring Cas12b/C2c1 or Cas12c/C2c3 protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any one of the napDNAbp sequences provided herein.
  • Cas12b/C2c1 or Cas12c/C2c3 from other bacterial species may also be used in accordance with the present disclosure.
  • a Cas12b/C2c1 ((uniprot.org/uniprot/T0D7A2#2) sp
  • C2c1 OS Alicyclobacillus acido-terrestris (strain ATCC 49025 / DSM 3922/ CIP 106132 / NCIMB 13137/GD3B)
  • GN c2c1
  • the Cas12b is BvCas12B, which is a variant of BhCas12b and comprises the following changes relative to BhCas12B: S893R, K846R, and E837G.
  • the Cas9 nuclease has two functional endonuclease domains: RuvC and HNH. Cas9 undergoes a second conformational change upon target binding that positions the nuclease domains to cleave opposite strands of the target DNA.
  • the end result of Cas9-mediated DNA cleavage is a double-strand break (DSB) within the target DNA ( ⁇ 3-4 nucleotides upstream of the PAM sequence).
  • the resulting DSB is then repaired by one of two general repair pathways: (1) the efficient but error-prone non-homologous end joining (NHEJ) pathway; or (2) the less efficient but high-fidelity homology directed repair (HDR) pathway.
  • NHEJ efficient but error-prone non-homologous end joining
  • HDR homology directed repair
  • The“efficiency” of non-homologous end joining (NHEJ) and/or homology directed repair (HDR) can be calculated by any convenient method. For example, in some cases, efficiency can be expressed in terms of percentage of successful HDR.
  • a surveyor nuclease assay can be used can be used to generate cleavage products and the ratio of products to substrate can be used to calculate the percentage.
  • a surveyor nuclease enzyme can be used that directly cleaves DNA containing a newly integrated restriction sequence as the result of successful HDR. More cleaved substrate indicates a greater percent HDR (a greater efficiency of HDR).
  • a fraction (percentage) of HDR can be calculated using the following equation [(cleavage products)/(substrate plus cleavage products)] (e.g., (b+c)/(a+b+c), where“a” is the band intensity of DNA substrate and“b” and“c” are the cleavage products).
  • efficiency can be expressed in terms of percentage of successful NHEJ.
  • a T7 endonuclease I assay can be used to generate cleavage products and the ratio of products to substrate can be used to calculate the percentage NHEJ.
  • T7 endonuclease Icleaves mismatched heteroduplex DNA which arises from hybridization of wild-type and mutant DNA strands (NHEJ generates small random insertions or deletions (indels) at the site of the original break). More cleavage indicates a greater percent NHEJ (a greater efficiency of NHEJ).
  • a fraction (percentage) of NHEJ can be calculated using the following equation: (1-(1-(b+c)/(a+b+c)) 1/2 ) ⁇ 100, where“a” is the band intensity of DNA substrate and“b” and“c” are the cleavage products (Ran et. al., Cell.2013 Sep.12;
  • the NHEJ repair pathway is the most active repair mechanism, and it frequently causes small nucleotide insertions or deletions (indels) at the DSB site.
  • the randomness of NHEJ- mediated DSB repair has important practical implications, because a population of cells expressing Cas9 and a gRNA or a guide polynucleotide can result in a diverse array of mutations.
  • NHEJ gives rise to small indels in the target DNA that result in amino acid deletions, insertions, or frameshift mutations leading to premature stop codons within the open reading frame (ORF) of the targeted gene.
  • ORF open reading frame
  • HDR homology directed repair
  • a DNA repair template containing the desired sequence can be delivered into the cell type of interest with the gRNA(s) and Cas9 or Cas9 nickase.
  • the repair template can contain the desired edit as well as additional homologous sequence immediately upstream and downstream of the target (termed left & right homology arms). The length of each homology arm can be dependent on the size of the change being introduced, with larger insertions requiring longer homology arms.
  • the repair template can be a single-stranded oligonucleotide, double-stranded oligonucleotide, or a double-stranded DNA plasmid.
  • the efficiency of HDR is generally low ( ⁇ 10% of modified alleles) even in cells that express Cas9, gRNA and an exogenous repair template.
  • the efficiency of HDR can be enhanced by synchronizing the cells, since HDR takes place during the S and G2 phases of the cell cycle. Chemically or genetically inhibiting genes involved in NHEJ can also increase HDR frequency.
  • Cas9 is a modified Cas9.
  • a given gRNA targeting sequence can have additional sites throughout the genome where partial homology exists. These sites are called off-targets and need to be considered when designing a gRNA.
  • CRISPR specificity can also be increased through modifications to Cas9.
  • Cas9 generates double-strand breaks (DSBs) through the combined activity of two nuclease domains, RuvC and HNH.
  • Cas9 nickase, a D10A mutant of SpCas9 retains one nuclease domain and generates a DNA nick rather than a DSB.
  • the nickase system can also be combined with HDR- mediated gene editing for specific gene edits.
  • Cas9 is a variant Cas9 protein.
  • a variant Cas9 polypeptide has an amino acid sequence that is different by one amino acid (e.g., has a deletion, insertion, substitution, fusion) when compared to the amino acid sequence of a wild type Cas9 protein.
  • the variant Cas9 polypeptide has an amino acid change (e.g., deletion, insertion, or substitution) that reduces the nuclease activity of the Cas9 polypeptide.
  • the variant Cas9 polypeptide has less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, or less than 1% of the nuclease activity of the corresponding wild-type Cas9 protein. In some cases, the variant Cas9 protein has no substantial nuclease activity.
  • a subject Cas9 protein is a variant Cas9 protein that has no substantial nuclease activity, it can be referred to as“dCas9.”
  • a variant Cas9 protein has reduced nuclease activity.
  • a variant Cas9 protein exhibits less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 1%, or less than about 0.1%, of the endonuclease activity of a wild-type Cas9 protein, e.g., a wild-type Cas9 protein.
  • a variant Cas9 protein can cleave the complementary strand of a guide target sequence but has reduced ability to cleave the non-complementary strand of a double stranded guide target sequence.
  • the variant Cas9 protein can have a mutation (amino acid substitution) that reduces the function of the RuvC domain.
  • a variant Cas9 protein has a D10A (aspartate to alanine at amino acid position 10) and can therefore cleave the complementary strand of a double stranded guide target sequence but has reduced ability to cleave the non-complementary strand of a double stranded guide target sequence (thus resulting in a single strand break (SSB) instead of a double strand break (DSB) when the variant Cas9 protein cleaves a double stranded target nucleic acid) (see, for example, Jinek et al., Science.2012 Aug.17; 337(6096):816-21).
  • SSB single strand break
  • DSB double strand break
  • a variant Cas9 protein can cleave the non-complementary strand of a double stranded guide target sequence but has reduced ability to cleave the complementary strand of the guide target sequence.
  • the variant Cas9 protein can have a mutation (amino acid substitution) that reduces the function of the HNH domain (RuvC/HNH/RuvC domain motifs).
  • the variant Cas9 protein has an H840A (histidine to alanine at amino acid position 840) mutation and can therefore cleave the non-complementary strand of the guide target sequence but has reduced ability to cleave the complementary strand of the guide target sequence (thus resulting in a SSB instead of a DSB when the variant Cas9 protein cleaves a double stranded guide target sequence).
  • H840A histidine to alanine at amino acid position 840
  • Such a Cas9 protein has a reduced ability to cleave a guide target sequence (e.g., a single stranded guide target sequence) but retains the ability to bind a guide target sequence (e.g., a single stranded guide target sequence).
  • a variant Cas9 protein has a reduced ability to cleave both the complementary and the non-complementary strands of a double stranded target DNA.
  • the variant Cas9 protein harbors both the D10A and the H840A mutations such that the polypeptide has a reduced ability to cleave both the complementary and the non-complementary strands of a double stranded target DNA.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors W476A and W1126A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors P475A, W476A, N477A, D1125A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors H840A, W476A, and W1126A, mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors H840A, D10A, W476A, and W1126A, mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 has restored catalytic His residue at position 840 in the Cas9 HNH domain (A840H).
  • the variant Cas9 protein harbors, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors D10A, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • a variant Cas9 protein harbors W476A and W1126A mutations or when the variant Cas9 protein harbors P475A, W476A, N477A, D1125A, W1126A, and
  • the variant Cas9 protein does not bind efficiently to a PAM sequence.
  • the method does not require a PAM sequence.
  • the method can include a guide RNA, but the method can be performed in the absence of a PAM sequence (and the specificity of binding is therefore provided by the targeting segment of the guide RNA).
  • Other residues can be mutated to achieve the above effects (i.e., inactivate one or the other nuclease portions).
  • residues D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or A987 can be altered (i.e., substituted). Also, mutations other than alanine substitutions are suitable.
  • a variant Cas9 protein that has reduced catalytic activity e.g., when a Cas9 protein has a D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or a A987 mutation, e.g., D10A, G12A, G17A, E762A, H840A, N854A, N863A, H982A, H983A, A984A, and/or D986A), the variant Cas9 protein can still bind to target DNA in a site- specific manner (because it is still guided to a target DNA sequence by a guide RNA) as long as it retains the ability to interact with the guide RNA.
  • the variant Cas9 protein can still bind to target DNA in a site- specific manner (because it is still guided to a target DNA sequence by a guide RNA) as long as it retains the ability to interact with the guide RNA.
  • the variant Cas protein can be spCas9, spCas9-VRQR, spCas9- VRER, xCas9 (sp), saCas9, saCas9-KKH, spCas9-MQKSER, spCas9-LRKIQK, or spCas9- LRVSQL.
  • CRISPR/Cpf1 RNA-guided endonucleases from the Cpf1 family that display cleavage activity in mammalian cells.
  • CRISPR from Prevotella and Francisella 1 (CRISPR/Cpf1) is a DNA-editing technology analogous to the CRISPR/Cas9 system.
  • Cpf1 is an RNA-guided endonuclease of a class II CRISPR/Cas system. This acquired immune mechanism is found in Prevotella and Francisella bacteria.
  • Cpf1 genes are associated with the CRISPR locus, coding for an endonuclease that use a guide RNA to find and cleave viral DNA.
  • Cpf1 is a smaller and simpler endonuclease than Cas9, overcoming some of the CRISPR/Cas9 system limitations. Unlike Cas9 nucleases, the result of Cpf1-mediated DNA cleavage is a double-strand break with a short 3 overhang. Cpf1’s staggered cleavage pattern can open up the possibility of directional gene transfer, analogous to traditional restriction enzyme cloning, which can increase the efficiency of gene editing. Like the Cas9 variants and orthologues described above, Cpf1 can also expand the number of sites that can be targeted by CRISPR to AT-rich regions or AT-rich genomes that lack the NGG PAM sites favored by SpCas9.
  • the Cpf1 locus contains a mixed alpha/beta domain, a RuvC-I followed by a helical region, a RuvC-II and a zinc finger-like domain.
  • the Cpf1 protein has a RuvC-like
  • Cpf1 does not have a HNH endonuclease domain, and the N-terminal of Cpf1 does not have the alpha-helical recognition lobe of Cas9.
  • Cpf1 CRISPR-Cas domain architecture shows that Cpf1 is functionally unique, being classified as Class 2, type V CRISPR system.
  • the Cpf1 loci encode Cas1, Cas2 and Cas4 proteins more similar to types I and III than from type II systems.
  • Cpf1 doesn’t need the trans-activating CRISPR RNA (tracrRNA), therefore, only CRISPR (crRNA) is required. This benefits genome editing because Cpf1 is not only smaller than Cas9, but also it has a smaller sgRNA molecule (proximately half as many nucleotides as Cas9).
  • the Cpf1-crRNA complex cleaves target DNA or RNA by identification of a
  • Cpf1 introduces a sticky-end-like DNA double- stranded break of 4 or 5 nucleotides overhang.
  • fusion proteins comprising domains that act as nucleic acid programmable DNA binding proteins, which may be used to guide a protein, such as a base editor, to a specific nucleic acid (e.g., DNA or RNA) sequence.
  • a fusion protein comprises a nucleic acid programmable DNA binding protein domain and a deaminase domain.
  • DNA binding proteins include, without limitation, Cas9 (e.g., dCas9 and nCas9), Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, and Cas12i.
  • Cas9 e.g., dCas9 and nCas9
  • Cas9 e.g., dCas9 and nCas9
  • Cas9 e.g., dCas9 and nCas9
  • Cas9 e.g., dCas9 and nCas9
  • Cas9 e.g., dCas9 and nCas9
  • Cas12a/Cpfl Cas12b/C2cl
  • Cas12c/C2c3 Cas12d/CasY
  • Cpf1 Palindromic Repeats from Prevotella and Francisella1 (Cpf1). Similar to Cas9, Cpf1 is also a class 2 CRISPR effector. It has been shown that Cpf1 mediates robust DNA interference with features distinct from Cas9. Cpf1 is a single RNA-guided endonuclease lacking tracrRNA, and it utilizes a T-rich protospacer-adjacent motif (TTN, TTTN, or YTN). Moreover, Cpf1 cleaves DNA via a staggered DNA double-stranded break. Out of 16 Cpf1-family proteins, two enzymes from Acidaminococcus and Lachnospiraceae are shown to have efficient genome-editing activity in human cells.
  • Cpf1 proteins are known in the art and have been described previously, for example Yamano et al.,“Crystal structure of Cpf1 in complex with guide RNA and target DNA.” Cell (165) 2016, p.949-962; the entire contents of which is hereby incorporated by reference.
  • nuclease-inactive Cpf1 (dCpf1) variants that may be used as a guide nucleotide sequence-programmable polynucleotide-binding protein domain.
  • the Cpf1 protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9 but does not have a HNH endonuclease domain, and the N-terminal of Cpf1 does not have the alfa-helical recognition lobe of Cas9.
  • the RuvC-like domain of Cpf1 is responsible for cleaving both DNA strands and inactivation of the RuvC-like domain inactivates Cpf1 nuclease activity.
  • mutations corresponding to D917A, E1006A, or D1255A in Francisella novicida Cpf1 inactivate Cpf1 nuclease activity.
  • the dCpf1 of the present disclosure comprises mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or D917A/E1006A/D1255A. It is to be understood that any mutations, e.g., substitution mutations, deletions, or insertions that inactivate the RuvC domain of Cpf1, may be used in accordance with the present disclosure.
  • the nucleic acid programmable nucleotide binding protein of any of the fusion proteins provided herein may be a Cpf1 protein.
  • the Cpf1 protein is a Cpf1 nickase (nCpf1).
  • the Cpf1 protein is a nuclease inactive Cpf1 (dCpf1).
  • the Cpf1, the nCpf1, or the dCpf1 comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a Cpf1 sequence disclosed herein.
  • the dCpf1 comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a Cpf1 sequence disclosed herein, and comprises mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or
  • Cpf1 from other bacterial species may also be used in accordance with the present disclosure.
  • one of the Cas9 domains present in the fusion protein may be replaced with a guide nucleotide sequence-programmable DNA-binding protein domain that has no requirements for a PAM sequence.
  • the Cas domain is a Cas9 domain from Staphylococcus aureus (SaCas9).
  • the SaCas9 domain is a nuclease active SaCas9, a nuclease inactive SaCas9 (SaCas9d), or a SaCas9 nickase (SaCas9n).
  • the SaCas9 domain comprises a N579A mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM.
  • the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a NNGRRT or a NNGRRT PAM sequence.
  • the SaCas9 domain comprises one or more of a E781X, a N967X, and a R1014X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SaCas9 domain comprises one or more of a E781K, a N967K, and a R1014H mutation, or one or more corresponding mutation in any of the amino acid sequences provided herein.
  • the SaCas9 domain comprises a E781K, a N967K, or a R1014H mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • residue A579 which can be mutated from N579 to yield a SaCas9 nickase, is underlined and in bold.
  • Residue A579 above which can be mutated from N579 to yield a SaCas9 nickase, is underlined and in bold.
  • Residues K781, K967, and H1014 above which can be mutated from E781, N967, and R1014 to yield a SaKKH Cas9 are underlined and in italics. High fidelity Cas9 domains
  • high fidelity Cas9 domains are engineered Cas9 domains comprising one or more mutations that decrease electrostatic interactions between the Cas9 domain and the sugar- phosphate backbone of a DNA, relative to a corresponding wild-type Cas9 domain.
  • High fidelity Cas9 domains that have decreased electrostatic interactions with the sugar-phosphate backbone of DNA can have less off-target effects.
  • the Cas9 domain e.g., a wild type Cas9 domain
  • a Cas9 domain comprises one or more mutations that decreases the association between the Cas9 domain and the sugar-phosphate backbone of DNA by at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, or at least 70%.
  • any of the Cas9 fusion proteins provided herein comprise one or more of a N497X, a R661X, a Q695X, and/or a Q926X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • any of the Cas9 fusion proteins provided herein comprise one or more of a N497A, a R661A, a Q695A, and/or a Q926A mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the Cas9 domain comprises a D10A mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • Cas9 domains with high fidelity are known in the art and would be apparent to the skilled artisan. For example, Cas9 domains with high fidelity have been described in
  • the modified Cas9 is a high fidelity Cas9 enzyme.
  • the high fidelity Cas9 enzyme is SpCas9(K855A), eSpCas9(1.1), SpCas9-HF1, or hyper accurate Cas9 variant (HypaCas9).
  • the modified Cas9 eSpCas9(1.1) contains alanine substitutions that weaken the interactions between the HNH/RuvC groove and the non-target DNA strand, preventing strand separation and cutting at off-target sites.
  • SpCas9-HF1 lowers off-target editing through alanine substitutions that disrupt Cas9's interactions with the DNA phosphate backbone.
  • HypaCas9 contains mutations (SpCas9
  • N692A/M694A/Q695A/H698A in the REC3 domain that increase Cas9 proofreading and target discrimination. All three high fidelity enzymes generate less off-target editing than wildtype Cas9.
  • the term“guide polynucleotide(s)” refer to a polynucleotide which can be specific for a target sequence and can form a complex with a polynucleotide programmable nucleotide binding domain protein (e.g., Cas9 or Cpf1).
  • the guide polynucleotide is a guide RNA.
  • the term“guide RNA (gRNA)” and its grammatical equivalents can refer to an RNA which can be specific for a target DNA and can form a complex with Cas protein.
  • An RNA/Cas complex can assist in“guiding” Cas protein to a target DNA.
  • Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer.
  • the target strand not complementary to crRNA is first cut endonucleolytically, then trimmed 3’-5’ exonucleolytically.
  • DNA-binding and cleavage typically requires protein and both RNAs.
  • single guide RNAs (“sgRNA”, or simply“gNRA”) can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M. et al., Science 337:816-821(2012), the entire contents of which is hereby incorporated by reference.
  • Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self.
  • Cas9 nuclease sequences and structures are well known to those of skill in the art (see e.g.,“Complete genome sequence of an M1 strain of Streptococcus pyogenes.” Ferretti, J.J. et al., Natl. Acad. Sci. U.S.A.98:4658-4663(2001);“CRISPR RNA maturation by trans- encoded small RNA and host factor RNase III.” Deltcheva E.
  • Cas9 nucleases and sequences can be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier,“The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference.
  • a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain, that is, the Cas9 is a nickase.
  • the guide polynucleotide is at least one single guide RNA (“sgRNA” or“gNRA”). In some embodiments, the guide polynucleotide is at least one tracrRNA. In some embodiments, the guide polynucleotide does not require PAM sequence to guide the polynucleotide-programmable DNA-binding domain (e.g., Cas9 or Cpf1) to the target nucleotide sequence.
  • sgRNA single guide RNA
  • gNRA single guide RNA
  • the guide polynucleotide is at least one tracrRNA. In some embodiments, the guide polynucleotide does not require PAM sequence to guide the polynucleotide-programmable DNA-binding domain (e.g., Cas9 or Cpf1) to the target nucleotide sequence.
  • the polynucleotide programmable nucleotide binding domain (e.g., a CRISPR-derived domain) of the base editors disclosed herein can recognize a target polynucleotide sequence by associating with a guide polynucleotide.
  • a guide polynucleotide e.g., gRNA
  • a guide polynucleotide is typically single-stranded and can be programmed to site-specifically bind (i.e., via complementary base pairing) to a target sequence of a polynucleotide, thereby directing a base editor that is in conjunction with the guide nucleic acid to the target sequence.
  • a guide polynucleotide can be DNA.
  • a guide polynucleotide can be RNA.
  • the guide polynucleotide comprises natural nucleotides (e.g., adenosine). In some cases, the guide polynucleotide comprises non- natural (or unnatural) nucleotides (e.g., peptide nucleic acid or nucleotide analogs).
  • the targeting region of a guide nucleic acid sequence can be at least 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length. A targeting region of a guide nucleic acid can be between 10-30 nucleotides in length, or between 15-25 nucleotides in length, or between 15-20 nucleotides in length.
  • a guide polynucleotide comprises two or more individual polynucleotides, which can interact with one another via for example complementary base pairing (e.g. a dual guide polynucleotide).
  • a guide polynucleotide can comprise a CRISPR RNA (crRNA) and a trans-activating CRISPR RNA (tracrRNA).
  • a guide polynucleotide can comprise one or more trans-activating CRISPR RNA (tracrRNA).
  • Cas9 typically requires complementary base pairing between a first RNA molecule (crRNA) comprising a sequence that recognizes the target sequence and a second RNA molecule (trRNA) comprising repeat sequences which forms a scaffold region that stabilizes the guide RNA- CRISPR protein complex.
  • crRNA first RNA molecule
  • trRNA second RNA molecule
  • Such dual guide RNA systems can be employed as a guide polynucleotide to direct the base editors disclosed herein to a target polynucleotide sequence.
  • the base editor provided herein utilizes a single guide polynucleotide (e.g., gRNA). In some embodiments, the base editor provided herein utilizes a dual guide polynucleotide (e.g., dual gRNAs). In some embodiments, the base editor provided herein utilizes one or more guide polynucleotide (e.g., multiple gRNA). In some embodiments, a single guide polynucleotide is utilized for different base editors described herein. For example, a single guide polynucleotide can be utilized for a cytidine base editor and an adenosine base editor.
  • a single guide polynucleotide can be utilized for a cytidine base editor and an adenosine base editor.
  • a guide polynucleotide can comprise both the polynucleotide targeting portion of the nucleic acid and the scaffold portion of the nucleic acid in a single molecule (i.e., a single-molecule guide nucleic acid).
  • a single-molecule guide polynucleotide can be a single guide RNA (sgRNA or gRNA).
  • sgRNA or gRNA single guide RNA
  • guide polynucleotide sequence contemplates any single, dual or multi-molecule nucleic acid capable of interacting with and directing a base editor to a target polynucleotide sequence.
  • a guide polynucleotide (e.g., crRNA/trRNA complex or a gRNA) comprises a“polynucleotide-targeting segment” that includes a sequence capable of recognizing and binding to a target polynucleotide sequence, and a“protein-binding segment” that stabilizes the guide polynucleotide within a polynucleotide programmable nucleotide binding domain component of a base editor.
  • the polynucleotide targeting segment of the guide polynucleotide recognizes and binds to a DNA polynucleotide, thereby facilitating the editing of a base in DNA.
  • the polynucleotide targeting segment of the guide polynucleotide recognizes and binds to an RNA polynucleotide, thereby facilitating the editing of a base in RNA.
  • a“segment” refers to a section or region of a molecule, e.g., a contiguous stretch of nucleotides in the guide polynucleotide.
  • a segment can also refer to a region/section of a complex such that a segment can comprise regions of more than one molecule.
  • a protein-binding segment of a DNA-targeting RNA that comprises two separate molecules can comprise (i) base pairs 40-75 of a first RNA molecule that is 100 base pairs in length; and (ii) base pairs 10-25 of a second RNA molecule that is 50 base pairs in length.
  • RNA molecules are of any total length and can include regions with complementarity to other molecules.
  • a guide RNA or a guide polynucleotide can comprise two or more RNAs, e.g., CRISPR RNA (crRNA) and transactivating crRNA (tracrRNA).
  • crRNA CRISPR RNA
  • tracrRNA transactivating crRNA
  • a guide RNA or a guide polynucleotide can sometimes comprise a single-chain RNA, or single guide RNA (sgRNA) formed by fusion of a portion (e.g., a functional portion) of crRNA and tracrRNA.
  • sgRNA single guide RNA
  • a guide RNA or a guide polynucleotide can also be a dual RNA comprising a crRNA and a tracrRNA.
  • a crRNA can hybridize with a target DNA.
  • a guide RNA or a guide polynucleotide can be an expression product.
  • a DNA that encodes a guide RNA can be a vector comprising a sequence coding for the guide RNA.
  • a guide RNA or a guide polynucleotide can be transferred into a cell by transfecting the cell with an isolated guide RNA or plasmid DNA comprising a sequence coding for the guide RNA and a promoter.
  • a guide RNA or a guide polynucleotide can also be transferred into a cell in other way, such as using virus-mediated gene delivery.
  • a guide RNA or a guide polynucleotide can be isolated.
  • a guide RNA can be transfected in the form of an isolated RNA into a cell or organism.
  • a guide RNA can be prepared by in vitro transcription using any in vitro transcription system known in the art.
  • a guide RNA can be transferred to a cell in the form of isolated RNA rather than in the form of plasmid comprising encoding sequence for a guide RNA.
  • a guide RNA or a guide polynucleotide can comprise three regions: a first region at the 5’ end that can be complementary to a target site in a chromosomal sequence, a second internal region that can form a stem loop structure, and a third 3’ region that can be single- stranded.
  • a first region of each guide RNA can also be different such that each guide RNA guides a fusion protein to a specific target site.
  • second and third regions of each guide RNA can be identical in all guide RNAs.
  • a first region of a guide RNA or a guide polynucleotide can be complementary to sequence at a target site in a chromosomal sequence such that the first region of the guide RNA can base pair with the target site.
  • a first region of a guide RNA can comprise from or from about 10 nucleotides to 25 nucleotides (i.e., from 10 nucleotides to nucleotides; or from about 10 nucleotides to about 25 nucleotides; or from 10 nucleotides to about 25 nucleotides; or from about 10 nucleotides to 25 nucleotides) or more.
  • a region of base pairing between a first region of a guide RNA and a target site in a chromosomal sequence can be or can be about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 25, or more nucleotides in length.
  • a first region of a guide RNA can be or can be about 19, 20, or 21 nucleotides in length.
  • a guide RNA or a guide polynucleotide can also comprise a second region that forms a secondary structure.
  • a secondary structure formed by a guide RNA can comprise a stem (or hairpin) and a loop.
  • a length of a loop and a stem can vary.
  • a loop can range from or from about 3 to 10 nucleotides in length
  • a stem can range from or from about 6 to 20 base pairs in length.
  • a stem can comprise one or more bulges of 1 to 10 or about 10 nucleotides.
  • the overall length of a second region can range from or from about 16 to 60 nucleotides in length.
  • a loop can be or can be about 4 nucleotides in length and a stem can be or can be about 12 base pairs.
  • a guide RNA or a guide polynucleotide can also comprise a third region at the 3' end that can be essentially single-stranded.
  • a third region is sometimes not complementarity to any chromosomal sequence in a cell of interest and is sometimes not complementarity to the rest of a guide RNA.
  • the length of a third region can vary.
  • a third region can be more than or more than about 4 nucleotides in length.
  • the length of a third region can range from or from about 5 to 60 nucleotides in length.
  • a guide RNA or a guide polynucleotide can target any exon or intron of a gene target.
  • a guide can target exon 1 or 2 of a gene, in other cases; a guide can target exon 3 or 4 of a gene.
  • a composition can comprise multiple guide RNAs that all target the same exon or in some cases, multiple guide RNAs that can target different exons. An exon and an intron of a gene can be targeted.
  • a guide RNA or a guide polynucleotide can target a nucleic acid sequence of or of about 20 nucleotides.
  • a target nucleic acid can be less than or less than about 20 nucleotides.
  • a target nucleic acid can be at least or at least about 5, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, or anywhere between 1-100 nucleotides in length.
  • a target nucleic acid can be at most or at most about 5, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 40, 50, or anywhere between 1-100 nucleotides in length.
  • a target nucleic acid sequence can be or can be about 20 bases immediately 5’ of the first nucleotide of the PAM.
  • a guide RNA can target a nucleic acid sequence.
  • a target nucleic acid can be at least or at least about 1-10, 1-20, 1-30, 1-40, 1-50, 1- 60, 1-70, 1-80, 1-90, or 1-100 nucleotides.
  • a guide polynucleotide for example, a guide RNA, can refer to a nucleic acid that can hybridize to another nucleic acid, for example, the target nucleic acid or protospacer in a genome of a cell.
  • a guide polynucleotide can be RNA.
  • a guide polynucleotide can be DNA.
  • the guide polynucleotide can be programmed or designed to bind to a sequence of nucleic acid site-specifically.
  • a guide polynucleotide can comprise a polynucleotide chain and can be called a single guide polynucleotide.
  • a guide polynucleotide can comprise two polynucleotide chains and can be called a double guide polynucleotide.
  • a guide RNA can be introduced into a cell or embryo as an RNA molecule.
  • a RNA molecule can be transcribed in vitro and/or can be chemically synthesized.
  • An RNA can be transcribed from a synthetic DNA molecule, e.g., a gBlocks® gene fragment.
  • a guide RNA can then be introduced into a cell or embryo as an RNA molecule.
  • a guide RNA can also be introduced into a cell or embryo in the form of a non-RNA nucleic acid molecule, e.g., DNA molecule.
  • a DNA encoding a guide RNA can be operably linked to promoter control sequence for expression of the guide RNA in a cell or embryo of interest.
  • a RNA coding sequence can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III).
  • Plasmid vectors that can be used to express guide RNA include, but are not limited to, px330 vectors and px333 vectors.
  • a plasmid vector (e.g., px333 vector) can comprise at least two guide RNA-encoding DNA sequences.
  • unintentionally be targeted for deamination may be minimized.
  • software tools can be used to optimize the gRNAs corresponding to a target nucleic acid sequence, e.g., to minimize total off-target activity across the genome. For example, for each possible targeting domain choice using S. pyogenes Cas9, all off-target sequences (preceding selected PAMs, e.g. NAG or NGG) may be identified across the genome that contain up to certain number (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of mismatched base-pairs.
  • First regions of gRNAs complementary to a target site can be identified, and all first regions (e.g. crRNAs) can be ranked according to its total predicted off-target score; the top-ranked targeting domains represent those that are likely to have the greatest on-target and the least off-target activity.
  • candidate targeting gRNAs can be functionally evaluated by using methods known in the art and/or as set forth herein.
  • target DNA hybridizing sequences in crRNAs of a guide RNA for use with Cas9s may be identified using a DNA sequence searching algorithm.
  • gRNA design may be carried out using custom gRNA design software based on the public tool cas- offinder as described in Bae S., Park J., & Kim J.-S. Cas-OFFinder: A fast and versatile algorithm that searches for potential off-target sites of Cas9 RNA-guided endonucleases. Bioinformatics 30, 1473-1475 (2014). This software scores guides after calculating their genome-wide off-target propensity. Typically matches ranging from perfect matches to 7 mismatches are considered for guides ranging in length from 17 to 24.
  • an aggregate score is calculated for each guide and summarized in a tabular output using a web-interface.
  • the software also identifies all PAM adjacent sequences that differ by 1, 2, 3 or more than 3 nucleotides from the selected target sites.
  • Genomic DNA sequences for a target nucleic acid sequence e.g. a target gene may be obtained and repeat elements may be screened using publically available tools, for example, the RepeatMasker program. RepeatMasker searches input DNA sequences for repeated elements and regions of low complexity. The output is a detailed annotation of the repeats present in a given query sequence.
  • first regions of guide RNAs may be ranked into tiers based on their distance to the target site, their orthogonality and presence of 5’ nucleotides for close matches with relevant PAM sequences (for example, a 5 G based on identification of close matches in the human genome containing a relevant PAM e.g., NGG PAM for S.
  • relevant PAM sequences for example, a 5 G based on identification of close matches in the human genome containing a relevant PAM e.g., NGG PAM for S.
  • orthogonality refers to the number of sequences in the human genome that contain a minimum number of mismatches to the target sequence.
  • A“high level of orthogonality” or“good orthogonality” may, for example, refer to 20-mer targeting domains that have no identical sequences in the human genome besides the intended target, nor any sequences that contain one or two mismatches in the target sequence. Targeting domains with good orthogonality may be selected to minimize off-target DNA cleavage.
  • a reporter system may be used for detecting base-editing activity and testing candidate guide polynucleotides.
  • a reporter system may comprise a reporter gene based assay where base editing activity leads to expression of the reporter gene.
  • a reporter system may include a reporter gene comprising a deactivated start codon, e.g., a mutation on the template strand from 3'-TAC-5' to 3'-CAC-5'. Upon successful deamination of the target C, the corresponding mRNA will be transcribed as 5'- AUG-3' instead of 5'-GUG-3', enabling the translation of the reporter gene.
  • Suitable reporter genes will be apparent to those of skill in the art.
  • Non-limiting examples of reporter genes include gene encoding green fluorescence protein (GFP), red fluorescence protein (RFP), luciferase, secreted alkaline phosphatase (SEAP), or any other gene whose expression are detectable and apparent to those skilled in the art.
  • the reporter system can be used to test many different gRNAs, e.g., in order to determine which residue(s) with respect to the target DNA sequence the respective deaminase will target.
  • sgRNAs that target non-template strand can also be tested in order to assess off-target effects of a specific base editing protein, e.g. a Cas9 deaminase fusion protein.
  • gRNAs can be designed such that the mutated start codon will not be base-paired with the gRNA.
  • the guide polynucleotides can comprise standard ribonucleotides, modified ribonucleotides (e.g., pseudouridine),
  • the guide polynucleotide can comprise at least one detectable label.
  • the detectable label can be a fluorophore (e.g., FAM, TMR, Cy3, Cy5, Texas Red, Oregon Green, Alexa Fluors, Halo tags, or suitable fluorescent dye), a detection tag (e.g., biotin, digoxigenin, and the like), quantum dots, or gold particles.
  • the guide polynucleotides can be synthesized chemically, synthesized enzymatically, or a combination thereof.
  • the guide RNA can be synthesized using standard phosphoramidite-based solid-phase synthesis methods.
  • the guide RNA can be synthesized in vitro by operably linking DNA encoding the guide RNA to a promoter control sequence that is recognized by a phage RNA polymerase. Examples of suitable phage promoter sequences include T7, T3, SP6 promoter sequences, or variations thereof.
  • the guide RNA comprises two separate molecules (e.g.., crRNA and tracrRNA)
  • the crRNA can be chemically synthesized and the tracrRNA can be enzymatically synthesized.
  • a base editor system may comprise multiple guide
  • polynucleotides e.g. gRNAs.
  • the gRNAs may target to one or more target loci (e.g., at least 1 gRNA, at least 2 gRNA, at least 5 gRNA, at least 10 gRNA, at least 20 gRNA, at least 30 g RNA, at least 50 gRNA) comprised in a base editor system.
  • target loci e.g., at least 1 gRNA, at least 2 gRNA, at least 5 gRNA, at least 10 gRNA, at least 20 gRNA, at least 30 g RNA, at least 50 gRNA
  • Said multiple gRNA sequences can be tandemly arranged and are preferably separated by a direct repeat.
  • a DNA sequence encoding a guide RNA or a guide polynucleotide can also be part of a vector. Further, a vector can comprise additional expression control sequences (e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.), selectable marker sequences (e.g., GFP or antibiotic resistance genes such as puromycin), origins of replication, and the like.
  • a DNA molecule encoding a guide RNA can also be linear.
  • a DNA molecule encoding a guide RNA or a guide polynucleotide can also be circular.
  • one or more components of a base editor system may be encoded by DNA sequences.
  • DNA sequences may be introduced into an expression system, e.g. a cell, together or separately.
  • each DNA sequence can be part of a separate molecule (e.g., one vector containing the polynucleotide programmable nucleotide binding domain coding sequence and a second vector containing the guide RNA coding sequence) or both can be part of a same molecule (e.g., one vector containing coding (and regulatory) sequence for both the polynucleotide programmable nucleotide binding domain and the guide RNA).
  • a guide polynucleotide can comprise one or more modifications to provide a nucleic acid with a new or enhanced feature.
  • a guide polynucleotide can comprise a nucleic acid affinity tag.
  • a guide polynucleotide can comprise synthetic nucleotide, synthetic nucleotide analog, nucleotide derivatives, and/or modified nucleotides.
  • a gRNA or a guide polynucleotide can comprise modifications.
  • a modification can be made at any location of a gRNA or a guide polynucleotide. More than one modification can be made to a single gRNA or a guide polynucleotide.
  • a gRNA or a guide polynucleotide can undergo quality control after a modification. In some cases, quality control can include PAGE, HPLC, MS, or any combination thereof.
  • a modification of a gRNA or a guide polynucleotide can be a substitution, insertion, deletion, chemical modification, physical modification, stabilization, purification, or any combination thereof.
  • a gRNA or a guide polynucleotide can also be modified by 5’adenylate, 5’ guanosine- triphosphate cap, 5’N7-Methylguanosine-triphosphate cap, 5’triphosphate cap, 3’phosphate, 3’thiophosphate, 5’phosphate, 5’thiophosphate, Cis-Syn thymidine dimer, trimers, C12 spacer, C3 spacer, C6 spacer, dSpacer, PC spacer, rSpacer, Spacer 18, Spacer 9,3’-3’ modifications, 5’- 5’ modifications, abasic, acridine, azobenzene, biotin, biotin BB, biotin TEG, cholesteryl TEG, desthiobiotin TEG, DNP TEG, DNP-X, DOTA, dT-Biotin, dual biotin, PC biotin, psoralen C2, psoralen C6, TINA
  • methylphosphonate methylphosphonate, phosphodiester DNA, phosphodiester RNA, phosphothioate DNA, phosphorothioate RNA, UNA, pseudouridine-5’-triphosphate, 5’-methylcytidine-5’- triphosphate, or any combination thereof.
  • a modification is permanent. In other cases, a modification is transient. In some cases, multiple modifications are made to a gRNA or a guide polynucleotide.
  • a gRNA or a guide polynucleotide modification can alter physiochemical properties of a nucleotide, such as their conformation, polarity, hydrophobicity, chemical reactivity, base-pairing interactions, or any combination thereof.
  • a modification can also be a phosphorothioate substitute.
  • a natural phosphodiester bond can be susceptible to rapid degradation by cellular nucleases and; a modification of internucleotide linkage using phosphorothioate (PS) bond substitutes can be more stable towards hydrolysis by cellular degradation.
  • PS phosphorothioate
  • a modification can increase stability in a gRNA or a guide polynucleotide.
  • a modification can also enhance biological activity.
  • a phosphorothioate enhanced RNA gRNA can inhibit RNase A, RNase T1, calf serum nucleases, or any combinations thereof.
  • PS-RNA gRNAs can be used in applications where exposure to nucleases is of high probability in vivo or in vitro.
  • phosphorothioate (PS) bonds can be introduced between the last 3-5 nucleotides at the 5’- or‘'-end of a gRNA which can inhibit exonuclease degradation.
  • phosphorothioate bonds can be added throughout an entire gRNA to reduce attack by endonucleases.
  • PAM protospacer adjacent motif
  • PAM-like motif refers to a 2-6 base pair DNA sequence immediately following the DNA sequence targeted by the Cas9 nuclease in the CRISPR bacterial adaptive immune system.
  • the PAM can be a 5’ PAM (i.e., located upstream of the 5’ end of the protospacer).
  • the PAM can be a 3’ PAM (i.e., located downstream of the 5’ end of the protospacer).
  • the protospacer adjacent motif (PAM) or PAM-like motif refers to a 2-6 base pair DNA sequence immediately following the DNA sequence targeted by the Cas9 nuclease in the CRISPR bacterial adaptive immune system.
  • the PAM can be a 5’ PAM (i.e., located upstream of the 5’ end of the protospacer).
  • the PAM can be a 3’ PAM (i.e., located downstream of the 5’ end of the protospacer).
  • the PAM sequence is essential for target binding, but the exact sequence depends on a type of Cas protein.
  • a base editor provided herein can comprise a CRISPR protein-derived domain that is capable of binding a nucleotide sequence that contains a canonical or non-canonical protospacer adjacent motif (PAM) sequence.
  • a PAM site is a nucleotide sequence in proximity to a target polynucleotide sequence.
  • pyogenes require a canonical NGG PAM sequence to bind a particular nucleic acid region, where the“N” in“NGG” is adenine (A), thymine (T), guanine (G), or cytosine (C), and the G is guanine.
  • a PAM can be CRISPR protein-specific and can be different between different base editors comprising different CRISPR protein-derived domains.
  • a PAM can be 5’ or 3’ of a target sequence.
  • a PAM can be upstream or downstream of a target sequence.
  • a PAM can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more nucleotides in length. Often, a PAM is between 2-6 nucleotides in length.
  • the Cas9 domain is a Cas9 domain from Streptococcus pyogenes (SpCas9).
  • the SpCas9 domain is a nuclease active SpCas9, a nuclease inactive SpCas9 (SpCas9d), or a SpCas9 nickase (SpCas9n).
  • the SpCas9 comprises a D9X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid except for D.
  • the SpCas9 comprises a D9A mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM.
  • the SpCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having an NGG, a NGA, or a NGCG PAM sequence.
  • the SpCas9 domain comprises one or more of a D1135X, a R1335X, and a T1336X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SpCas9 domain comprises one or more of a D1135E, R1335Q, and T1336R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises a D1135E, a R1335Q, and a T1336R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises one or more of a D1135X, a R1335X, and a T1336X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SpCas9 domain comprises one or more of a D1135V, a R1335Q, and a T1336R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises a D1135V, a R1335Q, and a T1336R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises one or more of a D1135X, a G1217X, a R1335X, and a T1336X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SpCas9 domain comprises one or more of a D1135V, a G1217R, a R1335Q, and a T1336R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises a D1135V, a G1217R, a R1335Q, and a T1336R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • the Cas9 domains of any of the fusion proteins provided herein comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a Cas9 polypeptide described herein.
  • the Cas9 domains of any of the fusion proteins provided herein comprises the amino acid sequence of any Cas9 polypeptide described herein.
  • the Cas9 domains of any of the fusion proteins provided herein consists of the amino acid sequence of any Cas9 polypeptide described herein.
  • amino acid sequence of an exemplary PAM-binding SpCas9 is as follows:
  • amino acid sequence of an exemplary PAM-binding SpCas9n is as follows:
  • amino acid sequence of an exemplary PAM-binding SpEQR Cas9 is as follows:
  • amino acid sequence of an exemplary PAM-binding SpVQR Cas9 is as follows:
  • the Cas9 domain is a recombinant Cas9 domain.
  • the recombinant Cas9 domain is a SpyMacCas9 domain.
  • the SpyMacCas9 domain is a nuclease active SpyMacCas9, a nuclease inactive SpyMacCas9 (SpyMacCas9d), or a SpyMacCas9 nickase (SpyMacCas9n).
  • the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM.
  • the SpyMacCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having a NAA PAM sequence.
  • a variant Cas9 protein harbors, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1218A mutations such that the polypeptide has a reduced ability to cleave a target DNA or RNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors D10A, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1218A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein when a variant Cas9 protein harbors W476A and W1126A mutations or when the variant Cas9 protein harbors P475A, W476A, N477A, D1125A, W1126A, and D1218A mutations, the variant Cas9 protein does not bind efficiently to a PAM sequence. Thus, in some such cases, when such a variant Cas9 protein is used in a method of binding, the method does not require a PAM sequence.
  • the method when such a variant Cas9 protein is used in a method of binding, can include a guide RNA, but the method can be performed in the absence of a PAM sequence (and the specificity of binding is therefore provided by the targeting segment of the guide RNA).
  • Other residues can be mutated to achieve the above effects (i.e., inactivate one or the other nuclease portions).
  • residues D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or A987 can be altered (i.e., substituted).
  • mutations other than alanine substitutions are suitable.
  • a CRISPR protein-derived domain of a base editor can comprise all or a portion of a Cas9 protein with a canonical PAM sequence (NGG).
  • NGS canonical PAM sequence
  • a Cas9-derived domain of a base editor can employ a non-canonical PAM sequence.
  • Such sequences have been described in the art and would be apparent to the skilled artisan.
  • Cas9 domains that bind non-canonical PAM sequences have been described in Kleinstiver, B. P., et al.,“Engineered CRISPR-Cas9 nucleases with altered PAM specificities” Nature 523, 481-485 (2015); and Kleinstiver, B. P., et al.,“Broadening the targeting range of Staphylococcus aureus CRISPR-Cas9 by modifying PAM recognition” Nature Biotechnology 33, 1293-1298 (2015); the entire contents of each are hereby incorporated by reference.
  • a PAM recognized by a CRISPR protein-derived domain of a base editor disclosed herein can be provided to a cell on a separate oligonucleotide to an insert (e.g. an AAV insert) encoding the base editor.
  • an insert e.g. an AAV insert
  • providing PAM on a separate oligonucleotide can allow cleavage of a target sequence that otherwise would not be able to be cleaved, because no adjacent PAM is present on the same polynucleotide as the target sequence.
  • S. pyogenes Cas9 can be used as a CRISPR endonuclease for genome engineering. However, others can be used. In some cases, a different endonuclease can be used to target certain genomic targets. In some cases, synthetic SpCas9-derived variants with non-NGG PAM sequences can be used. Additionally, other Cas9 orthologues from various species have been identified and these“non-SpCas9s” can bind a variety of PAM sequences that can also be useful for the present disclosure.
  • the relatively large size of SpCas9 can lead to plasmids carrying the SpCas9 cDNA that cannot be efficiently expressed in a cell.
  • the coding sequence for Staphylococcus aureus Cas9 (SaCas9) is approximately 1 kilo base shorter than SpCas9, possibly allowing it to be efficiently expressed in a cell.
  • the SaCas9 endonuclease is capable of modifying target genes in mammalian cells in vitro and in mice in vivo.
  • a Cas protein can target a different PAM sequence.
  • a target gene can be adjacent to a Cas9 PAM, 5’-NGG, for example.
  • Cas9 orthologs can have different PAM requirements.
  • other PAMs such as those of S. thermophilus (5’-NNAGAA for CRISPR1 and 5’-NGGNG for CRISPR3) and Neisseria meningiditis (5’-NNNNGATT) can also be found adjacent to a target gene.
  • a target gene sequence can precede (i.e., be 5’ to) a 5’-NGG PAM, and a 20-nt guide RNA sequence can base pair with an opposite strand to mediate a Cas9 cleavage adjacent to a PAM.
  • an adjacent cut can be or can be about 3 base pairs upstream of a PAM.
  • an adjacent cut can be or can be about 10 base pairs upstream of a PAM.
  • an adjacent cut can be or can be about 0- 20 base pairs upstream of a PAM.
  • an adjacent cut can be next to, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 base pairs upstream of a PAM.
  • An adjacent cut can also be downstream of a PAM by 1 to 30 base pairs.
  • Fusion proteins comprising a nuclear localization sequence (NLS)
  • the fusion proteins provided herein further comprise one or more (e.g., 2, 3, 4, 5) nuclear targeting sequences, for example a nuclear localization sequence (NLS).
  • a nuclear localization sequence for example a nuclear localization sequence (NLS).
  • a bipartite NLS is used.
  • a NLS comprises an amino acid sequence that facilitates the importation of a protein, that comprises an NLS, into the cell nucleus (e.g., by nuclear transport).
  • any of the fusion proteins provided herein further comprise a nuclear localization sequence (NLS).
  • the NLS is fused to the N-terminus of the fusion protein.
  • the NLS is fused to the C-terminus of the fusion protein.
  • the NLS is fused to the N-terminus of the Cas9 domain. In some embodiments, the NLS is fused to the C-terminus of an nCas9 domain or a dCas9 domain. In some embodiments, the NLS is fused to the N-terminus of the deaminase. In some embodiments, the NLS is fused to the C-terminus of the deaminase. In some embodiments, the NLS is fused to the fusion protein via one or more linkers. In some embodiments, the NLS is fused to the fusion protein without a linker. In some embodiments, the NLS comprises an amino acid sequence of any one of the NLS sequences provided or referenced herein. Additional nuclear localization sequences are known in the art and would be apparent to the skilled artisan. For example, NLS sequences are described in Plank et al.,
  • an NLS comprises the amino acid sequence PKKKRKVEGADKRTADGSEFESPKKKRKV,
  • KRTADGSEFESPKKKRKV KRPAATKKAGQAKKKK, KKTELQTTNAENKTKKL, KRGINDRNFWRGENGRKTR, RKSGKIAAIVVKRPRKPKKKRKV, or
  • the NLS is present in a linker or the NLS is flanked by linkers, for example, the linkers described herein.
  • the N-terminus or C-terminus NLS is a bipartite NLS.
  • a bipartite NLS comprises two basic amino acid clusters, which are separated by a relatively short spacer sequence (hence bipartite - 2 parts, while monopartite NLSs are not).
  • KR[PAATKKAGQA]KKKK is the prototype of the ubiquitous bipartite signal: two clusters of basic amino acids, separated by a spacer of about 10 amino acids.
  • the sequence of an exemplary bipartite NLS follows: PKKKRKVEGADKRTADGSEFES PKKKRKV.
  • the fusion proteins of the invention do not comprise a linker sequence. In some embodiments, linker sequences between one or more of the domains or proteins are present.
  • the fusion proteins of the present disclosure may comprise one or more additional features.
  • the fusion protein may comprise inhibitors, cytoplasmic localization sequences, export sequences, such as nuclear export sequences, or other localization sequences, as well as sequence tags that are useful for solubilization, purification, or detection of the fusion proteins.
  • Suitable protein tags include, but are not limited to, biotin carboxylase carrier protein (BCCP) tags, myc-tags, calmodulin-tags, FLAG-tags, hemagglutinin (HA)-tags, polyhistidine tags, also referred to as histidine tags or His-tags, maltose binding protein (MBP)-tags, nus-tags, glutathione-S- transferase (GST)-tags, green fluorescent protein (GFP)-tags, thioredoxin-tags, S-tags, Softags (e.g., Softag 1, Softag 3), strep-tags , biotin ligase tags, FlAsH tags, V5 tags, and SBP-tags. Additional suitable sequences will be apparent to those of skill in the art.
  • the fusion protein comprises one or more His tags.
  • a vector that encodes a CRISPR enzyme comprising one or more nuclear localization sequences can be used.
  • NLSs nuclear localization sequences
  • a CRISPR enzyme can comprise the NLSs at or near the ammo-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 NLSs at or near the carboxy-terminus, or any combination of these (e.g., one or more NLS at the ammo-terminus and one or more NLS at the carboxy terminus).
  • each can be selected independently of others, such that a single NLS can be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies.
  • CRISPR enzymes used in the methods can comprise about 6 NLSs.
  • An NLS is considered near the N- or C-terminus when the nearest amino acid to the NLS is within about 50 amino acids along a polypeptide chain from the N- or C-terminus, e.g., within 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, or 50 amino acids.
  • an NLS comprises the amino acid sequence
  • KRPAATKKAGQAKKKK KKTELQTTNAENKTKKL
  • KRGINDRNFWRGENGRKTR RKSGKIAAIVVKRPRKPKKKRKV
  • MDSLLMNRRKFLYQFKNVRWAKGRRETYLC MDSLLMNRRKFLYQFKNVRWAKGRRETYLC.
  • the NLS is present in a linker or the NLS is flanked by linkers, for example, the linkers described herein.
  • the N-terminus or C-terminus NLS is a bipartite NLS.
  • a bipartite NLS comprises two basic amino acid clusters, which are separated by a relatively short spacer sequence (hence bipartite - 2 parts, while monopartite NLSs are not).
  • the NLS of nucleoplasmin, KR[PAATKKAGQA]KKKK is the prototype of the ubiquitous bipartite signal: two clusters of basic amino acids, separated by a spacer of about 10 amino acids.
  • the sequence of an exemplary bipartite NLS follows:
  • PKKKRKVEGADKRTADGSEFES PKKKRKV PKKKRKV.
  • the fusion proteins of the invention do not comprise a linker sequence. In some embodiments, linker sequences between one or more of the domains or proteins are present.
  • the PAM sequence can be any PAM sequence known in the art. Suitable PAM sequences include, but are not limited to, NGG, NGA, NGC, NGN, NGT, NGCG, NGAG, NGAN, NGNG, NGCN, NGCG, NGTN, NNGRRT, NNNRRT, NNGRR(N), TTTV, TYCV, TYCV, TATV, NNNNGATT, NNAGAAW, or NAAAAC.
  • Y is a pyrimidine; N is any nucleotide base; W is A or T.
  • base editors comprising a fusion protein that includes a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain (e.g., deaminase domain).
  • the base editor can be programmed to edit one or more bases in a target polynucleotide sequence by interacting with a guide polynucleotide capable of recognizing the target sequence. Once the target sequence has been recognized, the base editor is anchored on the polynucleotide where editing is to occur and the deaminase domain component of the base editor can then edit a target base.
  • the nucleobase editing domain is a deaminase domain.
  • a deaminase domain can be a cytosine deaminase or a cytidine deaminase.
  • the terms“cytosine deaminase” and“cytidine deaminase” can be used
  • a deaminase domain can be an adenine deaminase or an adenosine deaminase.
  • the terms“adenine deaminase” and“adenosine deaminase” can be used interchangeably. Details of nucleobase editing proteins are described in International PCT Application Nos. PCT/2017/045381 (WO2018/027078) and PCT/US2016/058344 (WO2017/070632), each of which is incorporated herein by reference for its entirety.
  • a base editor disclosed herein comprises a fusion protein comprising cytidine deaminase capable of deaminating a target cytidine (C) base of a polynucleotide to produce uridine (U), which has the base pairing properties of thymine.
  • the uridine base can then be substituted with a thymidine base (e.g. by cellular repair machinery) to give rise to a C:G to a T:A transition.
  • deamination of a C to U in a nucleic acid by a base editor cannot be accompanied by substitution of the U to a T.
  • the deamination of a target C in a polynucleotide to give rise to a U is a non-limiting example of a type of base editing that can be executed by a base editor described herein.
  • a base editor comprising a cytidine deaminase domain can mediate conversion of a cytosine (C) base to a guanine (G) base.
  • a U of a polynucleotide produced by deamination of a cytidine by a cytidine deaminase domain of a base editor can be excised from the polynucleotide by a base excision repair mechanism (e.g., by a uracil DNA glycosylase (UDG) domain), producing an abasic site.
  • the nucleobase opposite the abasic site can then be substituted (e.g. by base repair machinery) with another base, such as a C, by for example a translesion polymerase.
  • base repair machinery e.g. by base repair machinery
  • substitutions e.g. A, G or T
  • substitutions e.g. A, G or T
  • a base editor described herein comprises a deamination domain (e.g., cytidine deaminase domain) capable of deaminating a target C to a U in a polynucleotide.
  • the base editor can comprise additional domains which facilitate conversion of the U resulting from deamination to, in some embodiments, a T or a G.
  • a base editor comprising a cytidine deaminase domain can further comprise a uracil glycosylase inhibitor (UGI) domain to mediate substitution of a U by a T, completing a C-to-T base editing event.
  • UMI uracil glycosylase inhibitor
  • a base editor can incorporate a translesion polymerase to improve the efficiency of C-to-G base editing, since a translesion polymerase can facilitate incorporation of a C opposite an abasic site (i.e., resulting in incorporation of a G at the abasic site, completing the C-to-G base editing event).
  • a base editor comprising a cytidine deaminase as a domain can deaminate a target C in any polynucleotide, including DNA, RNA and DNA-RNA hybrids.
  • a cytidine deaminase catalyzes a C nucleobase that is positioned in the context of a single-stranded portion of a polynucleotide.
  • the entire polynucleotide comprising a target C can be single-stranded.
  • a cytidine deaminase incorporated into the base editor can deaminate a target C in a single-stranded RNA polynucleotide.
  • a base editor comprising a cytidine deaminase domain can act on a double-stranded polynucleotide, but the target C can be positioned in a portion of the polynucleotide which at the time of the deamination reaction is in a single-stranded state.
  • the NAGPB domain comprises a Cas9 domain
  • several nucleotides can be left unpaired during formation of the Cas9-gRNA-target DNA complex, resulting in formation of a Cas9“R-loop complex”.
  • These unpaired nucleotides can form a bubble of single-stranded DNA that can serve as a substrate for a single-strand specific nucleotide deaminase enzyme (e.g., cytidine deaminase).
  • a single-strand specific nucleotide deaminase enzyme e.g., cytidine deaminase
  • a cytidine deaminase of a base editor can comprise all or a portion of an apolipoprotein B mRNA editing complex (APOBEC) family deaminase.
  • APOBEC apolipoprotein B mRNA editing complex
  • APOBEC is a family of evolutionarily conserved cytidine deaminases. Members of this family are C-to-U editing enzymes.
  • the N-terminal domain of APOBEC like proteins is the catalytic domain, while the C-terminal domain is a pseudocatalytic domain. More specifically, the catalytic domain is a zinc dependent cytidine deaminase domain and is important for cytidine deamination.
  • APOBEC family members include APOBEC1, APOBEC2, APOBEC3A,
  • a deaminase incorporated into a base editor comprises all or a portion of an APOBEC1 deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of APOBEC2 deaminase.
  • a deaminase incorporated into a base editor comprises all or a portion of is an APOBEC3 deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of an APOBEC3A deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of APOBEC3B deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of APOBEC3C deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of
  • a deaminase incorporated into a base editor comprises all or a portion of APOBEC3E deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of APOBEC3F deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of
  • a deaminase incorporated into a base editor comprises all or a portion of APOBEC3H deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of APOBEC4 deaminase. In some embodiments, a deaminase incorporated into a base editor comprises all or a portion of activation-induced deaminase (AID). In some embodiments a deaminase incorporated into a base editor comprises all or a portion of cytidine deaminase 1 (CDA1).
  • CDA1 cytidine deaminase 1
  • a base editor can comprise a deaminase from any suitable organism (e.g., a human or a rat).
  • a deaminase domain of a base editor is from a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse.
  • the deaminase domain of the base editor is derived from rat (e.g., rat APOBEC1).
  • the deaminase domain of the base editor is human APOBEC1.
  • the deaminase domain of the base editor is pmCDA1.
  • CDS coding sequence
  • AID human activation- induced cytidine deaminase
  • Nucleic acid sequence >NG_011588.1:5001-15681 Homo sapiens activation induced cytidine deaminase (AICDA), RefSeqGene (LRG_17) on chromosome 12:
  • the active domain of the respective sequence can be used, e.g., the domain without a localizing signal (nuclear localization sequence, without nuclear export signal, cytoplasmic localizing signal).
  • Dog AID
  • Bovine AID [0306]
  • Green monkey APOBEC-3G [0312] Green monkey APOBEC-3G:
  • Bovine APOBEC-3B [0317] Bovine APOBEC-3B:
  • Bovine APOBEC-3A [0323]
  • Bovine APOBEC-2 [0333] Bovine APOBEC-2:
  • Some aspects of the present disclosure are based on the recognition that modulating the deaminase domain catalytic activity of any of the fusion proteins described herein, for example by making point mutations in the deaminase domain, affect the processivity of the fusion proteins (e.g., base editors). For example, mutations that reduce, but do not eliminate, the catalytic activity of a deaminase domain within a base editing fusion protein can make it less likely that the deaminase domain will catalyze the deamination of a residue adjacent to a target residue, thereby narrowing the deamination window. The ability to narrow the deamination window can prevent unwanted deamination of residues adjacent to specific target residues, which can decrease or prevent off-target effects.
  • an APOBEC deaminase incorporated into a base editor can comprise one or more mutations selected from the group consisting of H121X, H122X, R126X, R126X, R118X, W90X, W90X, and R132X of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase, wherein X is any amino acid.
  • an APOBEC deaminase incorporated into a base editor can comprise one or more mutations selected from the group consisting of H121R, H122R, R126A, R126E, R118A, W90A, W90Y, and R132E of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise one or more mutations selected from the group consisting of D316X, D317X, R320X, R320X, R313X, W285X, W285X, R326X of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase, wherein X is any amino acid.
  • any of the fusion proteins provided herein comprise an APOBEC deaminase comprising one or more mutations selected from the group consisting of D316R, D317R, R320A, R320E, R313A, W285A, W285Y, R326E of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise a H121R and a H122R mutation of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R126A mutation of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R126E mutation of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R118A mutation of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W90A mutation of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W90Y mutation of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R132E mutation of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W90Y and a R126E mutation of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R126E and a R132E mutation of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W90Y and a R132E mutation of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W90Y, R126E, and R132E mutation of rAPOBEC1, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a D316R and a D317R mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • any of the fusion proteins provided herein comprise an APOBEC deaminase comprising a R320A mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R320E mutation of
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R313A mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W285A mutation of hAPOBEC3G, or one or more corresponding mutations in another
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W285Y mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R326E mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W285Y and a R320E mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a R320E and a R326E mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W285Y and a R326E mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • an APOBEC deaminase incorporated into a base editor can comprise an APOBEC deaminase comprising a W285Y, R320E, and R326E mutation of hAPOBEC3G, or one or more corresponding mutations in another APOBEC deaminase.
  • a number of modified cytidine deaminases are commercially available, including, but not limited to, SaBE3, SaKKH-BE3, VQR-BE3, EQR-BE3, VRER-BE3, YE1-BE3, EE-BE3, YE2-BE3, and YEE-BE3, which are available from Addgene (plasmids 85169, 85170, 85171, 85172, 85173, 85174, 85175, 85176, 85177).
  • a deaminase incorporated into a base editor comprises all or a portion of an APOBEC1 deaminase.
  • a base editor described herein can comprise a deaminase domain which includes an adenosine deaminase.
  • a deaminase domain of a base editor can facilitate the editing of an adenine (A) nucleobase to a guanine (G) nucleobase by deaminating the A to form inosine (I), which exhibits base pairing properties of G.
  • Adenosine deaminase is capable of deaminating (i.e., removing an amine group) adenine of a deoxyadenosine residue in deoxyribonucleic acid (DNA).
  • the nucleobase editors provided herein can be made by fusing together one or more protein domains, thereby generating a fusion protein.
  • the fusion proteins provided herein comprise one or more features that improve the base editing activity (e.g., efficiency, selectivity, and specificity) of the fusion proteins.
  • the fusion proteins provided herein can comprise a Cas9 domain that has reduced nuclease activity.
  • the fusion proteins provided herein can have a Cas9 domain that does not have nuclease activity (dCas9), or a Cas9 domain that cuts one strand of a duplexed DNA molecule, referred to as a Cas9 nickase (nCas9).
  • the presence of the catalytic residue maintains the activity of the Cas9 to cleave the non-edited (e.g., non-deaminated) strand containing a T opposite the targeted A.
  • Mutation of the catalytic residue (e.g., D10 to A10) of Cas9 prevents cleavage of the edited strand containing the targeted A residue.
  • Such Cas9 variants are able to generate a single- strand DNA break (nick) at a specific location based on the gRNA-defined target sequence, leading to repair of the non-edited strand, ultimately resulting in a T to C change on the non- edited strand.
  • an A-to-G base editor further comprises an inhibitor of inosine base excision repair, for example, a uracil glycosylase inhibitor (UGI) domain or a catalytically inactive inosine specific nuclease.
  • a uracil glycosylase inhibitor UGI domain
  • a catalytically inactive inosine specific nuclease can inhibit or prevent base excision repair of a deaminated adenosine residue (e.g., inosine), which can improve the activity or efficiency of the base editor.
  • a base editor comprising an adenosine deaminase can act on any polynucleotide, including DNA, RNA and DNA-RNA hybrids.
  • a base editor comprising an adenosine deaminase can deaminate a target A of a polynucleotide comprising RNA.
  • the base editor can comprise an adenosine deaminase domain capable of deaminating a target A of an RNA polynucleotide and/or a DNA-RNA hybrid polynucleotide.
  • an adenosine deaminase incorporated into a base editor comprises all or a portion of adenosine deaminase acting on RNA (ADAR, e.g., ADAR1 or ADAR2).
  • adenosine deaminase incorporated into a base editor comprises all or a portion of adenosine deaminase acting on tRNA (ADAT).
  • a base editor comprising an adenosine deaminase domain can also be capable of deaminating an A nucleobase of a DNA
  • an adenosine deaminase domain of a base editor comprises all or a portion of an ADAT comprising one or more mutations which permit the ADAT to deaminate a target A in DNA.
  • the base editor can comprise all or a portion of an ADAT from Escherichia coli (EcTadA) comprising one or more of the following mutations: D108N, A106V, D147Y, E155V, L84F, H123Y, I157F, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase can be derived from any suitable organism (e.g., E. coli).
  • the adenine deaminase is a naturally-occurring adenosine deaminase that includes one or more mutations corresponding to any of the mutations provided herein (e.g., mutations in ecTadA).
  • the corresponding residue in any homologous protein can be identified by e.g., sequence alignment and determination of homologous residues.
  • any naturally-occurring adenosine deaminase e.g., having homology to ecTadA
  • any of the mutations described herein e.g., any of the mutations identified in ecTadA
  • the TadA is any one of the TadA described in
  • a fusion protein of the invention comprises a wild-type TadA linked to TadA7.10, which is linked to Cas9 nickase.
  • the fusion proteins comprise a single TadA7.10 domain (e.g., provided as a monomer).
  • the ABE7.10 editor comprises TadA7.10 and TadA(wt), which are capable of forming heterodimers.
  • TadA reference sequence is termed“the TadA reference sequence” or wild type TadA (TadA(wt)).
  • the adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth in any of the adenosine deaminases provided herein. It should be appreciated that adenosine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein).
  • the disclosure provides any deaminase domains with a certain percent identity plus any of the mutations or combinations thereof described herein.
  • the adenosine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more mutations compared to a reference sequence, or any of the adenosine
  • the adenosine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences known in the art or described herein.
  • the TadA deaminase is a full-length E. coli TadA deaminase.
  • the adenosine deaminase comprises the amino acid sequence:
  • adenosine deaminases useful in the present application would be apparent to the skilled artisan and are within the scope of this disclosure.
  • the adenosine deaminase may be a homolog of adenosine deaminase acting on tRNA (ADAT).
  • ADAT tRNA
  • amino acid sequences of exemplary AD AT homologs include the following:
  • Bacillus subtilis TadA Bacillus subtilis TadA:
  • E. Coli TadA includes the following:
  • the adenosine deaminase is from a prokaryote. In some embodiments, the adenosine deaminase is from a bacterium. In some embodiments, the adenosine deaminase is from Escherichia coli, Staphylococcus aureus, Salmonella typhi, Shewanella putrefaciens, Haemophilus influenzae, Caulobacter crescentus, or Bacillus subtilis. In some embodiments, the adenosine deaminase is from E. coli.
  • a fusion protein of the invention comprises a wild-type TadA linked to TadA7.10, which is linked to Cas9 nickase.
  • the fusion proteins comprise a single TadA7.10 domain (e.g., provided as a monomer).
  • the ABE7.10 editor comprises TadA7.10 and TadA(wt), which are capable of forming heterodimers.
  • the adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth in any of the adenosine deaminases provided herein. It should be appreciated that adenosine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein).
  • the disclosure provides any deaminase domains with a certain percent identity plus any of the mutations or combinations thereof described herein.
  • the adenosine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more mutations compared to a reference sequence, or any of the adenosine deaminases provided herein.
  • the adenosine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences known in the art or described herein.
  • any of the mutations provided herein can be introduced into other adenosine deaminases, such as E. coli TadA (ecTadA), S. aureus TadA (saTadA), or other adenosine deaminases (e.g., bacterial adenosine deaminases). It would be apparent to the skilled artisan that additional deaminases may similarly be aligned to identify homologous amino acid residues that can be mutated as provided herein.
  • adenosine deaminases such as E. coli TadA (ecTadA), S. aureus TadA (saTadA), or other adenosine deaminases (e.g., bacterial adenosine deaminases). It would be apparent to the skilled artisan that additional deaminases may similarly be aligned to identify homologous amino acid residues that can be mutated as provided herein
  • any of the mutations identified in the TadA reference sequence can be made in other adenosine deaminases (e.g. ecTada) that have homologous amino acid residues. It should also be appreciated that any of the mutations provided herein can be made individually or in any combination in the TadA reference sequence or another adenosine deaminase.
  • the adenosine deaminase comprises a D108X mutation in the TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a D108G, D108N, D108V, D108A, or D108Y mutation, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an A106X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A106V mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. wild type TadA or ecTadA).
  • the adenosine deaminase comprises a E155X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a E155D, E155G, or E155V mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises a D147X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a D147Y, mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an A106X, E155X, or D147X, mutation in the TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an E155D, E155G, or E155V mutation.
  • the adenosine deaminase comprises a D147Y.
  • an adenosine deaminase can contain a D108N, a A106V, a E155V, and/or a D147Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • an adenosine deaminase comprises the following group of mutations (groups of mutations are separated by a“;” ) in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g.
  • ecTadA D108N and A106V; D108N and E155V; D108N and D147Y; A106V and E155V; A106V and D147Y; E155V and D147Y; D108N, A106V, and E55V; D108N, A106V, and D147Y; D108N, E55V, and D147Y; A106V, E55V, and D 147Y; and D108N, A106V, E55V, and D147Y.
  • any combination of corresponding mutations provided herein can be made in an adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one or more of a H8X, T17X, L18X, W23X, L34X, W45X, R51X, A56X, E59X, E85X, M94X, I95X, V102X, F104X, A106X, R107X, D108X, K110X, M118X, N127X, A138X, F149X, M151X, R153X, Q154X, I156X, and/or K157X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g.
  • the adenosine deaminase comprises one or more of H8Y, T17S, L18E, W23L, L34S, W45L, R51H, A56E, or A56S, E59G, E85K, or E85G, M94L, 1951, V102A, F104L, A106V, R107C, or R107H, or R107P, D108G, or D108N, or D108V, or D108A, or D108Y, K110I, M118K, N127S, A138V, F149Y, M151V, R153C, Q154L, I156D, and/or K157R mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g. ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of a H8X, D108X, and/or N127X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g. ecTadA), where X indicates the presence of any amino acid.
  • the adenosine deaminase comprises one or more of a H8Y, D108N, and/or N127S mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one or more of H8X, R26X, M61X, L68X, M70X, A106X, D108X, A109X, N127X, D147X, R152X, Q154X, E155X, K161X, Q163X, and/or T166X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g. ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one or more of H8Y, R26W, M61I, L68Q, M70V, A106T, D108N, A109T, N127S, D147Y, R152C, Q154H or Q154R, E155G or E155V or E155D, K161Q, Q163H, and/or T166P mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g.
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8X, D108X, N127X, D147X, R152X, and Q154X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8X, M61X, M70X, D108X, N127X, Q154X, E155X, and Q163X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8X, D108X, N127X, E155X, and T166X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8X, A106X, D108X, mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8X, R126X, L68X, D108X, N127X, D147X, and E155X, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild- type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8X, D108X, A109X, N127X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8Y, D108N, N127S, D147Y, R152C, and Q154H in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8Y, M61I, M70V, D108N, N127S, Q154R, E155G and Q163H in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8Y, D108N, N127S, E155V, and T166P in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8Y, A106T, D108N, N127S, E155D, and K161Q in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8Y, R126W, L68Q, D108N, N127S, D147Y, and E155V in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g.
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8Y, D108N, A109T, N127S, and E155G in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA).
  • any of the mutations provided herein and any additional mutations can be introduced into any other adenosine deaminases.
  • Any of the mutations provided herein can be made individually or in any combination in TadA reference sequence or another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one or more corresponding mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises a D108N, D108G, or D108V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises a A106V and D108N mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises R107C and D108N mutations in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises a H8Y, D108N, N127S, D147Y, and Q154H mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises a H8Y, R24W, D108N, N127S, D147Y, and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g. ecTadA). In some embodiments, the adenosine deaminase comprises a D108N, D147Y, and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises a H8Y, D108N, and N127S mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g. ecTadA). In some embodiments, the adenosine deaminase comprises a A106V, D108N, D147Y and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one or more of a, S2X, H8X, I49X, L84X, H123X, N127X, I156X and/or K160X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of S2A, H8Y, I49F, L84F, H123Y, N127S, I156F and/or K160S mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an L84X mutation adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an L84F mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an H123X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an H123Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an I157X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an I157F mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of L84X, A106X, D108X, H123X, D147X, E155X, and I156X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of S2X, I49X, A106X, D108X, D147X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8X, A106X, D108X, N127X, and K160X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild- type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of L84F, A106V, D108N, H123Y, D147Y, E155V, and I156F in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of S2A, I49F, A106V, D108N, D147Y, and E155V in TadA reference sequence.
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8Y, A106T, D108N, N127S, and K160S in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one or more of a E25X, R26X, R107X, A142X, and/or A143X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g. ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • adenosine deaminase comprises one or more of a E25X, R26X, R107X, A142X, and/or A143X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g. ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of E25M, E25D, E25A, E25R, E25V, E25S, E25Y, R26G, R26N, R26Q, R26C, R26L, R26K, R107P, R07K, R107A, R107N, R107W, R107H, R107S, A142N, A142D, A142G, A143D, A143G, A143E, A143L, A143W, A143M, A143S, A143Q and/or A143R mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g.
  • the adenosine deaminase comprises one or more of the mutations described herein corresponding to TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an E25X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an E25M, E25D, E25A, E25R, E25V, E25S, or E25Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an R26X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises R26G, R26N, R26Q, R26C, R26L, or R26K mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an R107X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an R107P, R07K, R107A, R107N, R107W, R107H, or R107S mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an A142X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A142N, A142D, A142G, mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an A143X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A143D, A143G, A143E, A143L, A143W, A143M, A143S, A143Q and/or A143R mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises one or more of a H36X, N37X, P48X, I49X, R51X, M70X, N72X, D77X, E134X, S 146X, Q154X, K157X, and/or K161X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g. ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • adenosine deaminase comprises one or more of a H36X, N37X, P48X, I49X, R51X, M70X, N72X, D77X, E134X, S 146X, Q154X, K157X, and/or K161X mutation in TadA reference sequence, or one or more corresponding mutations in another adenos
  • the adenosine deaminase comprises one or more of H36L, N37T, N37S, P48T, P48L, I49V, R51H, R51L, M70L, N72S, D77G, E134G, S146R, S146C, Q154H, K157N, and/or K161T mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g. ecTadA).
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises an H36X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an H36L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an N37X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an N37T, or N37S mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an P48X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an P48T, or P48L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an R51X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an R51H, or R51L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an S146X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an S146R, or S146C mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an K157X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a K157N mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an P48X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a P48S, P48T, or P48A mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an A142X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a A142N mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an W23X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a W23R, or W23L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase comprises an R152X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a R152P, or R52H mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g. ecTadA).
  • the adenosine deaminase may comprise the mutations H36L, R51L, L84F, A106V, D108N, H123Y, S146C, D147Y, E155V, I156F, and K157N.
  • the adenosine deaminase comprises the following combination of mutations relative to TadA reference sequence, where each mutation of a combination is separated by a "_" and each combination of mutations is between parentheses:
  • the fusion proteins provided herein comprise one or more features that improve the base editing activity of the fusion proteins.
  • any of the fusion proteins provided herein may comprise a Cas9 domain that has reduced nuclease activity.
  • any of the fusion proteins provided herein may have a Cas9 domain that does not have nuclease activity (dCas9), or a Cas9 domain that cuts one strand of a duplexed DNA molecule, referred to as a Cas9 nickase (nCas9).
  • a fusion protein of the invention comprises a cytidine deaminase.
  • the cytidine deaminases provided herein are capable of deaminating cytosine or 5-methylcytosine to uracil or thymine.
  • the cytosine deaminases provided herein are capable of deaminating cytosine in DNA.
  • the cytidine deaminase may be derived from any suitable organism.
  • the cytidine deaminase is a naturally-occurring cytidine deaminase that includes one or more mutations corresponding to any of the mutations provided herein.
  • the cytidine deaminase is from a prokaryote. In some embodiments, the cytidine deaminase is from a bacterium. In some embodiments, the cytidine deaminase is from a mammal (e.g., human).
  • the cytidine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the cytidine deaminase amino acid sequences set forth herein. It should be
  • cytidine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein).
  • the disclosure provides any deaminase domains with a certain percent identity plus any of the mutations or combinations thereof described herein.
  • the cytidine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more mutations compared to a reference sequence, or any of the cytidine deaminases provided herein.
  • the cytidine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences known in the art or described herein.
  • a fusion protein of the invention comprises a nucleic acid editing domain.
  • the nucleic acid editing domain can catalyze a C to U base change.
  • the nucleic acid editing domain is a deaminase domain.
  • the deaminase is a cytidine deaminase or an adenosine deaminase.
  • the deaminase is an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase.
  • APOBEC apolipoprotein B mRNA-editing complex
  • the deaminase is an APOBECl deaminase.
  • the deaminase is an APOBEC2 deaminase. In some embodiments, the deaminase is an APOBEC3 deaminase. In some embodiments, the deaminase is an APOBEC3 A deaminase. In some embodiments, the deaminase is an APOBEC3B deaminase. In some embodiments, the deaminase is an APOBEC3C deaminase. In some embodiments, the deaminase is an
  • the deaminase is an APOBEC3E deaminase. In some embodiments, the deaminase is an APOBEC3F deaminase. In some embodiments, the deaminase is an APOBEC3G deaminase. In some embodiments, the deaminase is an
  • the deaminase is an APOBEC4 deaminase.
  • the deaminase is an activation-induced deaminase (AID).
  • the deaminase is a vertebrate deaminase.
  • the deaminase is an invertebrate deaminase.
  • the deaminase is a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse deaminase.
  • the deaminase is a human deaminase.
  • the deaminase is a rat deaminase, e.g., rAPOBECl. In some embodiments, the deaminase is a Petromyzon marinus cytidine deaminase 1 (pmCDAl). In some embodiments, the deaminase is a human APOBEC3G. In some embodiments, the deaminase is a fragment of the human APOBEC3G. In some embodiments, the deaminase is a human APOBEC3G variant comprising a D316R D317R mutation.
  • the deaminase is a fragment of the human APOBEC3G and comprising mutations corresponding to the D316R D317R mutations.
  • the nucleic acid editing domain is at least 80%, at least 85%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%), or at least 99.5% identical to the deaminase domain of any deaminase described herein.
  • Cas9 proteins such as Cas9 from S. pyogenes (spCas9)
  • spCas9 require a canonical NGG PAM sequence to bind a particular nucleic acid region, where the“N” in“NGG” is adenosine (A), thymidine (T), or cytosine (C), and the G is guanosine.
  • A adenosine
  • T thymidine
  • C cytosine
  • G guanosine
  • the base editing fusion proteins provided herein may need to be placed at a precise location, for example a region comprising a target base that is upstream of the PAM.
  • any of the fusion proteins provided herein may contain a Cas9 domain that is capable of binding a nucleotide sequence that does not contain a canonical (e.g., NGG) PAM sequence.
  • Cas9 domains that bind to non-canonical PAM sequences have been described in the art and would be apparent to the skilled artisan.
  • Cas9 domains that bind non- canonical PAM sequences have been described in Kleinstiver, B. P., et al.,“Engineered
  • the guide nucleic acid e.g., guide RNA
  • the guide RNA is from 15-100 nucleotides long and comprises a sequence of at least 10 contiguous nucleotides that is complementary to a target sequence.
  • the guide RNA is 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 nucleotides long.
  • the guide RNA comprises a sequence of 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 contiguous nucleotides that is complementary to a target sequence.
  • the target sequence is a DNA sequence.
  • the target sequence is a sequence in the genome of a bacteria, yeast, fungi, insect, plant, or animal.
  • the target sequence is a sequence in the genome of a human.
  • the 3’ end of the target sequence is immediately adjacent to a canonical PAM sequence (NGG).
  • the 3’ end of the target sequence is immediately adjacent to a non-canonical PAM sequence (e.g., a sequence listed in Table 1 or 5’-NAA-3’).
  • the guide nucleic acid e.g., guide RNA
  • the guide nucleic acid is complementary to a sequence in a gene of interest (e.g. SERPINA1).
  • Some aspects of this disclosure provide methods of using the fusion proteins, or complexes provided herein. For example, some aspects of this disclosure provide methods comprising contacting a DNA molecule with any of the fusion proteins provided herein, and with at least one guide RNA, wherein the guide RNA is about 15-100 nucleotides long and comprises a sequence of at least 10 contiguous nucleotides that is complementary to a target sequence. In some embodiments, the 3’ end of the target sequence is immediately adjacent to an AGC, GAG, TTT, GTG, or CAA sequence.
  • the 3’ end of the target sequence is immediately adjacent to an NGA, NGCG, NGN, NNGRRT, NNNRRT, NGCG, NGCN, NGTN, NGTN, NGTN, or 5’ (TTTV) sequence.
  • a guide RNA typically comprises a tracrRNA framework allowing for Cas9 binding, and a guide sequence, which confers sequence specificity to the Cas9:nucleic acid editing enzyme/domain fusion protein.
  • the guide RNA and tracrRNA may be provided separately, as two nucleic acid molecules.
  • the guide RNA comprises a structure, wherein the guide sequence comprises a sequence that is complementary to the target sequence.
  • the guide sequence is typically 20 nucleotides long.
  • suitable guide RNAs for targeting Cas9:nucleic acid editing enzyme/domain fusion proteins to specific genomic target sites will be apparent to those of skill in the art based on the instant disclosure.
  • Such suitable guide RNA sequences typically comprise guide sequences that are complementary to a nucleic sequence within 50 nucleotides upstream or downstream of the target nucleotide to be edited.
  • Some exemplary guide RNA sequences suitable for targeting any of the provided fusion proteins to specific target sequences are provided herein.
  • a base editor described herein can include any domain which helps to facilitate the nucleobase editing, modification or altering of a nucleobase of a polynucleotide.
  • a base editor comprises a polynucleotide programmable nucleotide binding domain (e.g., Cas9), a nucleobase editing domain (e.g., deaminase domain), and one or more additional domains.
  • the additional domain can facilitate enzymatic or catalytic functions of the base editor, binding functions of the base editor, or be inhibitors of cellular machinery (e.g., enzymes) that could interfere with the desired base editing result.
  • a base editor can comprise a nuclease, a nickase, a recombinase, a deaminase, a methyltransferase, a methylase, an acetylase, an acetyltransferase, a transcriptional activator, or a transcriptional repressor domain.
  • a base editor can comprise a uracil glycosylase inhibitor (UGI) domain.
  • UGI domain can for example improve the efficiency of base editors comprising a cytidine deaminase domain by inhibiting the conversion of a U formed by deamination of a C back to the C nucleobase.
  • cellular DNA repair response to the presence of U:G heteroduplex DNA can be responsible for a decrease in nucleobase editing efficiency in cells.
  • uracil DNA glyocosylase (UDG) can catalyze removal of U from DNA in cells, which can initiate base excision repair (BER), mostly resulting in reversion of the U:G pair to a C:G pair.
  • BER base excision repair
  • BER can be inhibited in base editors comprising one or more domains that bind the single strand, block the edited base, inhibit UGI, inhibit BER, protect the edited base, and /or promote repairing of the non-edited strand.
  • this disclosure contemplates a base editor fusion protein comprising a UGI domain.
  • a base editor comprises as a domain all or a portion of a double- strand break (DSB) binding protein.
  • a DSB binding protein can include a Gam protein of bacteriophage Mu that can bind to the ends of DSBs and can protect them from degradation. See Komor, A.C., et al.,“Improved base excision repair inhibition and
  • a base editor can comprise as a domain all or a portion of a nucleic acid polymerase (NAP).
  • NAP nucleic acid polymerase
  • a base editor can comprise all or a portion of a eukaryotic NAP.
  • a NAP or portion thereof incorporated into a base editor is a DNA polymerase.
  • a NAP or portion thereof incorporated into a base editor has translesion polymerase activity.
  • a NAP or portion thereof incorporated into a base editor is a translesion DNA polymerase.
  • a NAP or portion thereof incorporated into a base editor is a Rev7, Rev1 complex, polymerase iota, polymerase kappa, or polymerase eta.
  • a NAP or portion thereof incorporated into a base editor is a eukaryotic polymerase alpha, beta, gamma, delta, epsilon, gamma, eta, iota, kappa, lambda, mu, or nu component.
  • a NAP or portion thereof incorporated into a base editor comprises an amino acid sequence that is at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a nucleic acid polymerase (e.g., a translesion DNA polymerase).
  • a nucleic acid polymerase e.g., a translesion DNA polymerase
  • the base editor system comprises the steps of: (a) contacting a target nucleotide sequence of a polynucleotide (e.g., a double-stranded DNA or RNA, a single- stranded DNA or RNA) of a subject with a base editor system comprising a nucleobase editor (e.g., an adenosine base editor or a cytidine base editor) and a guide polynucleic acid (e.g., gRNA), wherein the target nucleotide sequence comprises a targeted nucleobase pair; (b) inducing strand separation of the target region; (c) converting a first nucleobase of the target nucleobase pair in a single strand of the target region to a second nucleobase; and (d) cutting no more than one strand of the target region, where a third nucleobase complementary to the first nucleobase base is replaced by a fourth nucleobase complementary to the
  • the targeted nucleobase pair is a plurality of nucleobase pairs in one or more genes.
  • the base editor system provided herein is capable of multiplex editing of a plurality of nucleobase pairs in one or more genes.
  • the plurality of nucleobase pairs is located in the same gene.
  • the plurality of nucleobase pairs is located in one or more genes, wherein at least one gene is located in a different locus.
  • the cut single strand (nicked strand) is hybridized to the guide nucleic acid. In some embodiments, the cut single strand is opposite to the strand comprising the first nucleobase. In some embodiments, the base editor comprises a Cas9 domain. In some embodiments, the first base is adenine, and the second base is not a G, C, A, or T. In some embodiments, the second base is inosine.
  • Base editing system as provided herein provides a new approach to genome editing that uses a fusion protein containing a catalytically defective Streptococcus pyogenes Cas9, a cytidine deaminase, and an inhibitor of base excision repair to induce programmable, single nucleotide (C®T or A®G) changes in DNA without generating double-strand DNA breaks, without requiring a donor DNA template, and without inducing an excess of stochastic insertions and deletions.
  • C®T or A®G programmable, single nucleotide
  • the base editor system comprises (1) a base editor (BE) comprising a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain (e.g., a deaminase domain) for editing the nucleobase; and (2) a guide polynucleotide (e.g., guide RNA) in conjunction with the polynucleotide programmable nucleotide binding domain.
  • the base editor system comprises a cytosine base editor (CBE).
  • the base editor system comprises an adenosine base editor (ABE).
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain. In some embodiments, the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable RNA binding domain. In some embodiments, the nucleobase editing domain is a deaminase domain. In some cases, a deaminase domain can be a cytosine deaminase or a cytidine deaminase. In some embodiments, the terms“cytosine deaminase” and“cytidine deaminase” can be used interchangeably.
  • a deaminase domain can be an adenine deaminase or an adenosine deaminase.
  • the terms“adenine deaminase” and “adenosine deaminase” can be used interchangeably. Details of nucleobase editing proteins are described in International PCT Application Nos. PCT/2017/045381 (WO2018/027078) and PCT/US2016/058344 (WO2017/070632), each of which is incorporated herein by reference for its entirety.
  • a nucleobase editor system may comprise more than one base editing component.
  • a nucleobase editor system may include more than one deaminase.
  • a nuclease base editor system may include one or more cytidine deaminase and/or one or more adenosine deaminases.
  • a single guide polynucleotide may be utilized to target different deaminases to a target nucleic acid sequence.
  • a single pair of guide polynucleotides may be utilized to target different deaminases to a target nucleic acid sequence.
  • the nucleobase component and the polynucleotide programmable nucleotide binding component of a base editor system may be associated with each other covalently or non- covalently.
  • a deaminase domain can be targeted to a target nucleotide sequence by a polynucleotide programmable nucleotide binding domain.
  • a polynucleotide programmable nucleotide binding domain can be fused or linked to a deaminase domain.
  • a polynucleotide programmable nucleotide binding domain can target a deaminase domain to a target nucleotide sequence by non- covalently interacting with or associating with the deaminase domain.
  • the nucleobase editing component e.g. the deaminase component can comprise an additional heterologous portion or domain that is capable of interacting with, associating with, or capable of forming a complex with an additional heterologous portion or domain that is part of a polynucleotide programmable nucleotide binding domain.
  • the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polypeptide. In some embodiments, the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a guide polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a polypeptide linker. In some embodiments, the additional heterologous portion may be capable of binding to a polynucleotide linker. The additional heterologous portion may be a protein domain.
  • the additional heterologous portion may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a steril alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or a RNA recognition motif.
  • KH K Homology
  • a base editor system may further comprise a guide polynucleotide component. It should be appreciated that components of the base editor system may be associated with each other via covalent bonds, noncovalent interactions, or any combination of associations and interactions thereof.
  • a deaminase domain can be targeted to a target nucleotide sequence by a guide polynucleotide.
  • the nucleobase editing component of the base editor system e.g.
  • the deaminase component can comprise an additional heterologous portion or domain (e.g., polynucleotide binding domain such as an RNA or DNA binding protein) that is capable of interacting with, associating with, or capable of forming a complex with a portion or segment (e.g., a polynucleotide motif) of a guide polynucleotide.
  • the additional heterologous portion or domain e.g., polynucleotide binding domain such as an RNA or DNA binding protein
  • the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polypeptide. In some embodiments, the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a guide polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a polypeptide linker. In some embodiments, the additional heterologous portion may be capable of binding to a polynucleotide linker. The additional heterologous portion may be a protein domain. In some embodiments, the additional heterologous portion may be a K
  • Homology (KH) domain a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a sterile alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or a RNA recognition motif.
  • a base editor system can further comprise an inhibitor of base excision repair (BER) component.
  • BER base excision repair
  • components of the base editor system may be associated with each other via covalent bonds, noncovalent interactions, or any combination of associations and interactions thereof.
  • the inhibitor of BER component may comprise a base excision repair inhibitor.
  • the inhibitor of base excision repair can be a uracil DNA glycosylase inhibitor (UGI).
  • the inhibitor of base excision repair can be an inosine base excision repair inhibitor.
  • the inhibitor of base excision repair can be targeted to the target nucleotide sequence by the polynucleotide programmable nucleotide binding domain.
  • a base excision repair can be targeted to the target nucleotide sequence by the polynucleotide programmable nucleotide binding domain.
  • polynucleotide programmable nucleotide binding domain can be fused or linked to an inhibitor of base excision repair. In some embodiments, a polynucleotide programmable nucleotide binding domain can be fused or linked to a deaminase domain and an inhibitor of base excision repair. In some embodiments, a polynucleotide programmable nucleotide binding domain can target an inhibitor of base excision repair to a target nucleotide sequence by non-covalently interacting with or associating with the inhibitor of base excision repair.
  • the inhibitor of base excision repair component can comprise an additional heterologous portion or domain that is capable of interacting with, associating with, or capable of forming a complex with an additional heterologous portion or domain that is part of a polynucleotide programmable nucleotide binding domain.
  • the inhibitor of base excision repair can be targeted to the target nucleotide sequence by the guide
  • the inhibitor of base excision repair can comprise an additional heterologous portion or domain (e.g., polynucleotide binding domain such as an RNA or DNA binding protein) that is capable of interacting with, associating with, or capable of forming a complex with a portion or segment (e.g., a polynucleotide motif) of a guide polynucleotide.
  • the additional heterologous portion or domain of the guide polynucleotide e.g., polynucleotide binding domain such as an RNA or DNA binding protein
  • the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a guide polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a polypeptide linker. In some embodiments, the additional heterologous portion may be capable of binding to a polynucleotide linker. The additional heterologous portion may be a protein domain.
  • the additional heterologous portion may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a sterile alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or a RNA recognition motif.
  • KH K Homology
  • the base editor inhibits base excision repair of the edited strand. In some embodiments, the base editor protects or binds the non-edited strand. In some embodiments, the base editor comprises UGI activity. In some embodiments, the base editor comprises a catalytically inactive inosine-specific nuclease. In some embodiments, the base editor comprises nickase activity. In some embodiments, the intended edit of base pair is upstream of a PAM site. In some embodiments, the intended edit of base pair is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nucleotides upstream of the PAM site.
  • the intended edit of base-pair is downstream of a PAM site.
  • the intended edited base pair is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nucleotides downstream stream of the PAM site.
  • the method does not require a canonical (e.g., NGG) PAM site.
  • the nucleobase editor comprises a linker or a spacer.
  • the linker or spacer is 1-25 amino acids in length. In some embodiments, the linker or spacer is 5-20 amino acids in length. In some embodiments, the linker or spacer is 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids in length.
  • the target region comprises a target window, wherein the target window comprises the target nucleobase pair.
  • the target window comprises 1- 10 nucleotides.
  • the target window is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nucleotides in length.
  • the intended edit of base pair is within the target window.
  • the target window comprises the intended edit of base pair.
  • the method is performed using any of the base editors provided herein.
  • a target window is a
  • the base editor is a cytidine base editor (CBE).
  • CBE cytidine base editor
  • non-limiting exemplary CBE is BE1 (APOBEC1-XTEN-dCas9), BE2
  • BE4 extends the APOBEC1- Cas9n(D10A) linker to 32 amino acids and the Cas9n-UGI linker to 9 amino acids, and appends a second copy of UGI to the C terminus of the construct with another 9 amino acid linker into a single base editor construct.
  • the base editors saBE3 and saBE4 have the S. pyogene
  • Cas9n(D10A) replaced with the smaller S. aureus Cas9n(D10A).
  • BE3-Gam, saBE3-Gam, BE4- Gam, and saBE4-Gam have 174 residues of Gam protein fused to the N-terminus of BE3, saBE3, BE4, and saBE4 via the 16 amino acid XTEN linker.
  • the base editor is an adenosine base editor (ABE).
  • ABE adenosine base editor
  • the adenosine base editor can deaminate adenine in DNA.
  • ABE is generated by replacing APOBEC1 component of BE3 with natural or engineered E. coli TadA, human ADAR2, mouse ADA, or human ADAT2.
  • ABE comprises evolved TadA variant.
  • the ABE is ABE 1.2 (TadA*-XTEN- nCas9-NLS).
  • TadA* comprises A106V and D108N mutations.
  • the ABE is a second generation ABE.
  • the ABE is ABE2.1, which comprises additional mutations D147Y and E155V in TadA* (TadA*2.1).
  • the ABE is ABE2.2, ABE2.1 fused to catalytically inactivated version of human alkyl adenine DNA glycosylase (AAG with E125Q mutation).
  • the ABE is ABE2.3, ABE2.1 fused to catalytically inactivated version of E. coli Endo V (inactivated with D35A mutation).
  • the ABE is ABE2.6 which has a linker twice as long (32 amino acids, (SGGS) 2 -XTEN-(SGGS) 2 ) as the linker in ABE2.1.
  • the ABE is ABE2.7, which is ABE2.1 tethered with an additional wild-type TadA monomer.
  • the ABE is ABE2.8, which is ABE2.1 tethered with an additional TadA*2.1 monomer.
  • the ABE is ABE2.9, which is a direct fusion of evolved TadA (TadA*2.1) to the N-terminus of ABE2.1.
  • the ABE is ABE2.10, which is a direct fusion of wild type TadA to the N- terminus of ABE2.1.
  • the ABE is ABE2.11, which is ABE2.9 with an inactivating E59A mutation at the N-terminus of TadA* monomer.
  • the ABE is ABE2.12, which is ABE2.9 with an inactivating E59A mutation in the internal TadA* monomer.
  • the ABE is a third generation ABE.
  • the ABE is ABE3.1, which is ABE2.3 with three additional TadA mutations (L84F, H123Y, and I157F).
  • the ABE is a fourth generation ABE.
  • the ABE is ABE4.3, which is ABE3.1 with an additional TadA mutation A142N (TadA*4.3).
  • the ABE is a fifth generation ABE.
  • the ABE is ABE5.1, which is generated by importing a consensus set of mutations from surviving clones (H36L, R51L, S146C, and K157N) into ABE3.1.
  • the ABE is ABE5.3, which has a heterodimeric construct containing wild-type E. coli TadA fused to an internal evolved TadA*.
  • the ABE is ABE5.2, ABE5.4, ABE5.5, ABE5.6, ABE5.7, ABE5.8, ABE5.9, ABE5.10, ABE5.11, ABE5.12, ABE5.13, or ABE5.14, as shown in below Table 2.
  • the ABE is a sixth generation ABE. In some embodiments, the ABE is ABE6.1, ABE6.2, ABE6.3, ABE6.4, ABE6.5, or ABE6.6, as shown in below Table 2. In some embodiments, the ABE is a seventh generation ABE. In some embodiments, the ABE is ABE7.1, ABE7.2, ABE7.3, ABE7.4, ABE7.5, ABE7.6, ABE7.7, ABE7.8, ABE7.9, or ABE7.10, as shown in below Table 2. Table 2. Genotypes of ABEs
  • the base editor is a fusion protein comprising a polynucleotide programmable nucleotide binding domain (e.g., Cas9-derived domain) fused to a nucleobase editing domain (e.g., all or a portion of a deaminase domain).
  • the base editor further comprises a domain comprising all or a portion of a uracil glycosylase inhibitor (UGI).
  • the base editor comprises a domain comprising all or a portion of a uracil binding protein (UBP), such as a uracil DNA glycosylase (UDG).
  • UBP uracil binding protein
  • UDG uracil DNA glycosylase
  • the base editor comprises a domain comprising all or a portion of a nucleic acid polymerase.
  • a nucleic acid polymerase or portion thereof incorporated into a base editor is a translesion DNA polymerase.
  • a domain of the base editor can comprise multiple domains.
  • the base editor comprising a polynucleotide programmable nucleotide binding domain derived from Cas9 can comprise an REC lobe and an NUC lobe corresponding to the REC lobe and NUC lobe of a wild-type or natural Cas9.
  • the base editor can comprise one or more of a RuvCI domain, BH domain, REC1 domain, REC2 domain, RuvCII domain, L1 domain, HNH domain, L2 domain, RuvCIII domain, WED domain, TOPO domain or CTD domain.
  • one or more domains of the base editor comprise a mutation (e.g., substitution, insertion, deletion) relative to a wild type version of a polypeptide comprising the domain.
  • a mutation e.g., substitution, insertion, deletion
  • an HNH domain of a polynucleotide programmable DNA binding domain can comprise an H840A substitution.
  • a RuvCI domain of a polynucleotide programmable DNA binding domain can comprise a D10A substitution.
  • a linker domain can be a bond (e.g., covalent bond), chemical group, or a molecule linking two molecules or moieties, e.g., two domains of a fusion protein, such as, for example, a first domain (e.g., Cas9-derived domain) and a second domain (e.g., a cytidine deaminase domain or adenosine deaminase domain).
  • a linker is a covalent bond (e.g., a carbon-carbon bond, disulfide bond, carbon-hetero atom bond, etc.). In certain embodiments, a linker is a carbon nitrogen bond of an amide linkage. In certain embodiments, a linker is a cyclic or acyclic, substituted or unsubstituted, branched or unbranched aliphatic or heteroaliphatic linker. In certain embodiments, a linker is polymeric (e.g., polyethylene, polyethylene glycol, polyamide, polyester, etc.). In certain embodiments, a linker comprises a monomer, dimer, or polymer of aminoalkanoic acid.
  • a linker comprises an aminoalkanoic acid (e.g., glycine, ethanoic acid, alanine, beta-alanine, 3- aminopropanoic acid, 4-aminobutanoic acid, 5-pentanoic acid, etc.).
  • a linker comprises a monomer, dimer, or polymer of aminohexanoic acid (Ahx).
  • a linker is based on a carbocyclic moiety (e.g., cyclopentane, cyclohexane).
  • a linker comprises a polyethylene glycol moiety (PEG).
  • a linker comprises an aryl or heteroaryl moiety. In certain embodiments, the linker is based on a phenyl ring.
  • a linker can include functionalized moieties to facilitate attachment of a nucleophile (e.g., thiol, amino) from the peptide to the linker. Any electrophile can be used as part of the linker. Exemplary electrophiles include, but are not limited to, activated esters, activated amides, Michael acceptors, alkyl halides, aryl halides, acyl halides, and isothiocyanates.
  • a linker joins a gRNA binding domain of an RNA- programmable nuclease, including a Cas9 nuclease domain, and the catalytic domain of a nucleic acid editing protein.
  • a linker joins a dCas9 and a second domain (e.g., cytidine deaminase, UGI, etc.).
  • a linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two.
  • a linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein).
  • a linker is an organic molecule, group, polymer, or chemical moiety.
  • a linker is 2-100 amino acids in length, for example, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 30-35, 35-40, 40-45, 45-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-150, or 150-200 amino acids in length.
  • the linker is about 3 to about 104 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100) amino acids in length.
  • a linker domain comprises the amino acid sequence SGSETPGTSESATPES, which can also be referred to as the XTEN linker.
  • Any method for linking the fusion protein domains can be employed (e.g., ranging from very flexible linkers of the form (SGGS)n, (GGGS)n, (GGGGS)n, and (G)n, to more rigid linkers of the form (EAAAK)n, (GGS)n, SGSETPGTSESATPES (see, e.g.,
  • n is independently an integer between 1 and 30, and wherein X is any amino acid.
  • n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15.
  • the linker comprises a (GGS) n motif, wherein n is 1, 3, or 7.
  • the Cas9 domain of the fusion proteins provided herein are fused via a linker comprising the amino acid sequence SGSETPGTSESATPES.
  • a linker comprises a plurality of proline residues and is 5-21, 5-14, 5-9, 5-7 amino acids in length, e.g., PAPAP, PAPAPA, PAPAPAP, PAPAPAPA, P(AP) 4 , P(AP) 7 , P(AP) 10 (see, e.g., Tan J, Zhang F, Karcher D, Bock R.
  • proline-rich linkers are also termed“rigid” linkers.
  • the domains of the base editor disclosed herein can be arranged in any order.
  • a base editor comprising a fusion protein comprising e.g., a polynucleotide- programmable nucleotide-binding domain and a deaminase domain can be arranged as following:
  • a Gam protein can be fused to an N terminus of a base editor.
  • a Gam protein can be fused to a C terminus of a base editor.
  • the Gam protein of bacteriophage Mu can bind to the ends of double strand breaks (DSBs) and protect them from degradation.
  • using Gam to bind the free ends of DSB can reduce indel formation during the process of base editing.
  • 174-residue Gam protein is fused to the N terminus of the base editors. See.
  • a mutation or mutations can change the length of a base editor domain relative to a wild type domain. For example, a deletion of at least one amino acid in at least one domain can reduce the length of the base editor. In another case, a mutation or mutations do not change the length of a domain relative to a wild type domain. For example, substitution(s) in any domain does/do not change the length of the base editor.
  • Non-limiting examples of such base editors, where the length of all the domains is the same as the wild type domains can include:
  • the base editing fusion proteins provided herein need to be positioned at a precise location, for example, where a target base is placed within a defined region (e.g., a“deamination window”).
  • a target can be within a 4 base region.
  • such a defined target region can be approximately 15 bases upstream of the PAM.
  • a defined target region can be a deamination window.
  • a deamination window can be the defined region in which a base editor acts upon and deaminates a target nucleotide. In some embodiments, the deamination window is within a 2, 3, 4, 5, 6, 7, 8, 9, or 10 base regions. In some embodiments, the deamination window is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 bases upstream of the PAM.
  • the base editors of the present disclosure can comprise any domain, feature or amino acid sequence which facilitates the editing of a target polynucleotide sequence.
  • the base editor comprises a nuclear localization sequence (NLS).
  • NLS nuclear localization sequence
  • an NLS of the base editor is localized between a deaminase domain and a polynucleotide programmable nucleotide binding domain.
  • an NLS of the base editor is localized C-terminal to a polynucleotide programmable nucleotide binding domain.
  • localization sequences such as cytoplasmic localization sequences, export sequences, such as nuclear export sequences, or other localization sequences, as well as sequence tags that are useful for solubilization, purification, or detection of the fusion proteins.
  • Suitable protein tags include, but are not limited to, biotin carboxylase carrier protein (BCCP) tags, myc-tags, calmodulin-tags, FLAG-tags, hemagglutinin (HA)-tags, polyhistidine tags, also referred to as histidine tags or His-tags, maltose binding protein (MBP)-tags, nus-tags, glutathione-S-transferase (GST)-tags, green fluorescent protein (GFP)-tags, thioredoxin-tags, S- tags, Softags (e.g., Softag 1, Softag 3), strep-tags, biotin ligase tags, FlAsH tags, V5 tags, and SBP-tags. Additional suitable sequences will be apparent to those of skill in the art.
  • the fusion protein comprises one or more His tags.
  • Non-limiting examples of protein domains which can be included in the fusion protein include a deaminase domain (e.g., cytidine deaminase and/or adenosine deaminase), a uracil glycosylase inhibitor (UGI) domain, epitope tags, reporter gene sequences, and/or protein domains having one or more of the following activities: methylase activity, demethylase activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, RNA cleavage activity, and nucleic acid binding activity. Additional domains can be a heterologous functional domain.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Cell Biology (AREA)
  • Mycology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Diabetes (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Toxicology (AREA)
PCT/US2019/031898 2018-05-11 2019-05-11 Methods of editing single nucleotide polymorphism using programmable base editor systems Ceased WO2019217943A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
EP19799854.5A EP3790595A4 (en) 2018-05-11 2019-05-11 METHODS OF EDITING MONONUCLEOTIDE POLYMORPHISM USING PROGRAMMABLE BASE EDITOR SYSTEMS
US17/054,348 US20230159956A1 (en) 2018-05-11 2019-05-11 Methods of editing single nucleotide polymorphism using programmable base editor systems
JP2021513764A JP2021523738A (ja) 2018-05-11 2019-05-11 プログラム可能な塩基エディターシステムを使用して単一ヌクレオチド多型を編集する方法
CN201980046479.3A CN112469446B (zh) 2018-05-11 2019-05-11 利用可编程碱基编辑器系统编辑单核苷酸多态性的方法
CA3100034A CA3100034A1 (en) 2018-05-11 2019-05-11 Methods of editing single nucleotide polymorphism using programmable base editor systems
KR1020207035000A KR20210023832A (ko) 2018-05-11 2019-05-11 프로그래밍가능한 염기 편집기 시스템을 이용하여 단일염기다형성을 편집하는 방법
AU2019266326A AU2019266326A1 (en) 2018-05-11 2019-05-11 Methods of editing single nucleotide polymorphism using programmable base editor systems
CN202411723844.9A CN119587720A (zh) 2018-05-11 2019-05-11 利用可编程碱基编辑器系统编辑单核苷酸多态性的方法
JP2024095618A JP2024147545A (ja) 2018-05-11 2024-06-13 プログラム可能な塩基エディターシステムを使用して単一ヌクレオチド多型を編集する方法

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201862670588P 2018-05-11 2018-05-11
US62/670,588 2018-05-11
US201862780838P 2018-12-17 2018-12-17
US62/780,838 2018-12-17
US201962817986P 2019-03-13 2019-03-13
US62/817,986 2019-03-13

Publications (1)

Publication Number Publication Date
WO2019217943A1 true WO2019217943A1 (en) 2019-11-14

Family

ID=68466849

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/US2019/031898 Ceased WO2019217943A1 (en) 2018-05-11 2019-05-11 Methods of editing single nucleotide polymorphism using programmable base editor systems
PCT/US2019/031899 Ceased WO2019217944A1 (en) 2018-05-11 2019-05-11 Methods of editing single nucleotide polymorphism using programmable base editor systems

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/US2019/031899 Ceased WO2019217944A1 (en) 2018-05-11 2019-05-11 Methods of editing single nucleotide polymorphism using programmable base editor systems

Country Status (8)

Country Link
US (2) US20210380955A1 (enExample)
EP (2) EP3790963A4 (enExample)
JP (4) JP7596259B2 (enExample)
KR (3) KR102853088B1 (enExample)
CN (3) CN119587720A (enExample)
AU (2) AU2019266327B2 (enExample)
CA (2) CA3100034A1 (enExample)
WO (2) WO2019217943A1 (enExample)

Cited By (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021122944A1 (en) * 2019-12-18 2021-06-24 Alia Therapeutics Srl Compositions and methods for treating retinitis pigmentosa
WO2021163492A1 (en) * 2020-02-14 2021-08-19 Ohio State Innovation Foundation Nucleobase editors and methods of use thereof
EP3720507A4 (en) * 2017-12-07 2021-08-25 Ramot at Tel-Aviv University Ltd. TREATMENT OF PARKINSON PATIENTS WITH MUTATIONS IN THE LRRK2 GENE
US11142760B2 (en) 2019-02-13 2021-10-12 Beam Therapeutics Inc. Compositions and methods for treating hemoglobinopathies
IT202000008014A1 (it) * 2020-04-15 2021-10-15 Fond Telethon RNA guida e loro usi
WO2021216623A1 (en) * 2020-04-21 2021-10-28 Aspen Neuroscience, Inc. Gene editing of lrrk2 in stem cells and method of use of cells differentiated therefrom
WO2021216622A1 (en) * 2020-04-21 2021-10-28 Aspen Neuroscience, Inc. Gene editing of gba1 in stem cells and method of use of cells differentiated therefrom
WO2021222318A1 (en) 2020-04-28 2021-11-04 The Broad Institute, Inc. Targeted base editing of the ush2a gene
WO2022015856A1 (en) * 2020-07-14 2022-01-20 The Regents Of The University Of California Compositions and methods for treating an inherited retinal disease
WO2022027035A1 (en) * 2020-07-27 2022-02-03 The Children's Hospital Of Philadelphia In utero and postnatal gene editing and therapy for treatment of monogenic diseases, including mucopolysaccharidosis type 1h and other disorders
US11286468B2 (en) 2017-08-23 2022-03-29 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with altered PAM specificity
WO2022197727A1 (en) * 2021-03-15 2022-09-22 Duke University Generation of novel crispr genome editing agents using combinatorial chemistry
WO2022251687A3 (en) * 2021-05-28 2023-01-19 Beam Therapeutics Inc. Compositions and methods for the self-inactivation of base editors
EP3924478A4 (en) * 2019-02-13 2023-01-25 Beam Therapeutics, Inc. Compositions and methods for treating glycogen storage disease type 1a
JP2023549339A (ja) * 2020-11-06 2023-11-24 ペアワイズ・プランツ・サーヴィシズ,インコーポレイテッド 対立遺伝子の、rnaによりコードされるdna置換のための組成物および方法
US12133884B2 (en) 2018-05-11 2024-11-05 Beam Therapeutics Inc. Methods of substituting pathogenic amino acids using programmable base editor systems
WO2025039001A1 (en) * 2023-08-17 2025-02-20 The Trustees Of The University Of Pennsylvania Compositions and methods for the management and treatment of phenylketonuria
WO2025059520A1 (en) * 2023-09-15 2025-03-20 Beam Therapeutics Inc. Compositions and methods for base editing a phenylalanine hydroxylase polynucleotide
WO2025061198A1 (zh) * 2023-09-22 2025-03-27 北京大学现代农业研究院 改进的基因组编辑方法
US12264341B2 (en) 2020-01-24 2025-04-01 The General Hospital Corporation CRISPR-Cas enzymes with enhanced on-target activity
US12312613B2 (en) 2020-01-24 2025-05-27 The General Hospital Corporation Unconstrained genome targeting with near-PAMless engineered CRISPR-Cas9 variants
WO2025122725A1 (en) * 2023-12-06 2025-06-12 The Broad Institute, Inc. Methods and compositions for base editing of tpp1 in the treatment of batten disease
EP4259187A4 (en) * 2020-12-10 2025-07-23 Apellis Pharmaceuticals Inc GENOMIC EDITING OF THE COMPLEMENT
US12454694B2 (en) 2018-09-07 2025-10-28 Beam Therapeutics Inc. Compositions and methods for improving base editing
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects

Families Citing this family (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9944912B2 (en) 2015-03-03 2018-04-17 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with altered PAM specificity
US11932856B2 (en) 2017-03-03 2024-03-19 The Regents Of The University Of California RNA targeting of mutations via suppressor tRNAs and deaminases
EP3633034A4 (en) * 2017-05-31 2021-03-24 The University Of Tokyo MODIFIED Cas9 PROTEIN AND USE THEREOF
WO2019178427A1 (en) 2018-03-14 2019-09-19 Arbor Biotechnologies, Inc. Novel crispr dna targeting enzymes and systems
US12157760B2 (en) * 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
WO2020154500A1 (en) 2019-01-23 2020-07-30 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
MX2021011426A (es) 2019-03-19 2022-03-11 Broad Inst Inc Metodos y composiciones para editar secuencias de nucleótidos.
CA3140093A1 (en) * 2019-05-21 2020-11-26 Beam Therapeutics Inc. Methods of editing a single nucleotide polymorphism using programmable base editor systems
WO2020252455A1 (en) 2019-06-13 2020-12-17 The General Hospital Corporation Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells
JP7500927B2 (ja) * 2019-08-06 2024-06-18 日本製紙株式会社 プロテイン用マスキング剤
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
AU2020395113A1 (en) 2019-12-02 2022-06-09 Shape Therapeutics Inc. Therapeutic editing
US20230049455A1 (en) * 2020-01-31 2023-02-16 University Of Massachusetts A cas9-pdbd base editor platform with improved targeting range and specificity
MX2022014008A (es) 2020-05-08 2023-02-09 Broad Inst Inc Métodos y composiciones para la edición simultánea de ambas cadenas de una secuencia de nucleótidos de doble cadena objetivo.
CN116670154A (zh) 2020-07-24 2023-08-29 总医院公司 增强的病毒样颗粒及使用其递送至细胞的方法
AU2021350835A1 (en) * 2020-09-24 2023-04-27 President And Fellows Of Harvard College Prime editing guide rnas, compositions thereof, and methods of using the same
CN117729931A (zh) * 2021-05-14 2024-03-19 比姆医疗股份有限公司 用于治疗转甲状腺素蛋白淀粉样变性的组合物和方法
CA3220738A1 (en) * 2021-05-21 2022-11-24 Beam Therapeutics Inc. Base editing of transthyretin gene
JP2024539652A (ja) * 2021-10-13 2024-10-29 アペリス・ファーマシューティカルズ・インコーポレイテッド 新生児fc受容体をゲノム編集するための組成物および方法
AU2022402249A1 (en) 2021-12-03 2024-07-11 President And Fellows Of Harvard College Compositions and methods for efficient in vivo delivery
KR20240136988A (ko) * 2022-01-24 2024-09-19 주식회사 툴젠 스트렙토코커스 피오게네스 유래 Cas9 변이체
CN114480445B (zh) * 2022-01-26 2023-06-27 西南交通大学 一种人源超氧化物歧化酶hSOD1突变体的制备及其应用
US20250304940A1 (en) * 2022-05-13 2025-10-02 Huidagene Therapeutics (Singapore) Pte. Ltd. Programmable adenine base editor and uses thereof
WO2023225572A2 (en) 2022-05-17 2023-11-23 Nvelop Therapeutics, Inc. Compositions and methods for efficient in vivo delivery
CN115148281B (zh) * 2022-06-29 2023-07-14 广州源井生物科技有限公司 一种基因编辑点突变方案自动设计方法及系统
KR20250067157A (ko) * 2022-09-08 2025-05-14 더 유니버시티 코트 오브 더 유니버시티 오브 에딘버그 레트 증후군 요법
WO2024107784A2 (en) * 2022-11-15 2024-05-23 Vanderbilt University Repair of disease-associated single nucleotide variants via interallelic gene conversion
WO2024259364A2 (en) * 2023-06-15 2024-12-19 Beam Therapeutics Inc. Methods and compositions for treating alpha-1 antitrypsin deficiency
US20250092426A1 (en) * 2023-07-25 2025-03-20 Flagship Pioneering Innovations Vii, Llc Cas endonucleases and related methods
CN118120704B (zh) * 2024-01-30 2025-10-24 江苏集萃药康生物科技股份有限公司 一种免高脂饮食诱导的动脉粥样硬化小鼠模型的构建方法

Citations (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4797368A (en) 1985-03-15 1989-01-10 The United States Of America As Represented By The Department Of Health And Human Services Adeno-associated virus as eukaryotic expression vector
US4880635A (en) 1984-08-08 1989-11-14 The Liposome Company, Inc. Dehydrated liposomes
US4906477A (en) 1987-02-09 1990-03-06 Kabushiki Kaisha Vitamin Kenkyusyo Antineoplastic agent-entrapping liposomes
US4911928A (en) 1987-03-13 1990-03-27 Micro-Pak, Inc. Paucilamellar lipid vesicles
US4917951A (en) 1987-07-28 1990-04-17 Micro-Pak, Inc. Lipid vesicles formed of surfactants and steroids
US4920016A (en) 1986-12-24 1990-04-24 Linear Technology, Inc. Liposomes with enhanced circulation time
US4921757A (en) 1985-04-26 1990-05-01 Massachusetts Institute Of Technology System for delayed and pulsed release of biologically active substances
US5173414A (en) 1990-10-30 1992-12-22 Applied Immune Sciences, Inc. Production of recombinant adeno-associated virus vectors
WO1993024641A2 (en) 1992-06-02 1993-12-09 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services Adeno-associated virus with inverted terminal repeat sequences as promoter
US5846946A (en) 1996-06-14 1998-12-08 Pasteur Merieux Serums Et Vaccins Compositions and methods for administering Borrelia DNA
WO2001038547A2 (en) 1999-11-24 2001-05-31 Mcs Micro Carrier Systems Gmbh Polypeptides comprising multimers of nuclear localization signals or of protein transduction domains and their use for transferring molecules into cells
US6453242B1 (en) 1999-01-12 2002-09-17 Sangamo Biosciences, Inc. Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites
US6503717B2 (en) 1999-12-06 2003-01-07 Sangamo Biosciences, Inc. Methods of using randomized libraries of zinc finger proteins for the identification of gene function
US6534261B1 (en) 1999-01-12 2003-03-18 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6599692B1 (en) 1999-09-14 2003-07-29 Sangamo Bioscience, Inc. Functional genomics using zinc finger proteins
US6689558B2 (en) 2000-02-08 2004-02-10 Sangamo Biosciences, Inc. Cells for drug discovery
US7013219B2 (en) 1999-01-12 2006-03-14 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
WO2011053982A2 (en) 2009-11-02 2011-05-05 University Of Washington Therapeutic nuclease compositions and methods
US8404658B2 (en) 2007-12-31 2013-03-26 Nanocor Therapeutics, Inc. RNA interference for the treatment of heart failure
US8454972B2 (en) 2004-07-16 2013-06-04 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Method for inducing a multiclade immune response against HIV utilizing a multigene and multiclade immunogen
US9405700B2 (en) 2010-11-04 2016-08-02 Sonics, Inc. Methods and apparatus for virtualization in an integrated circuit
WO2017070632A2 (en) 2015-10-23 2017-04-27 President And Fellows Of Harvard College Nucleobase editors and uses thereof
WO2017165862A1 (en) * 2016-03-25 2017-09-28 Editas Medicine, Inc. Systems and methods for treating alpha 1-antitrypsin (a1at) deficiency
WO2018027078A1 (en) 2016-08-03 2018-02-08 President And Fellows Of Harard College Adenosine nucleobase editors and uses thereof

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20250068794A (ko) * 2013-12-12 2025-05-16 더 브로드 인스티튜트, 인코퍼레이티드 게놈 편집을 위한 crispr-cas 시스템 및 조성물의 전달, 용도 및 치료적 응용
WO2015191693A2 (en) * 2014-06-10 2015-12-17 Massachusetts Institute Of Technology Method for gene editing
US9944912B2 (en) * 2015-03-03 2018-04-17 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with altered PAM specificity
US11851653B2 (en) 2015-12-01 2023-12-26 Crispr Therapeutics Ag Materials and methods for treatment of alpha-1 antitrypsin deficiency
CA3026110A1 (en) * 2016-04-19 2017-11-02 The Broad Institute, Inc. Novel crispr enzymes and systems
EP3445853A1 (en) * 2016-04-19 2019-02-27 The Broad Institute, Inc. Cpf1 complexes with reduced indel activity
US12410416B2 (en) * 2016-04-19 2025-09-09 The Broad Institute, Inc. CRISPR enzymes and systems with modified pam specificity
NZ751483A (en) 2016-09-01 2022-07-01 Proqr Therapeutics Ii Bv Chemically modified single-stranded rna-editing oligonucleotides
CN107043779B (zh) * 2016-12-01 2020-05-12 中国农业科学院作物科学研究所 一种CRISPR/nCas9介导的定点碱基替换在植物中的应用
CN111757937A (zh) 2017-10-16 2020-10-09 布罗德研究所股份有限公司 腺苷碱基编辑器的用途

Patent Citations (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4880635A (en) 1984-08-08 1989-11-14 The Liposome Company, Inc. Dehydrated liposomes
US4880635B1 (en) 1984-08-08 1996-07-02 Liposome Company Dehydrated liposomes
US4797368A (en) 1985-03-15 1989-01-10 The United States Of America As Represented By The Department Of Health And Human Services Adeno-associated virus as eukaryotic expression vector
US4921757A (en) 1985-04-26 1990-05-01 Massachusetts Institute Of Technology System for delayed and pulsed release of biologically active substances
US4920016A (en) 1986-12-24 1990-04-24 Linear Technology, Inc. Liposomes with enhanced circulation time
US4906477A (en) 1987-02-09 1990-03-06 Kabushiki Kaisha Vitamin Kenkyusyo Antineoplastic agent-entrapping liposomes
US4911928A (en) 1987-03-13 1990-03-27 Micro-Pak, Inc. Paucilamellar lipid vesicles
US4917951A (en) 1987-07-28 1990-04-17 Micro-Pak, Inc. Lipid vesicles formed of surfactants and steroids
US5173414A (en) 1990-10-30 1992-12-22 Applied Immune Sciences, Inc. Production of recombinant adeno-associated virus vectors
WO1993024641A2 (en) 1992-06-02 1993-12-09 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services Adeno-associated virus with inverted terminal repeat sequences as promoter
US5846946A (en) 1996-06-14 1998-12-08 Pasteur Merieux Serums Et Vaccins Compositions and methods for administering Borrelia DNA
US6534261B1 (en) 1999-01-12 2003-03-18 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6979539B2 (en) 1999-01-12 2005-12-27 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US7163824B2 (en) 1999-01-12 2007-01-16 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US7013219B2 (en) 1999-01-12 2006-03-14 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6453242B1 (en) 1999-01-12 2002-09-17 Sangamo Biosciences, Inc. Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites
US6607882B1 (en) 1999-01-12 2003-08-19 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6933113B2 (en) 1999-01-12 2005-08-23 Sangamo Biosciences, Inc. Modulation of endogenous gene expression in cells
US6824978B1 (en) 1999-01-12 2004-11-30 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6599692B1 (en) 1999-09-14 2003-07-29 Sangamo Bioscience, Inc. Functional genomics using zinc finger proteins
WO2001038547A2 (en) 1999-11-24 2001-05-31 Mcs Micro Carrier Systems Gmbh Polypeptides comprising multimers of nuclear localization signals or of protein transduction domains and their use for transferring molecules into cells
US6503717B2 (en) 1999-12-06 2003-01-07 Sangamo Biosciences, Inc. Methods of using randomized libraries of zinc finger proteins for the identification of gene function
US6689558B2 (en) 2000-02-08 2004-02-10 Sangamo Biosciences, Inc. Cells for drug discovery
US8454972B2 (en) 2004-07-16 2013-06-04 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Method for inducing a multiclade immune response against HIV utilizing a multigene and multiclade immunogen
US8404658B2 (en) 2007-12-31 2013-03-26 Nanocor Therapeutics, Inc. RNA interference for the treatment of heart failure
WO2011053982A2 (en) 2009-11-02 2011-05-05 University Of Washington Therapeutic nuclease compositions and methods
US9405700B2 (en) 2010-11-04 2016-08-02 Sonics, Inc. Methods and apparatus for virtualization in an integrated circuit
WO2017070632A2 (en) 2015-10-23 2017-04-27 President And Fellows Of Harvard College Nucleobase editors and uses thereof
WO2017165862A1 (en) * 2016-03-25 2017-09-28 Editas Medicine, Inc. Systems and methods for treating alpha 1-antitrypsin (a1at) deficiency
WO2018027078A1 (en) 2016-08-03 2018-02-08 President And Fellows Of Harard College Adenosine nucleobase editors and uses thereof

Non-Patent Citations (78)

* Cited by examiner, † Cited by third party
Title
"Antibodies, A Laboratory Manual, and Culture of Animal Cells: A Manual of Basic Technique and Specialized Applications", 1988
"Controlled Drug Bioavailability, Drug Product Design and Performance", 1984, WILEY
"Medical Applications of Controlled Release", 1974, CRC PRESS
"Remington's The Science and Practice of Pharmacy", 2006, LIPPINCOTT, WILLIAMS & WILKINS
ADDGENEWATERTOWN, MA.KOMOR AC ET AL., SCI ADV, vol. 30, no. 8, 2017, pages 4774
BAE S.PARK J.KIM J.-S.: "Cas-OFFinder: A fast and versatile algorithm that searches for potential off-target sites of Cas9 RNA-guided endonucleases.", BIOINFORMATICS, vol. 30, 2014, pages 1473 - 1475, XP055196964, DOI: 10.1093/bioinformatics/btu048
BENTONDAVIS, SCIENCE, vol. 196, 1977, pages 180
BUCHSCHER ET AL., J. VIROL, vol. 66, 1992, pages 1635 - 1640
BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 507
BURSTEIN ET AL.: "New CRISPR-Cas systems from uncultivated microbes", CELL RES., 21 February 2017 (2017-02-21)
CHATTERJEE, P. ET AL.: "Minimal PAM specificity of a highly similar SpCas9 ortholog", SCI ADV., vol. 4, no. 10, 24 October 2018 (2018-10-24), pages 0766
CONG, L.: "Multiplex genome engineering using CRISPR/Cas systems.", SCIENCE, vol. 339, 2013, pages 819 - 823, XP055871219, DOI: 10.1126/science.1231143
DELTCHEVA ECHYLINSKI KSHARMA C.M.GONZALES K.CHAO Y.PIRZADA Z.AECKERT M.R.VOGEL J.CHARPENTIER E., NATURE, vol. 471, 2011, pages 602 - 607
DICARLO, J.E.: "Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems.", NUCLEIC ACIDS RESEARCH, 2013
DUNNEN, J.TANTONARAKIS, S.E.: "Mutation Nomenclature Extensions and Suggestions to Describe Complex Mutations: A Discussion.", HUMAN MUTATION, vol. 15, 2000, pages 712
DURING ET AL., ANN. NEUROL., vol. 25, 1989, pages 351
FERRETTI J.JMCSHAN W.M.AJDIC D.JSAVIC D.J.SAVIC GLYON K.PRIMEAUX CSEZATE S.SUVOROV A.N.KENTON S., PROC. NATL. ACAD. SCI. U.S.A., vol. 98, 2001, pages 4658 - 4663
FERRETTI, J.J. ET AL., , NATL. ACAD. SCI. U.S.A., vol. 98, 2001, pages 4658 - 4663
GAUDELLI, N.M. ET AL.: ", ''Programmable base editing of A·T to G·C in genomic DNA without DNA cleavage", NATURE, vol. 551, 2017, pages 464 - 471
GRIMM, D ET AL., J. VIROL., vol. 82, 2008, pages 5887 - 5911
GRUNSTEINHOGNESS, PROC. NATL. ACAD. SCI., USA, vol. 72, 1975, pages 3961
GUILINGER JPTHOMPSON DBLIU DR: "Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification.", NAT. BIOTECHNOL., vol. 32, no. 6, 2014, pages 577 - 82, XP055157221, DOI: 10.1038/nbt.2909
HALEMARHAM, THE HARPER COLLINS DICTIONARY OF BIOLOGY, 1991
HERMONATMUZYCZKA, PNAS, vol. 81, 1984, pages 6466 - 6470
HOWARD, J. NEUROSURG, vol. 71, 1989, pages 105
HWANG, W.Y.: "Efficient genome editing in zebrafish using a CRISPR-Cas system.", NATURE BIOTECHNOLOGY, vol. 31, 2013, pages 227 - 229, XP055086625, DOI: 10.1038/nbt.2501
J.J., MCSHAN W.M.AJDIC D.J.SAVIC D.J.SAVIC GLYON KPRIMEAUX CSEZATE SSUVOROV A.N.KENTON S.LAI H.S, PROC. NATL. ACAD. SCI. U.S.A., vol. 98, 2001, pages 4658 - 4663
JIANG, W: "ah RNA-guided editing of bacterial genomes using CRISPR-Cas systems.", NATURE BIOTECHNOLOGY, vol. 31, 2013, pages 233 - 239, XP055249123, DOI: 10.1038/nbt.2508
JINEK ET AL., SCIENCE, vol. 337, no. 6096, 17 August 2012 (2012-08-17), pages 816 - 21
JINEK MCHYLINSKI K.FONFARA IHAUER M.DOUDNA J. A.CHARPENTIER E., SCIENCE, vol. 337, 2012, pages 816 - 821
JINEK, M.: "RNA-programmed genome editing in human cells.", ELIFE, vol. 2, 2013, pages e00471, XP002699851, DOI: 10.7554/eLife.00471
KLEINSTIVER, B. P. ET AL.: ", ''Broadening the targeting range of Staphylococcus aureus CRISPR-Cas9 by modifying PAM recognition", NATURE BIOTECHNOLOGY, vol. 33, 2015, pages 1293 - 1298, XP055309933, DOI: 10.1038/nbt.3404
KLEINSTIVER, B. P. ET AL.: ", ''Engineered CRISPR-Cas9 nucleases with altered PAM specificities", NATURE, vol. 523, 2015, pages 481 - 485, XP055293257, DOI: 10.1038/nature14592
KLEINSTIVER, B.P. ET AL.: "High-fidelity CRISPR-Cas9 nucleases with no detectable genome-wide off-target effects.", NATURE, vol. 529, 2016, pages 490 - 495, XP055650074, DOI: 10.1038/nature16526
KOBLAN ET AL., NATURE BIOTECH, 2018
KOMOR, A.C. ET AL.: ", ''Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity", SCIENCE ADVANCES, vol. 3, 2017, pages 4774
KOMOR, A.C. ET AL.: ", ''Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage", NATURE, vol. 533, 2016, pages 420 - 424, XP093078921, DOI: 10.1038/nature17946
KOMOR, A.C. ET AL.: "Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity", SCIENCE ADVANCES, vol. 3, 2017, pages 4774
KOMOR, A.C. ET AL.: "Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage", NATURE, vol. 533, 2016, pages 420 - 424, XP093078921, DOI: 10.1038/nature17946
KOTIN, HUMAN GENE THERAPY, vol. 5, 1994, pages 793 - 801
LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533
LEVY ET AL., SCIENCE, vol. 228, 1985, pages 190
LIU ET AL.: ", ''C2c1-sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism", MOL. CELL, vol. 65, no. 2, 19 January 2017 (2017-01-19), pages 310 - 322, XP029890333, DOI: 10.1016/j.molcel.2016.11.040
MAKAROVA ET AL.: "Classification and Nomenclature of CRISPR-Cas Systems: Where from Here?", CRISPR J., vol. 1, October 2018 (2018-10-01), pages 325 - 336, XP055619311, DOI: 10.1089/crispr.2018.0033
MALI, P.: "RNA-guided human genome engineering via Cas9.", SCIENCE, vol. 339, 2013, pages 823 - 826, XP055469277, DOI: 10.1126/science.1232033
MILLER ET AL., J. VIROL., vol. 65, 1991, pages 2220 - 2224
MUZYCZKA, J. CLIN., vol. 94, 1994, pages 1351
NAKAMURA, Y. ET AL.: "Codon usage tabulated from the international DNA sequence databases: status for the year 2000", NUCL. ACIDS RES, vol. 28, 2000, pages 292, XP002941557, DOI: 10.1093/nar/28.1.292
NISHIMASU, H. ET AL.: ", ''Engineered CRISPR-Cas9 nuclease with expanded targeting space", SCIENCE, vol. 361, no. 6408, 21 September 2018 (2018-09-21), pages 1259 - 1262, XP055578577, DOI: 10.1126/science.aas9129
PATTANAYAK, NATURE BIOTECHNOL., vol. 31, 2013, pages 839 - 843
PRASHANT ET AL.: "CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering", NATURE BIOTECHNOLOGY, vol. 31, no. 9, 2013, pages 833 - 838, XP055693153, DOI: 10.1038/nbt.2675
QI ET AL., CELL, vol. 152, no. 5, 2013, pages 1173 - 83
QI ET AL.: ", ''Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression", CELL, vol. 152, no. 5, 2013, pages 1173 - 83, XP055346792, DOI: 10.1016/j.cell.2013.02.022
QI ET AL.: ", ''Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression.", CELL, vol. 152, no. 5, 2013, pages 1173 - 83, XP055346792, DOI: 10.1016/j.cell.2013.02.022
RAN ET AL., NAT PROTOC., vol. 8, no. 11, November 2013 (2013-11-01), pages 2281 - 2308
RAN, CELL, vol. 154, no. 6, 12 September 2013 (2013-09-12), pages 1380 - 9
RANGERPEPPAS, MACROMOL. SCI. REV. MACROMOL. CHEM., vol. 23, 1983, pages 61
REES, H.A. ET AL.: ", ''Base editing: precision chemistry on the genome and transcriptome of living cells.", NAT REV GENET., vol. 19, no. 12, December 2018 (2018-12-01), pages 770 - 788
SAMULSKI ET AL., J. VIROL., vol. 63, 1989, pages 03822 - 3828
SAUDEK ET AL., N. ENGL. J. MED., vol. 321, 1989, pages 574
See also references of EP3790595A4
SEFTON, CRC CRIT. REF. BIOMED. ENG., vol. 14, 1989, pages 201
SHMAKOV ET AL.: "Discovery and Functional Characterization of Diverse Class 2 CRISPR Cas Systems", MOL. CELL, vol. 60, no. 3, 5 November 2015 (2015-11-05), pages 385 - 397, XP055785070, DOI: 10.1016/j.molcel.2015.10.008
SLAYMAKER, I.M. ET AL.: "Rationally engineered Cas9 nucleases with improved specificity.", SCIENCE, vol. 351, 2015, pages 84 - 88
SOMMNERFELT ET AL., , VIROL., vol. 176, 1990, pages 58 - 59
TAN JZHANG FKARCHER DBOCK R: "Engineering of high-precision base editors for site-specific single nucleotide replacement.", NAT COMMUN., vol. 10, no. 1, 25 January 2019 (2019-01-25), pages 439
TRATSCHIN ET AL., , MOL. CELL. BIOL., vol. 4, 1984, pages 2072 - 2081
TRATSCHIN ET AL., , MOL. CELL. BIOL., vol. 5, 1985, pages 3251 - 3260
WAHL, G. M.S. L. BERGER, METHODS ENZYMOL., vol. 152, 1987, pages 507
WEST ET AL., VIROLOGY, vol. 160, 1987, pages 38 - 47
WOOD ET AL., J. BIOL. CHEM., vol. 289, no. 21, 2014, pages 14512 - 9
YAMANO ET AL.: "Crystal structure of Cpfl in complex with guide RNA and target DNA.", CELL, vol. 165, 2016, pages 949 - 962
YAN ET AL.: "Functionally diverse type V CRISPR-Cas systems", SCIENCE, vol. 363, no. 6422, 4 January 2019 (2019-01-04), pages 88 - 91, XP055594948, DOI: 10.1126/science.aav7271
YANG ET AL.: ", ''PAM-dependent Target DNA Recognition and Cleavage by C2C1 CRISPR-Cas endonuclease", CELL, vol. 167, no. 7, 15 December 2016 (2016-12-15), pages 1814 - 1828, XP029850724, DOI: 10.1016/j.cell.2016.11.053
ZETSCHE ET AL., CELL, vol. 163, 2015, pages 759 - 771
ZHANG Y. P, GENE THER, vol. 6, 1999, pages 1438 - 47
ZURIS ET AL., NATURE BIOTECHNOL., vol. 33, 2015, pages 73 - 80
ZURIS, J.A. ET AL., NAT. BIOTECHNOLOGY, vol. 33, no. 1, 2015, pages 73 - 80

Cited By (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11286468B2 (en) 2017-08-23 2022-03-29 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with altered PAM specificity
US12241096B2 (en) 2017-08-23 2025-03-04 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with altered PAM specificity
US11624058B2 (en) 2017-08-23 2023-04-11 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with altered PAM specificity
EP3720507A4 (en) * 2017-12-07 2021-08-25 Ramot at Tel-Aviv University Ltd. TREATMENT OF PARKINSON PATIENTS WITH MUTATIONS IN THE LRRK2 GENE
US12133884B2 (en) 2018-05-11 2024-11-05 Beam Therapeutics Inc. Methods of substituting pathogenic amino acids using programmable base editor systems
US12454694B2 (en) 2018-09-07 2025-10-28 Beam Therapeutics Inc. Compositions and methods for improving base editing
EP3924478A4 (en) * 2019-02-13 2023-01-25 Beam Therapeutics, Inc. Compositions and methods for treating glycogen storage disease type 1a
US12016908B2 (en) 2019-02-13 2024-06-25 Beam Therapeutics Inc. Compositions and methods for treating hemoglobinopathies
US11344609B2 (en) 2019-02-13 2022-05-31 Beam Therapeutics Inc. Compositions and methods for treating hemoglobinopathies
US11142760B2 (en) 2019-02-13 2021-10-12 Beam Therapeutics Inc. Compositions and methods for treating hemoglobinopathies
US11752202B2 (en) 2019-02-13 2023-09-12 Beam Therapeutics Inc. Compositions and methods for treating hemoglobinopathies
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
WO2021122944A1 (en) * 2019-12-18 2021-06-24 Alia Therapeutics Srl Compositions and methods for treating retinitis pigmentosa
US12312613B2 (en) 2020-01-24 2025-05-27 The General Hospital Corporation Unconstrained genome targeting with near-PAMless engineered CRISPR-Cas9 variants
US12264341B2 (en) 2020-01-24 2025-04-01 The General Hospital Corporation CRISPR-Cas enzymes with enhanced on-target activity
WO2021163492A1 (en) * 2020-02-14 2021-08-19 Ohio State Innovation Foundation Nucleobase editors and methods of use thereof
US12416001B2 (en) 2020-02-14 2025-09-16 Ohio State Innovation Foundation Nucleobase editors and methods of use thereof
IT202000008014A1 (it) * 2020-04-15 2021-10-15 Fond Telethon RNA guida e loro usi
WO2021216623A1 (en) * 2020-04-21 2021-10-28 Aspen Neuroscience, Inc. Gene editing of lrrk2 in stem cells and method of use of cells differentiated therefrom
WO2021216622A1 (en) * 2020-04-21 2021-10-28 Aspen Neuroscience, Inc. Gene editing of gba1 in stem cells and method of use of cells differentiated therefrom
WO2021222318A1 (en) 2020-04-28 2021-11-04 The Broad Institute, Inc. Targeted base editing of the ush2a gene
WO2022015856A1 (en) * 2020-07-14 2022-01-20 The Regents Of The University Of California Compositions and methods for treating an inherited retinal disease
WO2022027035A1 (en) * 2020-07-27 2022-02-03 The Children's Hospital Of Philadelphia In utero and postnatal gene editing and therapy for treatment of monogenic diseases, including mucopolysaccharidosis type 1h and other disorders
JP2023549339A (ja) * 2020-11-06 2023-11-24 ペアワイズ・プランツ・サーヴィシズ,インコーポレイテッド 対立遺伝子の、rnaによりコードされるdna置換のための組成物および方法
EP4259187A4 (en) * 2020-12-10 2025-07-23 Apellis Pharmaceuticals Inc GENOMIC EDITING OF THE COMPLEMENT
WO2022197727A1 (en) * 2021-03-15 2022-09-22 Duke University Generation of novel crispr genome editing agents using combinatorial chemistry
WO2022251687A3 (en) * 2021-05-28 2023-01-19 Beam Therapeutics Inc. Compositions and methods for the self-inactivation of base editors
WO2025039001A1 (en) * 2023-08-17 2025-02-20 The Trustees Of The University Of Pennsylvania Compositions and methods for the management and treatment of phenylketonuria
WO2025059520A1 (en) * 2023-09-15 2025-03-20 Beam Therapeutics Inc. Compositions and methods for base editing a phenylalanine hydroxylase polynucleotide
WO2025061198A1 (zh) * 2023-09-22 2025-03-27 北京大学现代农业研究院 改进的基因组编辑方法
WO2025122725A1 (en) * 2023-12-06 2025-06-12 The Broad Institute, Inc. Methods and compositions for base editing of tpp1 in the treatment of batten disease

Also Published As

Publication number Publication date
CN112469446A (zh) 2021-03-09
JP2024147545A (ja) 2024-10-16
KR20210023833A (ko) 2021-03-04
KR20250133482A (ko) 2025-09-05
JP2024138268A (ja) 2024-10-08
CA3100034A1 (en) 2019-11-14
JP2021523739A (ja) 2021-09-09
US20230159956A1 (en) 2023-05-25
EP3790963A4 (en) 2022-04-20
EP3790595A4 (en) 2022-06-08
CA3100037A1 (en) 2019-11-14
CN112469446B (zh) 2024-12-17
WO2019217944A1 (en) 2019-11-14
JP7596259B2 (ja) 2024-12-09
AU2019266326A1 (en) 2020-11-26
KR102853088B1 (ko) 2025-09-02
JP2021523738A (ja) 2021-09-09
CN119587720A (zh) 2025-03-11
AU2019266327B2 (en) 2025-11-06
CN112469824A (zh) 2021-03-09
KR20210023832A (ko) 2021-03-04
US20210380955A1 (en) 2021-12-09
EP3790963A1 (en) 2021-03-17
AU2019266327A1 (en) 2020-11-26
EP3790595A1 (en) 2021-03-17

Similar Documents

Publication Publication Date Title
US20250108098A1 (en) Methods of substituting pathogenic amino acids using programmable base editor systems
CN112469446B (zh) 利用可编程碱基编辑器系统编辑单核苷酸多态性的方法
CN112601816B (zh) 使用可编程碱基编辑器系统遏止病原性突变的方法
JP7717684B2 (ja) 新規核酸塩基エディター及びその使用方法
JP7646554B2 (ja) アルファ-1アンチトリプシン不全を治療するための組成物および方法
CN114641567B (zh) 用于编辑突变以允许转录或表达的组合物和方法
AU2020279751A1 (en) Methods of editing a single nucleotide polymorphism using programmable base editor systems
US20240360433A1 (en) Compositions and methods for the treatment of hereditary angioedema (hae)
EP4408986A1 (en) Compositions and methods for treating hepatitis b virus infection

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19799854

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3100034

Country of ref document: CA

Ref document number: 2021513764

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019266326

Country of ref document: AU

Date of ref document: 20190511

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019799854

Country of ref document: EP

Effective date: 20201211