WO2019200033A1 - Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof - Google Patents

Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof Download PDF

Info

Publication number
WO2019200033A1
WO2019200033A1 PCT/US2019/026889 US2019026889W WO2019200033A1 WO 2019200033 A1 WO2019200033 A1 WO 2019200033A1 US 2019026889 W US2019026889 W US 2019026889W WO 2019200033 A1 WO2019200033 A1 WO 2019200033A1
Authority
WO
WIPO (PCT)
Prior art keywords
fusion protein
recombinant fusion
nrg
subject
pharmaceutical composition
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/026889
Other languages
English (en)
French (fr)
Inventor
Liang HUA
Pengyi LUO
Yang Wang
John Li
Shengwei LI
Dixiang LUO
Yiran WU
Ming Zhou
Xiaolei ZHUANG
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genekey Biotech (chengdu) Co Ltd
Salubris Biotherapeutics Inc
Original Assignee
Genekey Biotech (chengdu) Co Ltd
Salubris Biotherapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=66484143&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2019200033(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to IL322374A priority Critical patent/IL322374A/en
Priority to BR112020020646-6A priority patent/BR112020020646A2/pt
Priority to KR1020207032449A priority patent/KR102949228B1/ko
Priority to MYPI2020005322A priority patent/MY204230A/en
Priority to EA202092458A priority patent/EA202092458A1/ru
Priority to MX2020010740A priority patent/MX2020010740A/es
Priority to SG11202009831UA priority patent/SG11202009831UA/en
Priority to CN201980025049.3A priority patent/CN113166218B/zh
Priority to NZ768694A priority patent/NZ768694B2/en
Priority to EP24161673.9A priority patent/EP4361177A3/en
Priority to DK19723548.4T priority patent/DK3774859T3/da
Priority to JP2020556258A priority patent/JP7575272B2/ja
Priority to CN202411003345.2A priority patent/CN118909141A/zh
Priority to AU2019252262A priority patent/AU2019252262B2/en
Priority to FIEP19723548.4T priority patent/FI3774859T3/fi
Priority to CA3096420A priority patent/CA3096420A1/en
Priority to IL277790A priority patent/IL277790B2/en
Priority to PE2020001553A priority patent/PE20210111A1/es
Application filed by Genekey Biotech (chengdu) Co Ltd, Salubris Biotherapeutics Inc filed Critical Genekey Biotech (chengdu) Co Ltd
Priority to ES19723548T priority patent/ES2980163T3/es
Priority to EP19723548.4A priority patent/EP3774859B1/en
Priority to PL19723548.4T priority patent/PL3774859T3/pl
Publication of WO2019200033A1 publication Critical patent/WO2019200033A1/en
Priority to PH12020551648A priority patent/PH12020551648A1/en
Priority to MX2025002112A priority patent/MX2025002112A/es
Anticipated expiration legal-status Critical
Priority to CONC2020/0012621A priority patent/CO2020012621A2/es
Priority to JP2023097663A priority patent/JP7631420B2/ja
Priority to AU2023285793A priority patent/AU2023285793B2/en
Priority to JP2025017265A priority patent/JP2025072502A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • C07K14/4756Neuregulins, i.e. p185erbB2 ligands, glial growth factor, heregulin, ARIA, neu differentiation factor
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • A61K38/185Nerve growth factor [NGF]; Brain derived neurotrophic factor [BDNF]; Ciliary neurotrophic factor [CNTF]; Glial derived neurotrophic factor [GDNF]; Neurotrophins, e.g. NT-3
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/112Retroviridae (F), e.g. leukemia viruses
    • C07K16/114Lentivirus (G), e.g. human immunodeficiency virus [HIV], feline immunodeficiency virus [FIV] or simian immunodeficiency virus [SIV]
    • C07K16/1145Env proteins, e.g. gp41, gp110/120, gp160, V3, principal neutralising domain [PND] or CD4-binding site
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0681Cells of the genital tract; Non-germinal cells from gonads
    • C12N5/0682Cells of the female genital tract, e.g. endometrium; Non-germinal cells from ovaries, e.g. ovarian follicle cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells

Definitions

  • NRG Neuregulin
  • HRG glial growth factor
  • NDF new differentiation factor
  • the NRG protein family has four members: NRG-1, NRG-2, NRG- 3 and NRG-4.
  • NRG (including NRG-1) plays a particularly important role in the development of the heart.
  • NRG-1 As a ligand of tyrosine kinase receptors of the ErbB family, NRG-1 directly binds to membrane-bound ErbB3 or ErbB4, inducing dimerization to create ErbB2/ErbB4, ErbB2/ErbB3, ErbB3/ErbB3 and ErbB4/ErbB4 complexes, and subsequent intracellular signaling.
  • expression of NRG induces paracrine signaling to promote growth and differentiation m cardiac tissue during embryogenesis, with deletion of any of ErbB2, ErhB4 or NRG-1 leading to embryonic lethality.
  • cancer therapies blocking ErbB2 receptor signaling have been shown to have significant cardiotoxicity side-effects, demonstrating in humans that ErbB2 -mediated signaling is essential not only for development but also for the homeostasis of healthy cardiac tissue.
  • NRG-1 signal transduction plays a part in the development and function of other organ systems, as well as in the pathogenesis of human disease (including schizophrenia and head and neck cancer).
  • NRG-1 has many isomers.
  • Research in gene mutated mice indicates that isomers with different N terminal regions or EGF- hke domains have different in vivo functions.
  • the present invention is based on the NRG-If1 ⁇ 22 isoform.
  • Endogenous NRG-l binds to and induces signaling through both ErbB3 (HER3) and ErbB4 (HERA).
  • HER3 ErbB3
  • HERA ErbB4
  • Numerous pre-ciinical and clinical studies have shown the therapeutic potential of NRG-1 across a variety of cardiovascular indications, principally through its interactions with cardiomyocyte-expressed ErbB4 (HER4).
  • HER4 cardiomyocyte-expressed ErbB4
  • three key factors limit the ciinicai applications and utility of recombinant human NRG-l (rhNRG-l).
  • signaling of NRG-1 through HER3 may promote cancer development and-'or progression, raising significant concerns for any application requiring chronic administration or without grave cardiovascular (CV) risk factors.
  • CV grave cardiovascular
  • NRG-1 may disrupt gastrointestinal (GI) epithelial integrity and homeostasis, leading to severe GI toxicity and thus loss of therapeutic window' for NRG-1.
  • GI gastrointestinal
  • both clinical-stage active protein fragments of rhNRG-l have shown a short half-life, indicating that burdensome dosing and administration schedules may be required to achieve the desired therapeutic levels of exposure.
  • burdensome dosing and administration schedules may be required to achieve the desired therapeutic levels of exposure.
  • PK pharmacokinetic
  • the present invention addresses these needs by providing a recombinant protein comprising a fusion of the rhNRG-l active domain with a HERS-specific antagonist antibody: HERS signaling is blocked m a w3 ⁇ 4y that mitigates the oncogenic risk and GI toxicity of rhNRG- 1 , and at the same time the antibody backbone format confers a molecular half-life of a typical monoclonal antibody, enabling more convenient dosing and administration for the product.
  • the present invention relates to a recombinant fusion protein comprising a fragment of the cardioprotective protein neuregulin-1 (NRG-1) fused to a monoclonal antibody (mAb) backbone.
  • NRG-1 fragment is fused to the C-terminus of the antibody heavy chain via a linker.
  • NRG-1 is attached to the linker via the first (1 st ) amino acid on the N-terminus of NRG-1, which in one embodiment is a Serine (S or Ser) amino acid.
  • the fragment is an active fragment that comprises the active domain of NRG- 1.
  • the mAh is monospecific for ErhB3 (HER3)
  • the NRG-l is the NRG-1 B2a isoform.
  • the invention in another aspect, relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a recombinant fusion protein comprising a fragment of the cardioprotective protein neuregulin- 1 (NRG-1) fused to an anti-HER3 monoclonal antibody backbone and a pharmaceutically acceptable earner, diluent or excipient.
  • NSG-1 cardioprotective protein neuregulin- 1
  • the invention in another aspect, relates to a method of treating a disease or condition in a subject in need thereof, the method comprising administering a therapeutically effective amount of the recombinant fusion protein or the pharmaceutical composition comprising the recombinant fusion protein disclosed herein.
  • the invention in another aspect, relates to a method of preventing, inhibiting, suppressing or delaying the onset of a cardiovascular disease or condition in a subject, the method comprising administering an effective amount of the recombinant fusion protein disclosed herein.
  • the invention in another aspect, relates to a method of treating a CNS-related disease or condition in a subject in need thereof, the method comprising administering a therapeutically effective amount of the recombinant fusion protein.
  • the invention in another aspect, relates to a method of preventing, inhibiting, suppressing or delaying the onset of a CNS-related disease or condition in a subject, the method comprising administering an effective amount of the recombinant fusion protein.
  • the NRG-1 binds to and induces signaling through ErbB4 (HER4).
  • the mAb inhibits NRG-l signaling through ErbB3 (HER3).
  • the invention relates to a kit comprising an effective amount of a recombinant fusion protein of the invention or pharmaceutical composition comprising a recombinant fusion protein of the invention.
  • FIGURE 1 shows the Construction of the expression plasmids for expressing the recombinant fusion protein disclosed herein
  • FIGURE 2A-D illustrates the schematic structure of the recombinant fusion protein disclosed herein.
  • FIGURE 2A illustrates a molecular schematic of an anti-HER3 mAb/NRG-l fusion protein of the disclosure.
  • FIGURE 2B show's representative data generated by SDS- PAGE analysis.
  • FIGURE 2C shows Western blot results detected by primary antibody specific for the 61 -ammo acid active fragment of NRG-l comprising the HER3/4 binding domain (“NRG-1”, R&D Systems, Minneapolis, MN).
  • FIGURE 2D shows Western blot results detected by primary' antibody specific for IgG.
  • FIGURE 3 illustrates a binding analysis showing that the recombinant fusion protein disclosed herein binds to HERS protein (Crave 1, Step 2) and can simultaneously bind an anti- NRG-l antibody (Curve 1 , Step 3). Note that Fc mutations were introduced into the recombinant fusi on protein disclosed herein to knock out the Fc effector function of the parent antibody sequence encoding a HERS specific antibody, which may mitigate the undesired cytotoxicity towards normal tissues expressing HERS receptor.
  • Figure 4A shows the mean relative growth rate m the NCI-N87 gastric cancer cell line.
  • Figure 4B show's the mean relative growth rate in the MCF-7 breast cancer cell line.
  • Figure 4C show's the mean relative growth rate in the RT-112 bladder cancer cell line.
  • Figure 4D shows the mean relative growth rate in the T47D breast cancer cell line.
  • the recombinant fusion protein provided herein demonstrates markedly lower activity in promoting cancer cell proliferation.
  • FIGURE 5A-B illustrates that despite reduced cancer cell growth potential, the recombinant fusion protein provided herein fully preserves the ability to induce PI3K/AKT signaling in cardiomyocytes - demonstrating comparable activity to recombinant NRG-1 and GP120 mAb/NRG-l fusion protein.
  • FIGURE 5A is a plot showing the relative ratio of phospho-AKT (pAKT) to total ART (tAKT) versus antibody concentration (in nM) in human cardiomyocytes treated with the recombinant fusion protein of die disclosure and controls.
  • FIGURE 5B is a Western Blot analysis of AKT phosphorylation in human cardiomyocytes treated with the recombinant fusion protein of the disclosure and controls.
  • FIGURE 6A-C shows direct comparison of HER2/4 and HER2/3 dimerization in the presence of the recombinant fusion protein disclosed herein and controls.
  • FIGURE 6A shows the assay principle for detecting ligand-induced dimerization. PathHunter Dimerization Assay- developed by Eurofins DiseoverX (Fremont CA) is used for detecting ligand-induced dimerization of two subunits of a receptor-dimer pair b-gal enzyme is split into two fragments, ProLink (PK) and enzyme receptor (EA).
  • PK ProLink
  • EA enzyme receptor
  • FIGURE 6B is a plot illustrating that the recombinant fusion protein provided herein can induce HER2/HER4 dimerization with potency comparable to NRG-l.
  • Figure 6C is a plot illustrating that the recombinant fusion protein provided herein is significantly less potent than NRG-l in inducing HER2/HER3 dimerization.
  • FIGURE 7 illustrates the binding affinity of anti-HER3 mAb/NRG-1 fusion protein of the invention to HER3 antigen across different species including human, monkey, rat and mouse.
  • the equilibrium dissociation rate (KD) determined by BIAcore analysis is 3.l3xl0 10 (human), 3.97x10 0 (monkey), 2.68x10 9 (rat) and 2.77x10 9 (mouse), respectively.
  • FIGURE 8 is a plot that illustrates the effect of the recombinant fusion protein on ejection fraction (EF) in rat model of systolic heart failure induced by coronary artery ligation.
  • FIGURE 9A-F is a series of 6 images that show histopathological changes in cardiac muscle structure in a rat model of systolic heart failure induced by coronary artery ligation. Cardiac tissues next to the surgical site were collected and fixed 4% formaldehyde, paraffin sections were then prepared and stained with H&E.
  • FIGURE 9A shows cardiac tissue from a sham surgery control rat.
  • FIGURE 9B shows cardiac tissue from a systolic heart failure model rat treated with vehicle control.
  • Figure 9C shows cardiac tissue from a systolic heart failure model rat treated with GP120 mAb/NRG-1 (10 mg/kg).
  • FIGURE 9D shows cardiac tissue from a systolic heart failure model rat treated with anti-HER3 mAb/NRG-1 (1 mg/kg).
  • FIGURE 9E shows cardiac tissue from a systolic heart failure model rat treated with anti-HER3 mAb/NRG- 1 (3 mg/kg).
  • FIGURE 9F shows cardiac tissue from a systolic heart failure model rat treated with anti-HER3 mAb/NRG-1 (10 mg/kg).
  • FIGURE 10 is a graph illustrating the evaluation of in vivo anti -tumor activity ' using a subcutaneous FaDu carcinoma xenograft model in NOD/SCID mice.
  • FIGURE 11 is a graph illustrating body-weight changes in tumor bearing mice treated with the recombinant fusion protein of the disclosure and controls.
  • FIGURE 12 is a graph illustrating the pharmacokinetic profile of the recombinant fusion protein in cynomolgus monkeys (macaques).
  • the current invention utilizes a recombinant fusion protein comprising a fusion between a monoclonal antibody -fused to an active fragment of a neuregulin-l protein isoform across a variety of cardiovascular and central nervous system (CNS) indications.
  • CNS central nervous system
  • “Neuregulin or neuregulin analogs” are molecules that can activate ErbB2/ErbB4 or ErbB2/ErbB3 heterodimer protein tyrosine kinases, such as all neuregulin isoforms, neuregulin EGF domain alone, neuregulin mutants, and any kind of neuregulin-like gene products that also activate the above receptors.
  • the preferred“neuregulin” used in this invention is a polypeptide fragment of human neuregulin 1 b2 isoform containing the EGF -like domain and the receptor binding domain. In one embodiment, the neuregulin fragment is an active fragment.
  • Neuregulin- 1 and isoforms thereof are also known in the art as neuregulin 1 (NRG1), glial growth factor (GGF), Heregulin (HGL), HRG, new- differentiation factor (NDF), ARIA, GGF2, HRG1 , IIRGA, SMDF, MST131 , MSTP131 and NRG! intronic transcript 2 (NRG1-IT2).
  • the terms“ErbB3”,“ErbB3 (HER3)”,“HER3” refer to the same protein (or the same gene when in reference thereto) and are used interchangeably herein.
  • the recombinant fusion comprises a monoclonal antibody portion that is specific for ErbB3.
  • ErbB3 erb-b2 receptor tyrosine kinase 3
  • FERLK e.g., FERLK
  • LCCS2 e.g., LCCS2 receptor tyrosine kinase 3
  • FERLK ErbB3
  • LCCS2 receptor tyrosine kinase 3 is also known in the art as FERLK, LCCS2, ErbB- 3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, pl80-ErbB3, p45-sErhB3 and p85-sErbB3.
  • ErbB4 refers to the same protein (or the same gene when in reference thereto) and are used interchangeably herein.
  • ErbB4 erb-b2 receptor tyrosine kinase 4
  • AES 19 and pI80erbB4 is also known in the art as AES 19 and pI80erbB4.
  • fte terms“ErbB2”,“ErbB2 (HER2)”, ⁇ EK2” refer to the same protein (or the same gene when in reference thereto) and are used interchangeably herein.
  • ErbB2 erb-b2 receptor tyrosine kinase 2
  • NEE NEE
  • NGL NGL
  • TKR1 CD34G
  • HER-2 HER-2
  • MEN 19 HER-2/neu
  • the term“active,” as used herein, refers to a fragment having a biological activity or biological function. In some embodiments, the activity is equal to or approximates the activity' of the wild-type protein.
  • subject includes, but is not limited to, a mammal, including, e.g , a human, non-human primate (e.g., monkey), mouse, pig, cow, goat, rabbit, rat, guinea pig, hamster, horse, monkey, sheep, or other non-human mammal, a non-mammal, including, e.g., a non-mammalian vertebrate, such as a bird (e.g., a chicken or duck) or a fish; and a non mammalian invertebrate.
  • a mammal including, e.g , a human, non-human primate (e.g., monkey), mouse, pig, cow, goat, rabbit, rat, guinea pig, hamster, horse, monkey, sheep, or other non-human mammal, a non-mammal, including, e.g., a non-mammalian vertebrate, such as a bird (e.
  • the methods and compositions of the invention are used to treat (both prophy!actieal!y and/or therapeutically) non-human animals.
  • the ter “subject” can also refer to patients, i.e. individuals aw'aiting or receiving medical care.
  • composition means a composition suitable for pharmaceutical use in a subject, including an animal or human.
  • a pharmaceutical composition generally comprises an effective amount of an active agent (e.g., the recombinant fusion proteins of the invention) and a pharmaceutically acceptable carrier, diluent or excipient (e.g., a buffer, adjuvant, or the like).
  • the term“effective amount” means a dosage or amount sufficient to produce a desired result.
  • the desired result may comprise an objective or subjective improvement in the recipient of the dosage or amount (e.g., long-term survival, decrease in number and/or size of tumors, effective prevention of a disease state, etc.).
  • A‘"prophylactic treatment” is a treatment administered to a subject who does not display signs or symptoms of a disease, pathology, or medical disorder, or displays only early signs or symptoms of a disease, pathology, or disorder, such that treatment is administered for the purpose of diminishing, preventing, or decreasing the risk of developing the disease, pathology, or medical disorder.
  • a prophylactic treatment functions as a preventative treatment against a disease or disorder.
  • a ‘ prophylactic activity” is an activity of an agent, such as the recombinant fusion protein of the invention, or composition thereof, that, when administered to a subject who does not display signs or symptoms of a pathology, disease or disorder (or who displays only early signs or symptoms of a pathology', disease, or disorder) diminishes, prevents, or decreases the risk of the subject developing the pathology, disease, or disorder.
  • a “prophylaeticaliy useful” agent or compound refers to an agent or compound that is useful in diminishing, preventing, treating, or decreasing development of a pathology, disease or disorder.
  • A‘ ‘therapeutic treatment” is a treatment administered to a subject who displays symptoms or signs of pathology' ⁇ , disease, or disorder, in which treatment is administered to the subject for the purpose of diminishing or eliminating those signs or symptoms of pathology, disease, or disorder.
  • A“therapeutic activity” is an activity of an agent, such a recombinant fusion protein of the invention, or a composition thereof, that eliminates or diminishes signs or symptoms of a pathology 7 , disease or disorder, when administered to a subject suffering from such signs or symptoms.
  • A“therapeutically useful” agent or compound indicates that an agent or compound is useful in diminishing, treating, or eliminating such signs or symptoms of the pathology 7 , disease or disorder.
  • treating cancer means reversing, alleviating, inhibiting the progress of, or preventing, either partially or completely, the growth of tumors, tumor metastases, or other cancer-causin or neoplastic cells in a subject.
  • treatment refers to the act of treating.
  • cardiovascular disease means preventing, inhibiting, suppressing, delaying, reversing, or alleviating, either partially or completely, the onset of a cardiovascular disease or condition in a subject, or the progression of a pre-existing cardiovascular disease or condition, or a symptom thereof, in a subject.
  • cardiovascular diseases include chronic heart failure / Congestive heart failure (CHF), acute heart failure / myocardial infarction (MI), left ventricular systolic dysfunction, reperfusion injury associated with MI, chemotherapy -induced cardiotoxicity (adult or pediatric), radiation-induced eardiotoxicity, adjunct to surgical intervention in pediatric congenital heart disease.
  • Non limiting examples of symptoms of cardiovascular disease include shortness of breath, cough, rapid weight gain, swelling m legs, ankles and abdomen, dizziness, fatigue, weakness, dizziness, chest pain, fainting (syncope), taehychardia and bradychardia.
  • Methods of determining the progression of cardiovascular disease and the effecti eness of treatment will be readily apparent to one of ordinary skill in the art.
  • the progression of various cardiovascular diseases can be determined by ejection fraction, electrocardiogram (ECG), Holter monitoring, echocardiogram, stress test, cardiac catheterization, cardiac computerized tomography (CT) scan and cardiac magnetic resonance imaging (MRI).
  • the term“treating a CNS-related disease” also can also mean reversing, slowing or otherwise alleviating a pre-existing CNS-related disease or condition, or a symptom thereof.
  • CNS-related disease or conditions that can be treated with the methods of the disclosure include amyotrophic lateral sclerosis (ALS), Parkinson’s disease, Alzheimer's Disease, Bell's Palsy, epilepsy and seizures, Guil!ain-Barre Syndrome, stroke, traumatic brain injury , multiple sclerosis or a combination.
  • Treating CNS- related diseases can improve or prevent symptoms such as tremors, bradykmesia, rigid muscles, loss of balance, impaired posture, speech changes, loss of motor control, paralysis, trouble swallowing, muscle cramps, seizures, memory loss and confusion.
  • nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence.
  • sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence).
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • the molecules are identical at that position.
  • substantially identical in the context of two nucleic acids or polypeptides, refers to two or more sequences or subsequences that have at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% identity, or at least 9914 identity (e.g., as determined using one of the methods set forth infra).
  • the term "binds,” “specifically binds to,” or is “specific for” refers to measurable and reproducible interactions such as binding between a target and an antibody, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules including biological molecules.
  • an antibody that specifically binds to a target (which can be an epitope) is an antibody that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets.
  • the extent of binding of an antibody to an unrelated target is less than about 10% of the binding of the antibody to the target as measured, for example, by a radioimmunoassay (RIA).
  • an antibody that specifically binds to a target has a dissociation constant (Kd) of ⁇ 1 mM, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, or ⁇ 0.1 iiM.
  • an antibody specifically binds to an epitope on a protein that is conserved among the protein from different species.
  • specific binding can include, but does not require exclusive binding.
  • references to “neuregulin” or“a neureguhn peptide” includes mixtures of such neuregulins, neuregulin isoforms, and/or neuregulin-like polypeptides.
  • Reference to“the formulation” or“the method” includes one or more formulations, methods, and/or steps of the type described herein and/or which will become apparent to those persons skilled in the art upon reading this disclosure.
  • polypeptide refers to a polymer of amino acids and its equivalent and does not refer to a specific length of a product; thus,“peptides” and“proteins” are included within the definition of a polypeptide. Also included within the definition of polypeptides are “antibodies” as defined herein.
  • A“polypeptide region” refers to a segment of a polypeptide, which segment may contain, for example, one or more domains or motifs (e.g., a polypeptide region of an antibody can contain, for example, one or more complementarity determining regions (CDRs)).
  • fragment ’ refers to a portion of a polypeptide preferably having at least 20 contiguous or at least 50 contiguous amino acids of the polypeptide.
  • a“derivative” is a polypeptide or fragment thereof having one or more non-conservative or conservative amino acid substitutions relative to a second polypeptide (also referred to as a“variant”); or a polypeptide or fragment thereof that is modified by covalent attachment of a second molecule such as, e.g , by attachment of a heterologous polypeptide, or by glycosyiation, acetylation, phosphorylation, and the like.
  • polypeptides containing one or more analogs of an amino acid e.g., unnatural amino acids and the like
  • polypeptides with unsubstituted linkages as well as other modifications known in the art, both naturally and non-naturally occurring.
  • An“isolated” polypeptide is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant componen ts of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the polypeptide, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
  • An isolated polypeptide includes an isolated antibody, or a fragment or derivative thereof.
  • the current invention utilizes a recombinant fusion protein comprising a fusion between a monoclonal antibody -fused to a fragment of a neuregulin-1 protein isoform for use across a variety of cardiovascular and neurologic indications.
  • the antibody is specific for ERBB3 (HER3).
  • an‘ ‘ antibody” refers to a protein comprising one or more polypeptides substantially or partially encoded by immunoglobulin genes or fragments of immunoglobulin genes.
  • the recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as myriad immunoglobulin variable region genes.
  • Light chains are classified as either kappa or lambda.
  • Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
  • a Apical immunoglobulin (e.g., antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one“light” (about 25 kD) and one“heavy” chain (about 50-70 kD). The N- terminus of each chain defines a variable region of about 100 to 1 10 or more amino acids primarily responsible for antigen recognition.
  • VL variable light chain
  • VH variable heavy chain
  • Antibodies exist as intact immunoglobulins or as a number of well characterized fragments produced by digestion with various peptidases.
  • pepsin digests an antibody below the disulfide linkages m the hinge region to produce F(ab')2, a dimer of Fab which itself is a light chain joined to VH-CH1 by a disulfide bond.
  • the F(ab')2 may be reduced under mild conditions to break the disulfide linkage in the hinge region thereby converting the F(ab')2dimer into an Fab' monomer.
  • the Fab' monomer is essentially an Fab with part of the hinge region (see, Fundamental Immunology, W. E.
  • Antibodies include single chain antibodies, including single chain Fv (sFv or scFv) antibodies in which a variable heavy and a variable light chain are joined together (directly or through a peptide linker) to form a continuous polypeptide.
  • Antibodies include single domain antibodies, which comprise an antibody fragment consisting of a single monomeric variable antibody domain that is able to bind selectively to an antigen domain.
  • Exemplary single domain antibodies include VHH fragments, which were originally isolated from camelids.
  • the antibody domain of the fusion protein optionally comprises all or part of an immunoglobin molecule and optionally contains all or part of an immunoglobin variable region (i.e., the area of specificity for the disease related antigen) and optionally comprises region(s) encoded by a V gene, and/or a D gene and/or a I gene
  • the antibodies used herein optionally comprise F(ab)2, F(ab')2, Fab, Fab', scFv, single domain antibodies, etc. depending upon the specific requirements of the embodiment.
  • Some embodiments utilize fusion proteins comprising IgG domains.
  • other embodiments comprise alternate immunoglobins such as IgM, IgA, IgD, and IgE.
  • different embodiments of the invention comprise various hinge regions (or functional equivalents thereof). Such hinge regions provide flexibility between the different domains of the antihody-immunostimulant fusion proteins. See, e.g., Penichet, et al. 2001 “Antibody-cytokine fusion proteins for the therapy of cancer” J Immunol Methods 248:91-101.
  • the mAb comprised by the recombinant fusion protein of the invention is monospecific for ErhB3 (HER3)).
  • Human HER3 (ErbB-3, ERBB3, c-erbB-3, c-erbB3, receptor tyrosine-protein kinase erbB-3) encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases which also includes HER ! (also known as EGFR), HER2, and HER4 (Kraus, M.H. et al, PNAS 86 (1989) 9193-9197; Plowman, G.D. et al, PNAS 87 (1990) 4905-4909; Kraus, M.H. et al, PNAS 90 (1993) 2900-2904).
  • EGFR epidermal growth factor receptor
  • the Iran smembrane receptor HER3 consists of an extracellular ligand- binding domain (EXD), a dimerization domain within the ECD, a transmembrane domain, an intracellular protein tyrosine kinase domain (TKD) and a C -terminal phosphorylation domain.
  • EXD extracellular ligand- binding domain
  • TKD transmembrane domain
  • C -terminal phosphorylation domain This membrane-bound HER3 protein has a Heregulin (HRG) binding domain within the extracellular domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other HER family members which do have kinase activity.
  • HRG Heregulin
  • Heterodimerization leads to the activation of the receptor-mediated signaling pathway and transphosphorylation of its intracellular domain. Dimer formation between HER family members expands the signaling potential of HER3 and is a means not only for signal diversification but also signal amplification. For example the HER2/HER3 heterodimer induces one of the most important mitogenic signals via the PI3K and AKT pathway among HER family members (Sliwkowski M.X., et al, I. Biol Chem. 269 (1994) 14661 -14665; Alimandi M, et al, Oncogene. 10 (1995) 1813- 1821; He! h er. N.J., J. Biol. Chem. 276 (2001) 42153-4261 ; Singer, E., J. Biol.
  • the human ERBB3 protein comprises the following amino acid sequence provided in GenBank AAH02706. I and set forth in SEQ ID NO: 1 :
  • ERBB3 (HER3) sequence targeted by the antibody of the present methods and compositions may be an isomer, homolog, or variant of SEQ ID NO: 1.
  • the mAb of the recombinant fusion protein provided herein is an anti-Her3 mAb that inhibits NRG-1 signaling through ErbB3 (HER3).
  • the mAb comprised by the recombinant fusion protein of the invention comprises an anti-HER3 mAb.
  • anti-HER3 antibodies may include, but are not limited to the following: patritumab, seribantumab (fully human mAb), LJM716, KTN3379, AV-203, REGN1400, GSK2849330, or MM-141.
  • Such antibodies may be also be selected from any of the following forms, including, chimeric, bi-specific, non-human, fully human, or humanized form, so long as they bind to and inhibit signaling from human ERBB3 (HER3).
  • the anti-HER3 antibody is of human origin.
  • the term "antibody” encompasses the various forms of antibody structures including, but not being limited to, whole antibodies and antibody fragments.
  • the antibody according to the invention is preferably a human antibody, humanized antibody, chimeric antibody, or further genetically engineered antibody as long as the characteristic properties according to the invention are retained.
  • Antibody fragments comprise a portion of a full length antibody, preferably the variable domain thereof, or at least the antigen binding site thereof. Examples of antibody fragments include diabodies, single-chain antibody molecules, and multispecific antibodies formed from antibody fragments. scFv antibodies are, e.g., described m Huston, J.S., Methods in Enz mol. 203 (1991) 46-88.
  • antibody fragments comprise single chain polypeptides having the characteristics of a VH domain, namely being able to assemble together with a VL domain, or of a VL domain binding to the respective antigen being able to assemble together with a VH domain to a functional antigen binding site and thereby providing the properties of an antibody according to the invention.
  • the terms "monoclonal antibody " or "monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of a single ammo acid composition.
  • a chimeric antibody may be used in the compositions and methods provided herein.
  • the term "chimeric antibody” refers to a monoclonal antibody comprising a variable region, i.e., binding region, from mouse and at least a portion of a constant region derived from a different source or species, usually prepared by recombinant DNA techniques. Chimeric antibodies comprising a mouse variable region and a human constant region are especially preferred.
  • Such rat/human chimeric antibodies are the product of expressed immunoglobulin genes comprising DNA segments encoding rat immunoglobulin variable regions and DNA segments encoding human immunoglobulin constant regions.
  • chimeric antibodies encompassed by the present invention are those in which the class or subclass has been modified or changed from that of the original antibody. Such “chimeric” antibodies are also referred to as "class-switched antibodies.” Methods for producing chimeric antibodies involve conventional recombinant DNA and gene transfection techniques now well known in the art. See, e.g., Morrison, S.L., et al, Proc. Natl. Acad Sci. USA 81 (1984) 6851-6855; US 5,202,238 and US 5,204,244
  • a humanized antibody may be used in the compositions and methods provided herein.
  • the term "humanized antibody” or “humanized version of an antibody” refers to antibodies in which the framework or "complementarity determining regions” (CDR) have been modified to comprise the CDR of an immunoglobulin of different specificity as compared to that of the parent immunoglobulin.
  • the CDRs of the VH and VL are grafted into the framework region of human antibody to prepare the "humanized antibody.” See e.g. Riechmann, I,., et al, Nature 332 (1988) 323-327; and Neuberger, M.S., et al, Nature 314 (1985) 268-270.
  • the heavy and light chain variable framework regions can be derived from the same or different human antibody sequences.
  • the human antibody sequences can be the sequences of naturally occurring human antibodies.
  • Human heavy and light chain variable framework regions are listed e.g. in Lefranc, M.-P., Current Protocols in Immunology' (2000) - Appendix IP A.1P.1- A.1P.37 and are accessible via IMGT, the international ImMunoGeneTics information system® (http://imgt.cines.fr) or via http://vbase.mrc-cpe.camac.uk.
  • the framework region can be modified by further mutations.
  • Particularly preferred CDRs correspond to those representing sequences recognizing the antigens noted above for chimeric antibodies.
  • humanized antibody as used herein also comprises such antibodies which are modified in the constant region to generate the properties according to the invention, especially in regard to complement component iq (Clq) binding and/or Fc Receptor (FcR) binding, e.g. by "class switching” i.e. change or mutation of Fc parts (e.g. from IgGl to IgG4 and/or IgGl/igG4 mutation).
  • class switching i.e. change or mutation of Fc parts (e.g. from IgGl to IgG4 and/or IgGl/igG4 mutation).
  • human antibody as used herein, is intended to include antibodies having variable and constant regions derived from human germ line immunoglobulin sequences. Human antibodies are well-known in the state of the art (van Dijk, M.A., and van de Winkel, J.G., Curr. Opin. Chem. Biol.
  • Human antibodies can also be produced in transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire or a selection of human an tibodies in the absence of endogenous immunoglobulin production. Transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge (see, e.g., Jakobovits, A., et al, Proc. Natl. Acad.
  • human antibody as used herein also comprises such antibodies which are modified in the constant region to generate the properties according to the invention.
  • the mAb comprised by the recombinant fusion protein provided herein comprises at least one mutation in the Fc domain or region.
  • recombinant human antibody is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from a host cell, for example aNSO or CHO cell or from an animal (e.g. a mouse) that is transgenic for human immunoglobulin genes or antibodies expressed using a recombinant expression vector transfected into a host cell. S uch recombinant human antibodies have variable and constant regions in a rearranged form. The recombinant human antibodies accordin to the invention have been subjected to in vivo somatic hypermutation. Thus, the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germ line VH and VL sequences, may not naturally exist within the human antibody germ line repertoire vivo.
  • the terms "which binds to human HER3", “which specifically binds to human HER3", or “anti-HER3 antibody” are interchangeable and refer to an antibody which specifically binds to the human HER3 antigen with a KD-value of about 4.8lx !0 mol/L or lower at 25°C.
  • the binding affinity is determined with a standard binding assay at 25°C, such as surface p!asmon resonance technique (BIAcore®, GE-Healthcare Uppsala, Sweden).
  • an "antibody which binds to human HERS” as used herein refers to an antibody or portion thereof specifically which binds to the human HER3 antigen with a binding affinity within a range of KD 1.0 x 10 8 mol/L - 1.0 x 10 13 mol/L) at 25°C, and preferably with a KD-value of 4.81x iG mol/L or lower at 25°C.
  • an anti-HERS antibody comprised by the recombinant fusion protein disclosed herein comprises a variable region heavy (VH) chain and a variable region light (VL) chain in one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 2 and SEQ ID NO: 3, respectively; and has one or more of the following properties: inhibition of HER3 phosphorylation in tumor cells, inhibition of AKT phosphorylation in tumor cells, inhibition of signaling through ErbB3 (HER3), and inhibition of the proliferation of tumor cells.
  • the anti-HERS mAh provided herein comprises a VH am o acid sequence set forth in SEQ ID NO: 2:
  • the anti-HER3 mAb provided herein comprises a VL amino acid sequence of SEQ ID NO; 3;
  • DIEMTQSPDS LAVSLGERAT INCRSSQSVL YSSSNRNYLA WYQQNPGQPP KLLIYWASTR ESGVPDRFSG SGSGTDFTLT ISSLQAEDVA VYYCQQYYST PRTFGQGTKV EIKRTVAAPS VFIFPPSDEQ LKSGTASVVC LLNNFYPREA KVQWKVDNAL QSGNSQESVT EQDSKDSTYS LSSTLTLSKA DYEKHKVYAC EVTHQGLSSP VTKSFNRGEC (SEQ ID NO; 3).
  • the anti-HER3 antibody of the present invention comprises at least one mutation in the Fc region.
  • the mature anti-HER3 antibody (i.e.- !acking a signal peptide) of the present invention comprises at least one mutation in amino acids 234, 239, 434, or a combination thereof, where in other embodiments, the amino acid mutations comprise at least one of the following substitution mutations: L234F, S239A, N434A or a combination thereof.
  • mutations to amino acids 234 and/or 239 knock down effector functions of the anti-HER3 antibody.
  • a mutation to amino acid 434 extends the half-life of the antibody in a subject.
  • the one or more mutations m the Fc region reduce effector function.
  • the reduced effector function comprises a reduced affinity of the anti-HER3 antibody for one or more Fc Receptors.
  • the FcRs can be FcyRI, FcyRIIa, FcyRIib, FcyRIIIa (158F), FcyRIIIa (158V) and Clq.
  • the reduced affinity comprising an increase in dissociation constant of about 1 order of magnitude or greater.
  • introducing one or more Fc mutations increases the KD of the anti-HER3 antibody of fusion protein comprising same for FcyRI from 2.8IxlO 9 M to 1.03x10 s M.
  • introducing one or more Fc mutations increases the KD of the a ti- HER3 antibody of fusion protein comprising same for FcyRIIa from 3.95x10 7 M to 1.35xl0 6 M. In some embodiments, introducing one or more Fc mutations increases the KD of the anti- HER3 antibody of fusion protein comprising same for FcyRIib from 1.03x1 O 7 M to l.52xl0 6 M. In some embodiments, introducing one or more Fc mutations increases the KD of the anti- HER3 antibody of fusion protein comprising same for FcyRIIIa (158F) from 6.37x10 8 M to 1.18xlO 7 M. In some embodiments, introducing one or more Fc mutations increases the KD of the anti-HER3 antibody of fusion protein comprising same for FcyRJiia (158V) from 3.41 xl O 8 M to 9.10x1 O 8 M.
  • the anti ⁇ HER3 antibody or recombinant fusion protein comprising same binds to FcyRI with an equilibrium dissociation constant (KD) higher than or equal to l G3xl0 8 M
  • the anii-HER3 antibody or recombinant fusion protein comprising same comprises one or more Fc mutations and binds to FcyRIla with a KD higher than or equal to 1.35xl0 b M.
  • the anti -HERS antibody or recombinant fusion protein comprising same comprises one or more Fc mutations and hinds to FcyRIIb with a KD higher than or equal to 1.5 xlO 6 M.
  • the anti-HER3 antibody or recombinant fusion protein comprising same comprises one or more Fc mutations and binds to FcyRIIIa (158F) with a KD higher than or equal to l. l8xl(f 7 M.
  • the anii ⁇ HER3 antibody or recombinant fusion protein comprising same comprises one or more Fc mutations and binds to FcyRIIIa (158V) with a KD higher than or equal to 9.10x10 8 M.
  • antibody effector function(s) refers to a function contributed by an Fc region(s) of an Tg. Such function can be affected by, for example, binding of an Fc effector region (s) to an Fc receptor on an immune cell with phagocytic or lytic activity or by binding of an Fc effector region(s) to components of the complement system.
  • the a ti-HER3 antibody does not induce antibody-dependent cellular cytotoxicity (ADCC).
  • ADCC antibody-dependent cellular cytotoxicity
  • the antibody according to the invention is glycosylated.
  • the glycosy!ation is N-glycosylation.
  • the glycosylation is O-glycosylatioii.
  • the antibodies comprised by the recombinant fusion protein may be produced via recombinant means.
  • Such methods are widely known in the state of the art and comprise protein expression in prokaryotic and eukaryotic cells with subsequent isolation of the antibody polypeptide and usually purification to a pharmaceutically acceptable purity.
  • nucl eic acids encoding light and heavy chains or fragments thereof are inserted into expression vectors by standard methods. Expression is performed in appropriate prokaryotic or eukaryotic host cells, such as CHO ceils, NS0 cells, SP2/0 cells, HEK293 cells, COS ceils, yeast, or E.
  • the antibodies may be present in whole cells, in a cell lysate, or in a partially purified, or substantially pure form.
  • variable domains Cloning of variable domains is described by Orlandi, R., et al, Proc. Natl. Acad. Sci. USA 86 (1989) 3833- 3837; Carter, P., et al, Proc. Natl. Acad. Sci. USA 89 (1992) 4285-4289; Norderhaug, L., et al, J. Immunol Methods 204 (1997) 77-87.
  • a preferred transient expression system (HEK 293) is described by Schlaeger, E.-J. and Christensen, K., in Cytotechnology 30 (1999) 71-83, and by Sehlaeger, E.-J., m J. Immunol.
  • Monoclonal antibodies are suitably separated from the culture medium by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
  • DNA and RNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures.
  • the hybridoma cells can serve as a source of such DNA and RNA.
  • the DNA may be inserted into expression vectors, which are then transfected into host cells, such as HEK 293 cells, CHO cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of recombinant monoclonal antibodies in the host cells.
  • host cells such as HEK 293 cells, CHO cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of recombinant monoclonal antibodies in the host cells.
  • the heavy and light chain variable domains according to the invention are combined with sequences of promoter, translation initiation, constant region, 3' untranslated region, polyadenylation, and transcription termination to form expression vector constructs.
  • the heavy and light chain expression constructs can be combined into a single vector, co-transfected, serially transfected, or separately transfected into host cells which are then fused to form a single host cell expressing both chains.
  • the antibodies are administered to the subject in therapeutically effective amount which is the amount of the subject compound or combination that will elicit the biological or medical response of a tissue, system, animal or human that is being sought by the researcher, veterinarian, medical doctor or other clinician.
  • the recombinant fusion protein provided herein comprises a fragment of an NRG-1 protein.
  • NRG proteins can bind to the ErbB4 receptor on the surface of myocardial ceils, continuously activate the PI3K/AKT signal pathway in the cell, and change the structure of the myocardial cells, thereby improving the function of myocardial cells.
  • neuregulin or“NRG” refers to proteins or peptides that can bind and activate ErbB3, ErbB4 or heterodimers or homodimers thereof, including neuregulin isoforms, neuregulin EGF-like domain, polypeptides comprising neuregulin EGF-like domain, neuregulin mutants or derivatives, and any kind of neuregulin-like gene products that can activate the above receptors
  • Neuregulin also includes NRG-1, NRG-2, NRG- 3 and NRG-4 proteins, peptides, fragments and compounds that have the functions of neuregulin.
  • neuregulin is a protein or peptide that can hind to and activate ErbB2/ErbB4 or ErbB2/ErbB3 heterodimers, for example, but not for the purpose of restriction, peptides of the present invention includes a fragment of the NKO-1b2 isoform, i.e., the 177-237 amino acid fragment, which contains the EGF-like domain having the following amino acid sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYK AEELYQ (SEQ ID NO: 4).
  • the NRG proteins of the present invention can activate the receptors above and regulate their biological functions, for example, stimulate the synthesis of acetylcholine receptors in skeletal muscle cells, promote the differentiation and survival of cardiomyocytes and DNA synthesis. It is well known to those of skill in this art that a mutation of a single amino acid m a non-critical region generally would not alter the biological activity of the resulting protein or polypeptide (see, e.g., Watson et ah, Molecular Biology of the Gene, 4th Edition, 1987, The Bejacmin/Cummings Pub.co.,p. 224).
  • the NRG proteins of the invention can be isolated from natural sources, may be modified through recombination technology, artificial synthesis or other means.
  • “epidermal growth factor-like domain” or“EGF-like domain” refers to a polypeptide fragment encoded by the neuregulin gene that binds to and activates ErbB3, ErbB4, or heterodimers or homodimers thereof and including heterodimers with ErbB2, and structurally similar to the EGF receptor binding region as described in WO 00/64400, Holmes et aL Science, 256: 1205-1210 (1992); U.S. Pat. Nos. 5,530,109 and 5,716,930; Hijazi et al., Int J.
  • EGF-!ike domain binds to and activates ErhB2/ErhB4 or ErbB2/ErbB3 heterodimers.
  • EGF-like domain comprises the amino acid sequence of the receptor binding domain of NRG-1.
  • EGF-like domain refers to amino acid residues 177-226, 177-237, or 177-240 of NRG-1.
  • EGF- like domain comprises the amino acid sequence of the receptor binding domain of neuregulin- 2 (NRG-2, also known in the art as DON1, HRG2 and NTAK).
  • NRG-2 also known in the art as DON1, HRG2 and NTAK.
  • an EGF-like domain of NRG-2 comprises a sequence of HARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCL (SEQ ID NO: 15)
  • EGF-like domain comprises the amino acid sequence of the receptor binding domain of neureguhn 3 (NRG-3, also known in the art as EIRG3 and pro-NRG3).
  • the EGF-like domain of NRG-3 comprises a sequence of HFKPCRDKDLAYCLNDGECFVIETLTGSHKHCRCKEGYQGVRCD (SEQ ID NO: 16).
  • EGF-like domain comprises the amino acid sequence of the receptor binding domain of neuregulin 4 (NRG-4, also known in the art as HER4).
  • NRG-4 neuregulin 4
  • an EGF-like domain of NRG-4 comprises a sequence of HEEPCGPSHKSFCLNGGLGYVIPTIPSPFCRCVENYTGARCE (SEQ ID NO: 17).
  • EGF-like domain comprises the amino acid sequence of Ala Glu Lys GIu Lys Thr Phe Cys Val Asn Gly Glu Cys Phe Met Val Lys Asp Leu Ser Asn Pro (SEQ ID NO:
  • the NRG-1 protein provided in the recombinant fusion protein disclosed herein is the NRG-1 B2a isoform.
  • the active NRG-1 fragment comprises the ERBB3/4 binding domain.
  • the NRG-1 binds to and induces signaling through ErbB4 (HER4).
  • the mAb inhibits NRG-1 signaling through ErbB3 (HER3).
  • the active protein fragment of NRG-1 comprises the active domain of NRG- 1.
  • the NRG-1 in the recombinant fusion protein disclosed herein is fused to the C -terminus of the anti-HER3 antibody heavy chain using a linker.
  • NRG-1 is attached to the linker via the first (1 st ) amino acid on the N-termmus of NRG- 1, which in one embodiment is a Serine (S or Ser) amino acid.
  • the specific recombinant fusion protein utilized in the current invention may be optionally obtained or created by any method known in the art (including purchase from commercial sources).
  • nucleic acid sequences encoding the appropriate antibody framework are optionally cloned and ligated into appropriate vectors (e.g., expression vectors for, e.g., prokaryotic or eukaryotic organisms).
  • appropriate vectors e.g., expression vectors for, e.g., prokaryotic or eukaryotic organisms.
  • nucleic acid sequences encoding the NRG-1 B2a isoform molecule are optionally cloned into the same vector in the appropriate orientation and location so that expression from the vector produces an antibody -NRG- 1 B2a isoform fusion protein.
  • Some optional embodiments also require post-expression modification, e.g., assembly of antibody subunits, etc. The techniques and art for the above (and similar) manipulations are well known to those skilled in the art.
  • the antibody domain and NRG-1 B2a isoform are assembled post-expression through, e.g., chemical means.
  • the present invention provides a composition, e.g. a pharmaceutical composition comprising the recombinant fusion protein of the present invention.
  • the recombinant fusion protein promotes cardiomyocyte proliferation, differentiation, and survival. In another embodiment, the recombinant fusion protein promotes proliferation, differentiation and survival of cardiac tissue. In one embodiment, the recombinant fusion protein promotes cardiomyocyte proliferation, differentiation, and survival without promoting cancer and/or tumor growth. In another embodiment, the recombinant fusion protein promotes proliferation, differentiation and survival of cardiac tissue without promoting cancer or tumor growth.
  • the cancer is adrenocortical carcinoma, AIDS-related cancers, AIDS-related lymphoma, anal cancer, anorectal cancer, cancer of the anal canal, appendix cancer, childhood cerebellar astrocytoma, childhood cerebral astrocytoma, basal cell carcinoma, skin cancer (non-melanoma), biliary cancer, extrahepatic bile duct cancer, intrahepatie bile duct cancer, bladder cancer, urinary bladder cancer, bone and joint cancer, osteosarcoma and malignant fibrous histiocytoma, brain cancer, brain tumor, brain stem glioma, cerebellar astrocytoma, cerebral astrocytoma/malignant glioma, ependymoma, medulloblastoma, supratentorial primitive neuroectodermal tumors, visual pathway and hypothalamic glioma, breast cancer, bronchial adenomas/careinoids
  • the recombinant fusion protein promotes proliferation, differentiation and survival of central nervous system (CNS) cells. In another embodiment, the recombinant fusion protein promotes proliferation, differentiation and survival of central nervous system (CNS) cells without promoting cancer and/or tumor growth. In another embodiment, the recombinant fusion protein has a reduced capacity to induce antibody- dependent cell cytotoxicity (ADCC)
  • the recombinant fusion protein promotes HER2/4 signaling over HER2/3 signaling relative to the signal induction potential of recombinant NRG- 1.
  • the recombinant fusion protein comprises an anti-HER3mAb fused to or operably linked to the C-terminus of the antibody heavy chain via a GGGGSGGGGS (G4S) linker (SEQ ID NO: 5) to the NRG-l B2a isoform of SEQ ID NO; 4.
  • G4S GGGGSGGGGS
  • SEQ ID NO: 5 to the NRG-l B2a isoform of SEQ ID NO; 4.
  • one or more copies of the linker may be used.
  • 2, 3, 4, or 5 copies of the G4S linker or any other linker known in the art as being suitable for the composition disclosed herein may be used herein.
  • linker refers to a molecule (including but not limited to unmodified or modified nucleic acids or amino acids) or group of molecules (for example, 2 or more, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more) connecting two compounds, such as two polypeptides.
  • the linker may be comprised of a single linking molecule or may comprise a linking molecule and at least one spacer molecule, intended to separate the linking molecule and a compound by a specific distance.
  • a nucleic acid sequence is“operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
  • a nucleic acid presequence or secretory' leader is operably linked to a nucleic acid encoding a polypeptide if it is expressed as a preprotein that participates m the secretion of the polypeptide;
  • a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • “operably linked” means that the nucleic acid sequences being linked are contiguous, and, in the case of a secretory' leader, contiguous and in reading frame. However, enhancers are optionally contiguous. Linking can be accomplished, for example, by ligation at convenient restriction sites. If such sites do not exist, synthetic oligonucleotide adaptors, linkers or other methods known in the art can be used. In another embodiment, the “operably linked” also refers to the functional pairing of distinct amino acid sequences, peptides or proteins, as in the pairing of the antibody and NRG-l fragment described herein via a linker sequence also described herein.
  • the anti-HER3 mAb heavy chain comprised by the recombinant fusion protein provided herein is encoded by SEQ ID NO: 6:
  • CTCTTTTTATAAGGCTGAGGAGCTGTACCAGTAA (SEQ ID NO: 6).
  • sequence set forth in SEQ ID NO: 6 comprises no Fc mutations.
  • SEQ ID NO: 6 is also referred to as“NPCF”
  • the recombinant fusion protein provided herein comprises a heavy chain of an an ⁇ i-HER3 mAb.
  • the anti-HER3 mAb heavy chain is encoded by SEQ ID NO: 7:
  • SEQ ID NO: 7 is also referred to as“NPCFA”.
  • SEQ ID NO: 7 comprises one or more mutations that encode for one or more mutations in the constant (Fc) region of the anti-HER3 mAh provided herein.
  • the mature anti-HER3 antibody of the present invention comprises at least one mutation m amino acids 234, 239, 434, or a combination thereof.
  • the amino acid mutations comprise at least one of the following substitution mutations: L234F, S239A, N434A or a combination thereof.
  • the recombinant fusion protein provided herein comprises a light chain sequence of an anti-HER3 mAb.
  • the light chain sequence is encoded by (SEQ ID NO: 8):
  • SEQ ID NO: 8 is also referred to as
  • the heavy chain of the anti-HER3 antibody comprised by the recombinant fusion protein provided herein comprises the following ammo acid sequence: [001031 MEFGLSWVFLVAIIKGVQCQVQLQQWGAGLL PSETLSLTCAVYGGS FSGYYWSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRVTISVETSKNQFSLKLSSVT
  • the heavy chain of the anti-HER3 antibody comprised by the recombinant fusion protein provided herein comprises the following ammo acid sequence:
  • the anti-HER3 mAb heavy chain sequence comprises a signal peptide sequence.
  • the anti-HER3 mAb heavy chain signal peptide sequence comprises the amino acid sequence of MEFGLSWVFLVAIIKGVQC (SEQ ID NO: 11).
  • light chain of the anti-HER3 antibody comprised by the recombinant fusion protein comprises the following amino acid sequence:
  • the anti-HER3 mAh light chain sequence comprises a signal peptide sequence.
  • the anti-HER3 mAh light chain signal peptide sequence comprises the amino acid sequence of MVLQTQVFISLLLWISGAYG (SEQ ID NO: 13).
  • a mature polypeptide such as an antibody heavy chain or light chain amino acid sequence disclosed herein lacks a signal peptide.
  • the recombinant fusion protein comprises the following amino acid sequences:
  • each of the heavy chain sequence and light chain sequence in the mature recombinant fusion protein lack a signal peptide amino acid sequence.
  • the heavy chain of the anti-HER3 antibody provided herein is fused via the C-terminus linker sequence to the NRG-l B2a isoform provided herein.
  • the C-terminus of the antibody heavy chain comprises the Fc domain of the antibody.
  • the anti-HER3 antibody and the NRG-1 fragment described herein are recombinantly or chemically fused/ operably linked via a linker to form a fusion protein.
  • A“fusion protein,”“fusion polypeptide,”“recombinant fusion protein,” or “recombinant polypeptide” refers to a hybrid polypeptide which comprises polypeptide portions from at least two different polypeptides.
  • A“fusion protein” as defined herein is a fusion of a first amino acid sequence (protein) comprising, for example an NRG- 1 fi2a isoform of the invention, joined via a linker to the C -terminus of a second amino acid sequence comprising an heavy' chain of an antibody that binds specifically to ERBB3 (HERS).
  • protein comprising, for example an NRG- 1 fi2a isoform of the invention
  • the fusion protein is recombinantly encoded and produced.
  • the recombinant fusion protein is encoded by a nucleic acid sequence encoding the antibody of the invention that is operably linked via a nucleic acid sequence encoding a linker, to a nucleic acid sequence encoding an NRG-1 B2a isoform of the invention.
  • the recombinant fusion protein amino acid sequence is homologous to SEQ ID NO: 14 fused to SEQ ID NO: 3.
  • the term“homology” may refer to identity to recombinant fusion protein sequence (e.g. to any of SEQ ID NO: 1-18) of greater than 70%.
  • “homology” refers to identity' to any of SEQ ID NO: 1 -18 of greater than 72%.
  • “homology'” refers to identity to any of SEQ ID NO: 1-18 of greater than 75%.
  • “homology” refers to identity' to any of SEQ ID NO: 1-18 of greater than 78%.
  • “homology” refers to identity' to any of SEQ ID NO: 1-18 of greater than 80%. In another embodiment,“homology” refers to identity to any of SEQ ID NO: 1-18 of greater than 82%. In another embodiment, “homology” refers to identity to any of SEQ 1D NO: 1-18 of greater than 83%. In another embodiment,“homology” refers to identity to any of SEQ ID NO: 1-18 of greater than 85%. In another embodiment,“homology” refers to identity to any of SEQ ID NO: 1-18 of greater than 87%. ln another embodiment,“homology'” refers to identity to any of SEQ ID NO: 1-18 of greater than 88%.
  • “homology” refers to identity to any of SEQ ID NO: 1-18 of greater than 90%. In another embodiment,“homology” refers to identity to any of SEQ ID NO: 1-18 of greater than 92%. In another embodiment,“homology” refers to identity to any of SEQ ID NO: 1-18 of greater than 93%. In another embodiment,“homology” refers to identity to any of SEQ ID NO: 1-18 of greater than 95%. In another embodiment, “homology” refers to identity to any of SEQ ID NO: 1-18 of greater than 96%. In another embodiment,“homology” refers to identity to any of SEQ ID NO: 1 -18 of greater than 97%.
  • “homolog ) '” refers to identity to any of SEQ ID NO: 1-18 of greater than 98%.
  • “homology” refers to identity to any of SEQ ID NO: 1-18 of greater than 99%.
  • “homology” refers to identity to any of SEQ ID NO: 1-18 of 100%.
  • the determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • a non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul, 1990, Proc Natl. Acad. Sci. USA 87:2264-2268, modified as in Karlin and Altschul, 1993, Proc. Natl. Acad. Sci. L3 ⁇ 4V190:5873-5877.
  • Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul et al, 1990, J Mol. Biol.
  • Gapped BLAST can be utilized as described in Altschul et al , 1997, Nucleic Acids Res. 25:3389-3402.
  • PSI-Blast can be used to perform an iterated search which detects distant relationships between molecules (id.).
  • protein sequence alignment may be carried out using the CLUSTAL W algorithm, as described by Higgins et al, 1996, Methods Enzymol. 266:383-402
  • polynucleotides of the present invention are prepared using PCR techniques using procedures and methods known to one skilled in the art.
  • the procedure involves the ligation of two different DNA sequences (See, for example,“Current Protocols in Molecular Biology”, eds Ausubel et al., John Wiley & Sons, 1992).
  • polynucleotides of the present invention are inserted into expression vectors (i.e., a nucleic acid construct) to enable expression of the recombinant polypeptide.
  • the expression vector of the present invention includes additional sequences which render this vector suitable for replication and integration in prokaryotes.
  • the expression vector of the present invention includes additional sequences which render this vector suitable for replication and integration in eukaryotes.
  • the expression vector of the present invention includes a shuttle vector which renders this vector suitable for replication and integration in both prokaryotes and eukaryotes.
  • cloning vectors comprise transcription and translation initiation sequences (e.g., promoters, enhancer) and transcription and translation terminators (e.g., polyadenylation signals).
  • prokaryotic or eukaryotic cells can be used as host-expression systems to express the polypeptides of the present invention.
  • these include, but are not limited to, microorganisms, such as bacteria transformed with a recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vector containing the polypeptide coding sequence; yeast transformed with recombinant yeast expression vectors containing the polypeptide coding sequence.
  • non-bacteria! expression systems are used (e.g., mammalian expression systems such as CHO ceils) to express the polypeptide of the present invention.
  • the expression vector used to express polynucleotides of the present invention in mammalian cells is pCI-DHFR vector comprising a CMV promoter and a neomycin resistance gene.
  • a number of expression vectors can be advantageously selected depending upon the use intended for the polypeptide expressed.
  • large quantities of polypeptide are desired.
  • vectors that direct the expression of high levels of the protein product, possibly as a fusion with a hydrophobic signal sequence, which directs the expressed product into the periplasm of the bacteria or the culture medium where the protein product is readily purified are desired.
  • vectors adaptable to such manipulation include, but are not limited to, the pET series of E. coli expression vectors [Studier et al., Methods in Enzymol. 185:60-89 (1990)].
  • yeast expression systems are used.
  • a number of vectors containing constitutive or inducible promoters can be used in yeast as disclosed in U.S. Pat. No. 5,932,447.
  • vectors which promote integration of foreign DNA sequences into the yeast chromosome are used.
  • the expression vectors of the present invention can further include additional polynucleotide sequences that allow, for example, the translation of several proteins from a single mRNA such as an internal ribosome entry site (IRES) and sequences for genomic integration of the promoter-chimeric polypeptide.
  • IRS internal ribosome entry site
  • the expression vectors of the present invention include elements that increase the expression of the recombinant fusion proteins of the invention. Such features include, but are not limited to, choice of promoter and po!yadenylation.
  • the polyadenylation sequence is a bovine growth hormone (BGH) polyadenylation sequence.
  • BGH bovine growth hormone
  • the promoter comprises a constitutive! ⁇ active promoter.
  • the promoter comprises a cytomegalovirus promoter (pCMV).
  • mammalian expression vectors include, but are not limited to, pcDNA3, pcDNA3 1 (+/-), pGL3, pZeoSV2(+/-), pSecTag2, pDisplay, pEF/myc/cyto, pCMV/myc/cyto, pCR3 l, pSinRepS, DH26S, DHBB, pNMTl, pNMT4i, pNMTBl, which are available from Invitrogen, pCI which is available from Promega, pMbac, pPbac, pBK-RSV and pBK-CMV which are available from Strategene, pTRES which is available from Clontech, and their derivatives.
  • expression vectors containing regulatory elements from eukaryotic viruses such as retroviruses are used by the present invention.
  • SV40 vectors include pSVT7 and pMT2
  • vectors derived from bovine papilloma virus include pBV-lMTHA
  • vectors derived from Epstein Barr virus include pHEBO, and p205.
  • exemplary vectors include pMSG, pAV009/A + , pMTOlO/A + , pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the SV -40 early promoter, SV-40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
  • recombinant viral vectors are useful for m vivo expression of the polypeptides of the present invention since they offer advantages such as lateral infection and targeting specificity.
  • lateral infection is inherent in the life cycle of, for example, retrovirus and is the process by which a single infected cell produces many progeny virions that hud off and infect neighboring ceils.
  • the result is that a large area becomes rapidly infected, most of which was not initially infected by the original viral particles.
  • viral vectors are produced that are unable to spread laterally. In one embodiment, this characteristic can be useful if the desired purpose is to introduce a specified gene into only a localized number of targeted cells.
  • various methods can be used to introduce the expression vector encoding the recombinant fusion protein of the present invention into cells. Such methods are generally described in Sambrook et af, Molecular Cloning: A Laboratory Manual, Cold Springs Harbor Laboratory', New York (1989, 1992), in Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1989), Chang et af, Somatic Gene Therapy, CRC Press, Ann Arbor, Mich. (1995), Vega et al, Gene Targeting, CRC Press, Ann Arbor Mich.
  • introduction of nucleic acid by viral infection offers several advantages over other methods such as lipofection and electroporation, since higher transfection efficiency can be obtained due to the infectious nature of viruses.
  • the polypeptides of the present invention can also be expressed from a nucleic acid construct administered to the individual employing any suitable mode of administration, described hereinabove (i.e., in-vivo gene therapy).
  • the nucleic acid construct is introduced into a suitable cell via an appropriate gene delivery vehicle/method (transfection, transduction, homologous recombination, etc.) and an expression system as needed and then the modified cells are expanded in culture and returned to the individual (i.e., ex-vivo gene therapy).
  • the expression construct of the present invention can also include sequences engineered to optimize stability, production, purification, yield or activity of the expressed polypeptide.
  • transformed cells are cultured under effective conditions, which allow for the expression of high amounts of recombinant fusion protein or polypeptide.
  • effective culture conditions include, but are not limited to, effective media, bioreactor, temperature, pH and oxygen conditions that permit protein production.
  • an effective medium refers to any medium in which a cell is cultured to produce the recombinant polypeptide of the present invention.
  • a medium typically includes an aqueous solution having assimilable carbon, nitrogen and phosphate sources, and appropriate salts, minerals, metals and other nutrients, such as vitamins.
  • cells of the present invention can be cultured in conventional fermentation bioreactors, shake flasks, test tubes, microtiter dishes and petri plates.
  • culturing is carried out at a temperature, pH and oxygen content appropriate for a recombinant cell.
  • culturing conditions are within the expertise of one of ordinary skill in the art.
  • resultant polypeptides of the present invention either remain within the recombinant cell, secreted into the fermentation medium, secreted into a space between two cellular membranes, such as the periplasmie space in E. coli ; or retained on the outer surface of a cell or viral membrane.
  • the phrase“recovering the recombinant polypeptide” used herein refers to collecting the whole fermentation medium containing the polypeptide and need not imply additional steps of separation or purification.
  • polypeptides of the present invention are purified using a variety of standard protein purification techniques, such as, but not limited to, affinity' chromatography, ion exchange chromatography, filtration, electrophoresis, hydrophobic interaction chromatography, gel filtration chromatography, reverse phase chromatography, concanavalin A chromatography, chromatofocusing and differential solubilization.
  • the expressed coding sequence can be engineered to encode the polypeptide of the present invention and fused cleavable moiety.
  • a fusion protein can be designed so that the polypeptide ca be readily isolated by affinity chromatography: e.g., by immobilization on a column specific for the cleavable moiety.
  • a cleavage site is engineered between the polypeptide and the cleavable moiety and the polypep tide can be released from the chromatographic column by treatment with an appropriate enzyme or agent that specifically cleaves the fusion protein at this site [e.g., see Booth et at., Immunol. Lett. 19:65-70 (1988); and Gardella et al., J. Biol. Chem. 265 : 15854- 15859 ( 1990)] .
  • polypeptide of the present invention is retrieved in “substantially pure” form.
  • the phrase‘ ‘ substantially pure” refers to a purity that allows for the effective use of the protein in the applications described herein.
  • the polypeptide of the present invention can also be synthesized using m vitro expression systems.
  • m vitro synthesis methods are well known in the art and the components of the system are commercially available.
  • the recombinant polypeptides are synthesized and purified; their therapeutic efficacy can be assayed in vivo or in vitro.
  • the pharmaceutical composition provided herein comprising the recombinant fusion protein of the invention is further formulated with a pharmaceutical carrier.
  • pharmaceutical carrier includes any and ail solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g. by injection or infusion).
  • the present invention provides a method of treating a disease or condition in a subject in need thereof, the method comprising administering a therapeutically effective amount of the recombinant fusion protein or the pharmaceutical composition comprising the recombinant fusion protein disclosed herein.
  • the present invention provides a method of treating a cardiovascular disease or condition in a subject in need thereof, the method comprising administering a therapeutically effective amount of the recombinant fusion protein or a pharmaceutical composition comprising the same
  • the present invention provides a method of preventing, inhibiting, suppressing or delaying the onset of a cardiovascular disease or condition in a subject, the method comprising administering an effective amount of the recombinant fusion protein or the pharmaceutical composition described herein.
  • the cardiovascular disease comprises a chronic heart failure / Congestive heart failure (CHF), acute heart failure / myocardial infarction (MI), left ventricular systolic dysfunction, reperfusion injury associated with MI, chemotherapy-induced cardiotoxicity (adult or pediatric), radiation-induced cardiotoxicity, adjunct to surgical intervention m pediatric congenital heart disease.
  • CHF chronic heart failure / Congestive heart failure
  • MI myocardial infarction
  • RV left ventricular systolic dysfunction
  • reperfusion injury associated with MI a chronic heart failure / Congestive heart failure
  • chemotherapy-induced cardiotoxicity adult or pediatric
  • radiation-induced cardiotoxicity adjunct to surgical intervention m pediatric congenital heart disease.
  • the wherein the chemotherapy-induced cardiotoxicity results from a subject receiving anthracy dines, alkylating agents, antimicrotubule agents, and antimetabolites agents used as chemotherapy.
  • the cardiovascular condition is cardiotoxicity as a result of a subject receiving a cancer therapy.
  • the cancer therapy is a HER-2 targeted therapy.
  • the HER-2 targeted therapy comprises use of trastuzumab, ado-trastuzumab, emtansme, lapatinib, neratinib, and pertuzumab, any anti-HER2 antibody, any anti-HER2 agent or a combination thereof.
  • the invention relates to a method of inducing remodeling of muscle cell sarcomeric and cytoskeleton structures, or cell-cell adhesions, the method comprising treating the cells with the recombinant fusion protein disclosed herein.
  • the therapeutic method is directed to treating heart failure resulting from disassociation of cardiac muscle cell-cell adhesion and/or the disarray of sarcomeric structures in the mammal.
  • the present invention provides a method for preventing, treating or delaying heart failure with preserved ejection fraction in a human, the method comprising administering a pharmaceutical composition comprising a recombinant fusion protein disclosed herein.
  • ejection fraction refers to Ejection fraction (EF), a measurement, typically expressed as a percentage, of how much blood the left ventricle pumps out with each contraction. For example, an ejection fraction of 50 percent means that 50 percent of the total amount of blood in the left ventricle is pushed out with each heartbeat.
  • EF Ejection fraction
  • the invention is directed to treating subjects with or at risk for development of heart disease and related conditions, e.g , heart failure
  • heart failure is meant an abnormality of cardiac function where the heart does not pump blood at the rate needed for the requirements of metabolizing tissues.
  • Heart failure includes a wide range of disease states such as congestive heart failure, myocardial infarction, tachyarrhythmia, familial hypertrophic cardiomyopathy, ischaemic heart disease, idiopathic dilated cardiomyopathy, and myocarditis.
  • the heart failure can be caused by any number of factors, including ischaemic, congenital, rheumatic, or idiopathic forms.
  • Chronic cardiac hypertrophy is a significantly diseased state which is a precursor to congestive heart failure and cardiac arrest.
  • treatment refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow' down (lessen) heart hypertrophy.
  • Those need of treatment include those already with the disorder as well as those prone to have the disorder or those in winch the disorder is to be prevented.
  • the heart hypertrophy may be from any cause wiiich is responsive to retinoic acid, including congenital, viral, idiopathic, cardiotrophic, or myotrophic causes, or as a result of ischaemia or ischaemic insults such as myocardial infarction.
  • the treatment is performed to stop or slow the progression of hypertrophy, especially after heart damage, such as from ischaemia, has occurred.
  • the pharmaceutical composition provided herein is given immediately after the myocardial infarction, to prevent or lessen hypertrophy.
  • treating a subject with a pharmaceutical composition comprising the recombinant fusion protein provided herein can result in increase in average survival time of a population of treated subjects in comparison to a population receiving monotherapy with a drug that is not a compound of the disclosure, or a pharmaceutically acceptable salt, solvate, analog or derivative thereof.
  • the average sumval time is increased by more than 30 days; more preferably, by more than 60 days; more preferably, by more than 90, 120, or 365 days; more preferably, by more than 365 days.
  • An increase in average survival time of a population may be measured by any reproducible means.
  • An increase in average survival time of a population may be measured, for example, by calculating for a population the average length of survival following initiation of treatment with an active compound.
  • An increase in average survival time of a population may also be measured, for example, by calculating for a population the average length of survival following completion of a first round of treatment with the pharmaceutical composition disclosed herein
  • treating a subject with a pharmaceutical composition comprising the recombinant fusion protein provided herein can result in a decrease in the mortality rate of a population of treated subjects in comparison to a population receiving carrier alone.
  • Treating cancer can result m a decrease in the mortality rate of a population of treated subjects in comparison to an untreated population.
  • Treating cancer can result in a decrease in the mortality rate of a population of treated subjects in comparison to a population receiving monotherapy with a drug that is not a compound of the disclosure, or a pharmaceutically acceptable salt, solvate, analog or derivative thereof.
  • the mortality rate is decreased by more than 2%; more preferably, by more than 5%; more preferably, by more than 10%; and most preferably, by more than 25%.
  • a decrease in the mortality rate of a population of treated subjects may be measured by any reproducible means.
  • a decrease in the mortality rate of a population may be measured, for example, by calculating for a population the average number of disease-related deaths per unit time following initiation of treatment with an active compound.
  • a decrease in the mortality rate of a population may also be measured, for example, by calculating for a population the average number of disease- related deaths per unit time following completion of a first round of treatment with the pharmaceutical composition disclosed herein.
  • the present invention provides a method of treating a central nervous system (CNS)-related disease or condition in a subject in need thereof, the method comprising administering a therapeutically effective amount of the recombinant fusion protein or the pharmaceutical composition described herein.
  • CNS central nervous system
  • the present invention provides a method of preventing, inhibiting, suppressing or delaying the onset of a CNS-related disease or condition in a subject, the method comprising administering an effective amount of the recombinant fusion protein or the pharmaceutical composition described herein.
  • the CNS-related disease or condition is amyotrophic lateral sclerosis (ALS), Parkinson’s disease, Alzheimer's Disease, Bell's Palsy, epilepsy and seizures, Guillam-Barre Syndrome, stroke, traumatic brain injur ⁇ , multiple sclerosis or a combination.
  • ALS amyotrophic lateral sclerosis
  • Parkinson’s disease Alzheimer's Disease, Bell's Palsy, epilepsy and seizures
  • Guillam-Barre Syndrome stroke
  • stroke traumatic brain injur ⁇
  • multiple sclerosis or a combination is administered, Dosing
  • a composition of the present invention can be parenterally administered to a subject in need thereof, or can be administered by a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. To administer a compound of the invention by certain routes of administration, it may be necessary to coat the compound with, or co-administer the compound with, a material to prevent its inactivation.
  • the compound may be administered to a subject in an appropriate carrier, for example, liposomes, or a diluent.
  • Pharmaceutically acceptable diluents include saline and aqueous buffer solutions.
  • Pharmaceutical carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art.
  • preparations for administration to subjects include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
  • Some embodiments include non-aqueous solvents such as propylene glycol, polyethylene glycol, vegetable oils (e.g., olive oils), organic esters (e.g , ethyl oleate) and other solvents known to those of skill in the art.
  • Physiologically acceptable carriers are optionally used m certain embodiments of the invention. Examples of such include, e.g., saline, PBS, Ringer's solution, lactated Ringer's solution, etc.
  • preservatives and additives are optionally added to the compositions to help ensure stability and sterility.
  • antibiotics and other bactenocides, antioxidants, chelating agents, and the like are all optionally present in various embodiments of the compositions herein.
  • parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intra-arterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intra-articular, subcapsular, subarachnoid, intraspinal, epidural and intrastemal injection and infusion.
  • the compounds of the present invention which may be used in a suitable hydrated form, and/or the pharmaceutical compositions of the present invention, are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those of skill in the art.
  • the recombinant fusion protein, or pharmaceutical composition comprising the same are optionally administered to subjects in need of treatment (either therapeutically or prophylactically) in any appropriate sterile pharmaceutical carrier.
  • Such pharmaceutical carrier acts to maintain the solubility and action of the fusion protein.
  • it may he desired to administer additional components in conjunction with the fusion protein.
  • chemotherapeutic agents, antibiotics, additional formulations comprising the recombinant fusion protein of the invention and one or more standard of care agents, etc. are all optionally included with the compositions of the invention.
  • the terms“combination treatment,”“combination therapy,” and “co-therapy” are used interchangeably and generally refer to treatment modalities featuring an recombinant fusion protein or pharmaceutical composition comprising the same as provided herein and an additional therapeutic agent.
  • combination treatment modalities are paid of a specific treatment regimen intended to provide a beneficial effect from the concurrent action of the therapeutic agent combination.
  • the beneficial effect of the combination may include, but is not limited to, pharmacokinetic or pharmacodynamic co-action resulting from the combination of therapeutic agents.
  • Administration of these therapeutic agents in combination typically is carried out over a defined time period (usually minutes, hours, days or weeks depending upon the combination selected).
  • combination treatment comprises administration of two or more therapeutic agents in a sequential manner, wherein each therapeutic agent is administered at a different time, as well as administration of these therapeutic agents, or at least two of the therapeutic agents, in a substantially simultaneous manner.
  • Substantially simultaneous administration can be accomplished, for example, by administering to the subject a single dosage form having a fixed ratio of each therapeutic agent or in multiple, separate dosage forms for the therapeutic agents.
  • Sequential or substantially simultaneous administration of each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, intramuscular routes, and direct absorption through mucous membrane tissues.
  • the therapeutic agents can be administered by the same route or by different routes.
  • the therapeutic agents can be administered according to the same or to a different administration interval.
  • a first therapeutic agent of the combination selected may be administered by intravenous injection while the other therapeutic agents of the combination may be administered orally.
  • all therapeutic agents may be administered orally or all therapeutic agents may be administered by intravenous injection.
  • combination therapy also embraces the administration of the therapeutic agents as described above in further combination with other biologically active ingredients and non-drug therapies (e.g., surgery or radiation treatment).
  • the combination therapy further comprises a non-drag treatment
  • the non-drag treatment may be conducted at any suitable time so long as a beneficial effect from the co-action of the combination of the therapeutic agents and non-drug treatment is achieved. For example, in appropriate cases, the beneficial effect is still achieved when the non-drag treatment is temporally removed from the administration of the therapeutic agents, perhaps by days or even weeks.
  • the additional therapeutic agent is a chemotherapeutic agent (also referred to as an anti -neoplastic agent or anti -proliferative agent), e.g., an alkylating agent; an antibiotic; an anti-metabolite; a detoxifying agent; an interferon; a polyclonal or monoclonal antibody; an EGFR inhibitor; a HER2 inhibitor; a histone deacetylase inhibitor; a hormone; a mitotic inhibitor; an MTOR inhibitor; a multi-kinase inhibitor; a serine/threonine kinase inhibitor; a tyrosine kinase inhibitors; a VEGF/VEGFR inhibitor; a taxane or taxane derivative, an aromatase inhibitor, an anthracy cline, a microtubule targeting drug, a topoisomerase poison drug, an inhibitor of a molecular target or enzyme (e.g., a kinas), e.g.,
  • alkylating agents suitable for use according to the combination treatment modalities provided herein include, but are not limited to, cyclophosphamide (Cytoxan; Neosar); chlorambucil (Leukeran); melphalan (Alkeran); carmustine (BiCNU); busulfan (Busulfex); !omustine (CeeNU); dacarbazine (DTIC-Dome); oxaliplatin (Eloxatin); carmustine (Gliadel); ifosfamide (Ifex); mechlorethamine (Mustargen); busulfan (Myleran); carboplatin (ParapJatin); cisplatin (CDDP; Platinol); temozolomide (Temodar); thiotepa (Thioplex); bendamustine (Treanda); or streptozocin (Zanosar)
  • doxorubicin (Adriamycin); doxorubicin liposomal (Doxil); mitoxantrone (Novantrone); bleomycin (Blenoxane); daunorubicin (Cerubidine); daunorubicin liposomal (DaunoXome); dactinomycin (Cosmegen); epirubicin (Ellence); idarubicin (Idamycin); plicamycin (Mithracin); mitomycin (Mutamycin); pentostatin (Nipent); or valrubiciii (Valstar).
  • Exemplary anii-metabolites include, but are not limited to, fluorouracil (Adrucil); capecitabine (Xeloda); hydroxyurea (Hydrea); mercaptopurine (Purinethol); pemetrexed (Alimta); fludarabine (Fludara); nelarabine (Arran on); c!adrihine (Cladribine Novaplus); clofarabine (Clolar); cytarabine (Cytosar-U); decitabme (Dacogen): cytarabine liposomal (DepoCyt); hydroxyurea (Droxia); pralatrexate (Folotyn); floxuridine (FUDR); gemcitabine (Gemzar); cladribine (Leustatin); fludarabine (Oforta); methotrexate (MTX; Rheumatrex); methotrexate (Trexail
  • Exemplary detoxifying agents include, but are not limited to, amifostine (Ethyol) or mesna (Mesnex).
  • interferons include, but are not limited to, interferon alfa-2b (Intron A) or interferon alfa-2a (Roferon-A).
  • Exemplary polyclonal or monoclonal antibodies include, but are not limited to, trastuzumab (Herceptin); ofatumumab (Arzerra); bevacizumab (Avastin); rituximab (Rituxan); cetuximab (Erbitux); panitumumab (Vectibix); tositumomab/iodme-131 tositumomab (Bexxar); alemtuzumab (Campath); ibritumomab (Zevalin; In-l l l; Y-90 Zevalin); gemtuzumab (Mylotarg); ecuhzumab (Soliris) or denosumab.
  • Exemplary EGFR inhibitors include, but are not limited to, gefitinib (!ressa); lapatinib (Tykerb); cetuximab (Erbitux): erlotmib (Tarceva); panitumumab (Vectibix); PKI- 166; canertinib (CI-1033); matuzumab (EMD 72000) or EKB-569.
  • Exemplary HER2 inhibitors include, but are not limited to, trastuzumab (Herceptin); lapatinib (Tykerb) or AC-480.
  • Flistone Deacetylase Inhibitors include, but are not limited to, vorinostat (Zo!inza).
  • Exemplary hormones include, but are not limited to, tamoxifen (Soltamox; Nolvadex); raloxifene (Evista); megestrol (Megace); leuprolide (Lupron; Lupron Depot; Eligard; Viadur) ; fulvestrant (Faslodex); letrozole (Fernara); triptorelin (Trelstar LA; Trelstar Depot) : exemestane (Aromasin) ; goserelin (Zoladex) ; bicalutamide (Casodex); anastrozole (Arimidex); fluoxymesterone (Androxy; Halotestin); medroxyprogesterone (Provera; Depo- Provera); estramustine (Emcyt); flutamide (Eulexin); toremifene (Fareston); degarelix (Firmagon); mlutamide (N
  • Exemplary mitotic inhibitors include, but are not limited to, paclitaxel (Taxol; Onxol; Abraxane); docetaxel (Taxotere); vincristine (Oncovin; Vincasar PFS); vinblastine (Veltaan); etoposide (Toposar; Etopophos; VePesid); teniposide (Vumon); ixabepilone (Ixempra); nocodazole; epothilone; vinorelbine (Navelbine); camptothecin (CPT); irinotecan (Camptosar); topotecan (Hycamtin); amsacrine or lamellarin D (LAM-D).
  • paclitaxel Taxol; Onxol; Abraxane
  • docetaxel Taxotere
  • vincristine Oncovin
  • Vincasar PFS vinblastine
  • Exemplary MTOR inhibitors include, but are not limited to, everolimus (Afimtor) or temsirolimus (Torisel); rapamune, ridaforolimus; or AP23573.
  • Exemplary' multi-kinase inhibitors include, but are not limited to, sorafenib (Nexavar); sunitimb (Sutent); BIBW 2992; E7080; Zd6474; PKC-412; motesanib; or AP24534.
  • Exemplary serine/threonine kinase inhibitors include, but are not limited to, ruboxistaunn; eril/fasudil hydrochloride; flavopiridol; seliciclib (CYC202; Roscovitine); SNS- 032 (BMS-387032); Pkc412; bryostatm; KAI-9803; SF1126; VX-680; A/d i i 2; Arry-142886 (AZD-6244); SCIO-469; GW681323; CC-401; CEP-1347 or PD 332991.
  • Exemplary' tyrosine kinase inhibitors include, but are not limited to, er!otinib (Tarceva); gefitmib (Iressa); imatinib (Gleevec); sorafenib (Nexavar); sunitimb (Sutent); trastuzumab (Herceptin); bevacizumab (Avastin); rituximab (Rituxan); lapatinib (Tykerb); cetuximab (Erbitux); panitumumab (Vectibix); everolimus (Afmitor); alemtuzumab (Campath); gemtuzumab (Mylotarg); temsirolimus (Torisel); pazopanib (Votnent); dasatinib (Spry cel); nilotimb (Tasigna); vatalanib (Ptk787; ZK222584); CEP-701
  • Exemplary VEGF/VEGFR inhibitors include, but are not limited to, bevacizumab (Avastin), sorafenib (Nexavar), sunitinib (Sutent), ranibizumab, pegaptamb, or vandetinib.
  • Exemplar ⁇ ' microtubule targeting drugs include, but are not limited to, paclitaxel, docetaxel, vincristm, vinblastin, nocodazole, epothilones and navelbine.
  • topoisomerase poison drugs include, but are not limited to, teniposide, etoposide, adriarnyein, camptothecin, daunorubicin, dactinomycin, mitoxantrone, amsacrine, epirubicin and idarubicm.
  • Exemplary taxanes or taxane derivatives include, but are not limited to, paclitaxel and docetaxol.
  • Exemplar ⁇ ' immune checkpoint inhibitors include programmed cell death 1 (PD-1), CD274 molecule (PD-L1) and cytotoxic T-lymphocyte associated protein 4 (CTLA4) inhibitors.
  • PD-1 inhibitors include Pembrolizumab, Nivolumab and Cemiplimab.
  • PD-L1 inhibitors include Atezolizumab, Avelumab and Durvalumab.
  • CLTA4 inhibitors include Ipilimumab.
  • Exemplar ⁇ platinum based antineoplastic agents include Cisplatin and
  • Exemplary cyclin dependent kinase (CDK) inhibitors include abemaciclib, palbociclib, and ribociclib.
  • Exemplary poly (ADP-ribose) polymerase (PARP) inhibitors include talazoparib, olaparib, rucaparib, niraparib and veliparib.
  • Exemplary general chemotherapeutic, anti -neoplastic, a ti -proliferative agents include, but are not limited to, a!tretamine (Hexalen); isotretinoin (Accutane; Amn esteem; Claravis; Sotret); tretinoin (Vesanoid); azacitidine (Vidaza); bortezomib (Velcade) asparaginase (Elspar); levamisole (Ergamisol); mitotane (Lysodren); procarbazine (Matulane); pegaspargase (Oncaspar); denileukin diftitox (Ontak); porfimer (Photofrin); aldesleukin (Proleukin); lenalidomide (Revlimid); bexarotene (Targretin); thalidomide (Thalomid); temsirolimus (Torisel);
  • combination treatment modalities are provided in which the additional therapeutic agent is a cytokine, e.g., G-CSF (granulocyte colony stimulating factor).
  • a pharmaceutical composition provided herein may be administered in combination with radiation therapy. Radiation therapy can also be administered in combination with a pharmaceutical composition pro vided herein and another chemotherapeutic agent described herein as part of a multi-agent therapy.
  • a pharmaceutical composition provided herein may be administered in combination with standard chemotherapy combinations such as, but not restricted to, CMF (cyclophosphamide, methotrexate and 5- fluorouracil), CAF (cyclophosphamide, adriamycin and 5 -fluoro uracil), AC (adnamycin and cyclophosphamide), FEC (5-fluorouracil, epirubicin, and cyclophosphamide), ACT or ATC (adriamycin, cyclophosphamide, and paclitaxel), rituximab, Xeloda (capecitabme), Cisplatin (CDDP), Carboplatin, TS-1 (tegafur, gimestat and otastat potassium at a molar ratio of 1 :0.4: 1 ), Camptothecin-1 1 (CPT-i l , Irinotecan or CamptosarTM), CHOP
  • CMF
  • a pharmaceutical composition pro vided herein may he administered with an inhibitor of an enzyme, such as a receptor or non-receptor kinase.
  • an enzyme such as a receptor or non-receptor kinase.
  • Receptor and non-receptor kinases are, for example, tyrosine kinases or serine/threonine kinases.
  • Kinase inhibitors described herein are small molecules, polynucleic acids, polypeptides, or antibodies.
  • Exemplary' kinase inhibitors include, but are not limited to, Bevacizumab (targets VEGF), BIBW 2992 (targets EGFR and Erb2), Cetuximab/Erbitux (targets Erbl), Imatinib/Gleevec (targets Bcr-Abl), Trastuzumab (targets Erb2), Gefitimb/Iressa (targets EGFR), Ranibizumah (targets VEGF), Pegaptanib (targets VEGF), Erlotinib/Tarceva (targets Erbl), Nilotinib (targets Bcr-Abl), Lapatinib (targets Erbl and Erb2/Her2), GW- 572016/iapatinib ditosylate (targets HER2/Erb2), Panitumumab/Vectibix (targets EGFR), Vandetinib (targets RET/VEGFR),
  • the recombinant fusion protein or pharmaceutical composition comprising the same polypeptide disclosed herein is administered to a subject once a day.
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject once ever ⁇ ' two days.
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject once every three days.
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject once every four days.
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject once every five days.
  • the recombinant fusion protein or pharmaceutical composition comprising the same polypeptide is administered to a subject once every six days. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject once ever ⁇ ' week. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject once every' 7-14 days. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject once every 10-20 days. In another embodiment, die recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject once every' 5-15 days. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject once every 15-30 days.
  • a dose of the recombinant fusion protein of the present invention comprises from 0.005 to 0.1 milligrams/kg in an injectable solution. In another embodiment, the dose comprises from 0.005 to 0.5 milligrams/kg of the recombinant fusion protein. In another embodiment, the dose comprises from 0.05 to 0.1 micrograms of the recombinant fusion protein. In another embodiment, the dose comprises from 0.005 to 0. 1 milligrams/kg of the recombinant fusion protein in an injectable solution.
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0 0001 mg to 0.6 mg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.001 mg to 0.005 mg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.005 mg to 0.01 mg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject m a dose ranging from 0.01 mg to 0.3 mg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.2 mg to 0.6 mg.
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 1-100 uicg/kg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 10-80 mcg/kg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 20-60 mcg/kg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 10-50 mcg/kg.
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 40-80 mcg/kg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 10-30 mcg/kg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 30-60 mcg/kg
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 100 mg/kg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject m a dose ranging from 0.1 mcg/kg to 50 mg/kg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 25 mg/kg.
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 10 mg/kg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 5 mg/kg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 1 mg/kg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.1 mcg/kg to 0.1 mg/kg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 10 mg/kg to 60 mg/kg.
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 0.5 mg/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 20 mg/kg, about 30 mg/kg, about 40 mg/kg, about 50 mg/kg, about 60 mg/kg or about 70 mg/kg.
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 0.2 mg to 2 mg.
  • the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject m a dose ranging from 2 mg to 6 mg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 4 mg to 10 mg. In another embodiment, the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 5 mg and 15 mg.
  • a recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 10 pg/kg ⁇ 1000 pg/kg. In another embodiment, a recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 25 pg/kg- 600 pg/kg. In another embodiment, a recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose ranging from 50 pg/kg- 400 pg/kg. In another embodiment, a recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 25 pg/kg.
  • a recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 50 pg/kg. In another embodiment, a recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 100 pg/kg. In another embodiment, a recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 200 pg/kg. In another embodiment, a recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 300 pg/kg.
  • a recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 400 pg/kg. In another embodiment, a recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 500 pg/kg. In another embodiment, a recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject in a dose of about 600 pg/kg.
  • a single one time dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject.
  • a total of two doses are administered to the subject.
  • a total of two or more doses are administered to the subject.
  • a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject at least once a day.
  • a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject at least once every two days.
  • a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject at least once a every two or more days. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject every week, biweekly or every three weeks. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject at least once a week. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject at least once every two weeks.
  • a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject at least once every three weeks. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject at least once every three or more weeks. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject two or more times a week. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject two or more times a month. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject two or more times a year.
  • a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject two or more times every- two years. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject two or more times every two or more years.
  • a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 36 hours. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 48 hours. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 60 hours. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 72 hours. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 84 hours.
  • a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 96 hours. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once ever ⁇ 5 days. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 6 days. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 7 days. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 8-10 days.
  • a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 10-12 days. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 12-15 days. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 15-25 days. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 20-30 days.
  • a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered to a subject at least once every 1 month. In one embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 7 2 months. In one embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 3 months. In one embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 4 months. In one embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 5 months.
  • a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 7 6 months. In one embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered at least once every 6-12 months. In another embodiment, a dose of the recombinant fusion protein or pharmaceutical composition comprising the same is administered quarterly. In another embodiment, the dose is administered daily, weekly, biweekly, monthly or annually. In another embodiment, the dose is administered once, twice, or two or more times a day, a week, a month or a year. In another embodiment, the dose is administered every two, three, four, or at least five years.
  • repeat administrations (doses) of compositions of this invention may be undertaken immediately following the first course of treatment or after an interval of days, weeks, or years to achieve the desired effect as further provided herein (e.g. to prevent or treat cardiovascular disease or condition, or a CNS-related disease or condition).
  • the pharmaceutical compositions are administered by intravenous, intra-arterial, subcutaneous or intramuscular injection of a liquid preparation.
  • liquid formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
  • the pharmaceutical compositions are administered intravenously, and are thus formulated in a form suitable for intravenous administration.
  • the pharmaceutical compositions are administered intra-arterially, and are thus formulated in a form suitable for intra-arterial administration.
  • compositions for use in the methods disclosed herein comprise solutions or emulsions, which in some embodiments are aqueous solutions or emulsions comprising a safe and effective amount of the compounds disclosed herein and optionally, other compounds, intended for intravenous or subcutaneous administration.
  • kits for conducting/using the methods and/or the compositions of the invention optionally include, e.g., appropriate recombinant fusion protein (and optionally mixtures of a number of such proteins for performing synergistic treatments, see, above), and optionally appropriate disease related antigen(s) as well).
  • kits can also comprise appropriate excipients (e.g., pharmaceutically acceptable excipients) for performing therapeutic and/or prophylactic treatments of the invention.
  • Such kits optionally contain additional components for the assembly and/or use of the compositions of the invention including, but not limited to, e.g., diluents, etc.
  • kits can optionally include such components as, e.g., buffers, reagents, serum proteins, antibodies, substrates, etc.
  • prepackaged reagents the kits optionally include pre-measured or pre-dosed amounts that are ready to incorporate into the methods without measurement, e.g., pre-measured fluid aliquots, or pre-weighed or pre-measured solid reagents that can be easily reconstituted by the end-user of the kit.
  • kits also typically include appropriate instructions for performing the methods of the invention and/or using the compositions of the invention.
  • the components of the kits/packages are provided in a stabilized form, so as to prevent degradation or other loss during prolonged storage, e.g., from leakage.
  • a number of stabilizing processes/agents are widely used for reagents, etc. that are to be stored, such as the inclusion of chemical stabilizers (i.e., enzymatic inhibitors, microbicides/bacteriostats, anticoagulants), etc.
  • Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular subject, composition, and mode of administration, without being toxic to the subject.
  • the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the subject being treated, and like factors well known m the medical arts.
  • the composition must be sterile and fluid to the extent that the composition is deliverable by syringe.
  • the carrier preferably is an isotonic buffered saline solution. Proper fluidity can be maintained, for example, by use of coating such as lecithin, by maintenance of required particle size in the case of dispersion and by use of surfactants.
  • isotonic agents for example, sugars, polyalcohols such as mannitol or sorbitol, and sodium chloride in the composition.
  • Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular subject, composition, and mode of administration, without being toxic to the subject.
  • the selected dosage level wall depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the subject being treated, and like factors well known in the medical arts.
  • a reference to“A and/or B”, when used in conjunction with open-ended language such as“comprising” can refer, m one embodiment, to A only (optionally including elements 5 other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
  • the phrase“at least one,” in reference to a list of one or more elements should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements.
  • This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase“at least one” refers, whether related or unrelated to those elements specifically identified.
  • “at least one of A and B” can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
  • the present invention further provides a kit for preventing, treating or delaying a cardiovascular disease or condition in a human, wherein the kit comprises one or more doses of pharmaceutical composition comprising a recombinant fusion protein discl osed herein used for preventing, treating or delaying a cardiovascular disease or condition, and instructions on how to use the pharmaceutical preparation or composition.
  • the present invention further provides a kit for preventing, treating or delaying a CNS-related disease or condition in a human, wherein the kit comprises one or more doses of pharmaceutical composition comprising a recombinant fusion protein disclosed herein used for preventing, treating or delaying a cardiovascular disease or condition, and instructions on how to use the pharmaceutical preparation or composition.
  • the present invention further provides a kit for preventing, treating or delaying heart failure with preserved ejection fraction in a human, wherein the kit comprises one or more doses of pharmaceutical composition comprising a recombinant fusion protein disclosed herein used for preventing, treating or delaying heart failure with preserved ejection fraction, and instructions on how to use the pharmaceutical preparation or composition.
  • NPCFA and NPCF for the sequences with or without Fc mutations, respectively) and light chain (named PAL) were synthesized by GENEWIZ (Suzhou, China).
  • Expression vector pCHOGTJN was obtained from Horizon Discover ⁇ ' (Cambridge, UK) under a licensing agreement. Construction of the expression plasmids is carried out as outlined in Figure 1. Briefly, pCHOGUN vector was linearized by restriction enzyme BfuAI and gene insert fragments such as NPCF, NPCFA, and PAL were purified following double restriction enzyme digestion by Ncol and Ascl. Tire linearized pCHOGUN/BfuAI and the purified gene insert fragment were ligated per standard protocol and then transformed into E.coli DH5a competent cells.
  • DH5a cells were plated and incubated overnight at 37°C. Plasmids pCHOGUN-NPCF, pCHOGU -NPCFA and pCHOGUN-PAL were isolated and confirmed by restriction enzyme digestion or PCR. The plasmid containing the heavy chain insert. (pCHOGUN-NPCF or pCHOGUN-NPCFA) was digested with restriction enzymes BspEI and Pcil, whereas the plasmid containing the light chain insert (pCHQGUN-PAL) was digested with restriction enzymes NgoMIV and Pcil. Following the restriction enzyme digestion, the fragments with the heavy or light chain insert were purified, ligated and then transformed into DH5a cells.
  • HD-BIOP3 a glutamine synthetase-null (GS A ) cell line derived from CHO Kl cells, was obtained from Horizon Discovery (Cambridge, UK) under a licensing agreement. Plasmid DNA is isolated using commercially available Qiagen Plasmid Kits. Transfection of the plasmid DNA into HD-BIOP3 cells was performed using a commercially available electroporation system from Lonza. The transfected cells vcere plated in 96-well plates and underwent pool selection using standard procedures. Ceils from the selected pools were cultured in 125-rnL shake flasks for 10-14 days and the media were harvested for antibody purification. Antibody proteins were purified by protein-A affinity chromatography followed by size-exclusion chromatography and then analyzed with SDS-PAGE and Western blot according to standard protocols.
  • Figure 2A illustrates the schematic structure of the recombinant fusion protein disclosed herein.
  • Figure 2B shows representative data generated by SDS-PAGE analysis.
  • Western blot results detected by primary antibody specific for the 61 -ammo acid active fragment of NRG-1 comprising the HER3/4 binding domain (“NRG-1”, R&D Systems, Minneapolis, MN) or IgG are shown in Figures 2C and 2D, respectively.
  • Molecular structure integrity of the recombinant fusion protein disclosed herein is assessed by evaluating its concurrent binding ability to HER3 protein and Anti -NRG-1 antibody. His-tagged HERS recombinant protein (Sino Biological, Beijing, China) was captured on the sensor chip immobilized with anti-His antibody (Thermo Fisher, Waltham, MA) (Step 1), followed by the injection of samples (including the recombinant fusion protein disclosed herein, the recombinant fusion protein disclosed herein without Fc mutations, anti- HER3 mAb (Step 2), and anti-NRG-l antibody (R&D Systems, Minneapolis, MN) (Step 3).
  • the anti-HER3 mAb bound only to His-HER3 on step 2, but not Anti -NRG-1 antibody and buffer (Step 3) (Ch 4, 5), verifying the absence of NRG-l -binding activity for the anti-HER3 mAb molecule. Buffer was injected at Step 2 and 3 as blank control. Therefore, both the HER3-binding epitope and NRG-l are present in the recombinant fusion protein of the invention.
  • EXAMPLE 4 Effect on Tumor Cell Line Proliferation in vitro
  • Tumor cells were seeded m 96-well plates at 2,500-20,000 cells per well, depending on the growth kinetics of each cell line.
  • Cell viability was assessed using Cell Counting Kit-8 from Dojindo Molecular Technologies (Kumamoto, Japan) according to the manufacturer’s instructions. Data were analyzed with GraphPad Prism software and are presented as the rate of growth relative to the untreated control.
  • the recombinant fusion protein disclosed herein demonstrates markedly lower activity ' i n promoting cancer cell proliferation.
  • Figure 5 shows AKT phosphorylation in response to stimuli in human cardiomyocytes. Results suggest that the recombinant fusion protein disclosed herein can activate the HER2:HER4 signaling pathway in cardiomyocytes with a potency comparable to NRG-1.
  • PathHunter Dimerization Assay developed by Eurofins DiseoverX (Fremont, CA) detects ligand induced dimerization of two subunits of a receptor-dimer pair.
  • the assay principle is illustrated in Figure 6A.
  • b-gal enzyme is split into two fragments, ProLmk (PK) and enzyme receptor (EA).
  • the cells have been engineered to co-express target protein 1 fused to enzyme donor PK, and target protein 2 fused to enzyme acceptor EA. Binding of ligand to one target protein induces it to interact with the other target protein, forcing complementation of the two enzyme fragments and resulting m the enzyme reaction to release chemiluminescent signal which is detected as Relative Fluorescence Unit or RFU.
  • the recombinant fusion protein disclosed herein can induce HER2/FIER4 dimerization with potency comparable to NRG-1; whereas its ability to induce HER2/HER3 dimerization is much weaker.
  • As negative controls for the study neither the isotype control antibody GP120 mAb nor the anti-HER3 mAb induced receptor dimerization.
  • EXAMPLE 7 In Vivo Efficacy of the Recombinant Fusion Protein in a Rat Model of
  • a Sprague Dawley rat model of myocardial infarction and systolic heart failure was employed.
  • a 6-0 silk suture was used to ligate the left anterior descending coronary artery (LAD) 3-4 mm below the left atrial appendage in a surgical procedure.
  • LAD left anterior descending coronary artery
  • ECG M-mode echocardiography
  • mice were divided into five groups of eleven rats each, with an additional ten sham-surgery rats included in a sixth group.
  • the study was designed for each group to receive twice-weekly tail vein injections for a period of four weeks, or eight total injections.
  • Both the sham surger' group and the negative control of vehicle group received saline, three groups received the recombinant fusion protein at 1, 3, or 10 mg/kg, and the final group received a positive control of GP120 mAb/NRG-l fusion protein (10 mg/kg).
  • mice were euthanized and the cardiac tissues next to the surgical site were collected, fixed in 4% formaldehyde, and embedded in paraffin.
  • Five p thick paraffin sections of the heart tissues were stained with hematoxylin and eosin dyes, and lustopathological changes were observed under a light microscope.
  • the cardiomyocytes were arranged in an orderly fashion and the cytoplasm and the myocardial fibers were evenly stained. No inflammatory cell infiltration was observed in the interstitial spaces and no myocardial necrosis was found.
  • the myocardial infarction marginal zone exhibited widened gaps between myocardial cells; the nuclei were condensed and shattered and the myocardial fiber arrangement lost its ordered structure; the cell size was enlarged and the interstitial edema was noticed.
  • Treatment with the recombinant fusion protein partially alleviated the pathological changes in the myocardial infarction zone, including significant reduction of necrotic cells, narrowed interstitial spaces between myocardial cells, and recovery of myocardial fiber arrangement towards normal structure.
  • EXAMPLE 8 The Recombinant Fusion Protein Attenuated Tumor Growth in Subcutaneous FaDu Carcinoma Xenograft Model in NOD/SCID Mice
  • mice Female NOD/SCID mice, age 7-10 weeks, w3 ⁇ 4re inoculated subcutaneously in the right fl ank with FaDu tumor cells (3 x 10 6 ) suspended in 0.1 ml of PBS. When tumors reached approximately 150 mm 3 , mice were randomized and sorted into 6 study groups with 8 animals per group. Test samples were administrated intravenously by tail vein injection twice a w3 ⁇ 4ek for three consecutive w'eeks, for a total of 6 treatments. Tumor growth was monitored by caliper measurements. The study was terminated at 21 days post-treatment.
  • the safety and tolerability of the recombinant fusion protein was evaluated following four consecutive weekly administrations at dose levels of 3, 10, and 30 mg/kg m comparison to vehicle control, with three males and three females included in each cohort for the main 28-day study period, and an additional two males and two females in the 30 mg/kg and vehicle control cohorts evaluated following a subsequent 28-day recovery period.
  • While there was test agent-related vomiting observed in this repeat-dose study clinical observations of vomiting were only associated with infusion reactions, only observed in one animal in the 10 mg/kg cohort (17%) and two animals in the 30 mg/kg cohort (20%), and were transient in nature.
  • Diarrhea was observed only in the vehicle control cohort and 30 mg/kg recombinant fusion protein cohort, in only one (10%) and three (30%) animals respectively, and was considered normal for this type of procedure and unrelated to the recombinant fusion protein. Finally, in this repeat-dose study, average body weight was reduced by >10% relative to baseline only at the 10 mg/kg and 30 nig/kg dose levels, and only following the fourth dose m the 10 mg/kg cohort and the third and fourth doses in die 30 mg/kg cohort. In summary, treatment with the recombinant fusion protein did not result in any clinically significant findings related to food intake, vomiting, or diarrhea other than during acute infusion reactions, and gastrointestinal findings had no impact on the determination of the no-adverse event level in either study. These results indicate that the design of the recombinant fusion protein mitigates the ad verse effect of NRG- 1 recombinant protein on the gastrointestinal tract.
  • Blood samples ( ⁇ l ml) were collected from cynomolgus monkeys following single dose administration of 60 mg/kg of the recombinant fusion protein at different time points, and sera were extracted and stored at -80°C until tested.
  • concentrations of the recombinant fusion protein in the serum samples were assayed by capture ELISA according to standard procedures. Briefly, 96-well plates were coated with the recombinant human HER3 protein (R&D System), blocked with BSA, and incubated with test samples. After multiple washes, plates were incubated with HRP -conjugated anti-human IgG Fe antibody and then detected with TMB substrate.
  • Figure 12 shows that the pharmacokinetic profile of the recombinant fusion protein is similar to IgG antibody.
  • EXAMPLE 10 Summary of Kinetic Constants on Fc Receptor Binding
  • the binding affinity between the recombinant anti-HER3 niAb/NRG-1 fusion protein and Fc receptors were measured using label-free SPR technique.
  • a total of six Fc receptors (each fused with a His-tag), including FcyRI (Abeam), FcyRIIa, FcyRIIb, FcyRIIIa (158F), FcyRIIIa (158V), and Clq (Sino Biological), were analyzed against the recombinant fusion protein, the recombinant fusion protein without Fc mutations and anti-HER3 antibody, respectively.
  • the recombinant fusion protein and all other samples were serially diluted to a total of 6 concentrations, ranging from 0.3 nM to 30 nM, and the serial dilutions wore injected in sequence through both flow' cells in each channel. Multiple analy ses were completed in the same run by simultaneously injecting samples over multiple channels.
  • FcyRIIIa 158F
  • FcyRIIIa 158V
  • Fc mutations led to 2 to 3-fold reduction in binding affinity for the recombinant fusion protein. Binding to Clq w3 ⁇ 4s too weak to be detected for all samples.
  • ADCC antibody -dependent cellular cytotoxicity
  • FcyRIIIa (158F) 1 18E-07 6.37E-08 1.66E-07

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Microbiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Oncology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Epidemiology (AREA)
  • Cardiology (AREA)
  • Cell Biology (AREA)
  • Mycology (AREA)
  • Virology (AREA)
  • Endocrinology (AREA)
  • Reproductive Health (AREA)
PCT/US2019/026889 2018-04-11 2019-04-11 Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof Ceased WO2019200033A1 (en)

Priority Applications (27)

Application Number Priority Date Filing Date Title
PL19723548.4T PL3774859T3 (pl) 2018-04-11 2019-04-11 Kompozycje rekombinowanego białka fuzyjnego ludzkiej neureguliny-1 (nrg-1) i sposoby ich zastosowania
FIEP19723548.4T FI3774859T3 (fi) 2018-04-11 2019-04-11 Ihmisen neureguliini-1:n (nrg-1) rekombinanttifuusioproteiinikoostumukset ja niiden käyttömenetelmät
KR1020207032449A KR102949228B1 (ko) 2018-04-11 2019-04-11 인간 뉴레귤린-1(nrg-1) 재조합 융합 단백질 조성물 및 이의 사용 방법
MYPI2020005322A MY204230A (en) 2018-04-11 2019-04-11 Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
EA202092458A EA202092458A1 (ru) 2018-04-11 2019-04-11 Композиции на основе рекомбинантного слитого белка, содержащего нейрегулин-1 (nrg-1) человека, и способы их применения
MX2020010740A MX2020010740A (es) 2018-04-11 2019-04-11 Composiciones de proteina de fusion recombinante neuregulina-1 (nrg-1) humana y metodos para su uso.
SG11202009831UA SG11202009831UA (en) 2018-04-11 2019-04-11 Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
CN201980025049.3A CN113166218B (zh) 2018-04-11 2019-04-11 人神经调节蛋白-1(nrg-1)重组融合蛋白组合物和其使用方法
NZ768694A NZ768694B2 (en) 2019-04-11 Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
EP24161673.9A EP4361177A3 (en) 2018-04-11 2019-04-11 Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
DK19723548.4T DK3774859T3 (da) 2018-04-11 2019-04-11 Sammensætninger af rekombinante fusionsproteiner af human neuregulin-1 (nrg-1) og fremgangsmåder til anvendelse deraf
JP2020556258A JP7575272B2 (ja) 2018-04-11 2019-04-11 ヒトニューレグリン-1(nrg-1)組換え型融合タンパク質組成物及びその使用方法
CN202411003345.2A CN118909141A (zh) 2018-04-11 2019-04-11 人神经调节蛋白-1(nrg-1)重组融合蛋白组合物和其使用方法
AU2019252262A AU2019252262B2 (en) 2018-04-11 2019-04-11 Human neuregulin-1 (NRG-1) recombinant fusion protein compositions and methods of use thereof
CA3096420A CA3096420A1 (en) 2018-04-11 2019-04-11 Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
IL322374A IL322374A (en) 2018-04-11 2019-04-11 Human recombinant neuregulin-1 chimeric protein preparations and methods of using them
BR112020020646-6A BR112020020646A2 (pt) 2018-04-11 2019-04-11 composições de proteína de fusão recombinante de neuregulina-1 (nrg-1) humana e métodos de uso destas
PE2020001553A PE20210111A1 (es) 2018-04-11 2019-04-11 Composiciones de proteina de fusion recombinante neuregulina-1 (nrg-1) humana y metodos para su uso
IL277790A IL277790B2 (en) 2018-04-11 2019-04-11 Human recombinant neuregulin-1 chimeric protein preparations and methods of using them
ES19723548T ES2980163T3 (es) 2018-04-11 2019-04-11 Composiciones de proteína de fusión recombinante de neuregulina-1 (nrg-1) humana y métodos de uso de las mismas
EP19723548.4A EP3774859B1 (en) 2018-04-11 2019-04-11 Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
PH12020551648A PH12020551648A1 (en) 2018-04-11 2020-10-02 Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
MX2025002112A MX2025002112A (es) 2018-04-11 2020-10-09 Composiciones de proteina de fusion recombinante neuregulina-1 (nrg-1) humana y metodos para su uso
CONC2020/0012621A CO2020012621A2 (es) 2018-04-11 2020-10-21 Composiciones de proteína de fusión recombinante neuregulina-1 (nrg-1) humana y métodos para su uso
JP2023097663A JP7631420B2 (ja) 2018-04-11 2023-06-14 ヒトニューレグリン-1(nrg-1)組換え型融合タンパク質組成物及びその使用方法
AU2023285793A AU2023285793B2 (en) 2018-04-11 2023-12-20 Human neuregulin-1 (NRG-1) recombinant fusion protein compositions and methods of use thereof
JP2025017265A JP2025072502A (ja) 2018-04-11 2025-02-05 ヒトニューレグリン-1(nrg-1)組換え型融合タンパク質組成物及びその使用方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862656246P 2018-04-11 2018-04-11
US62/656,246 2018-04-11

Publications (1)

Publication Number Publication Date
WO2019200033A1 true WO2019200033A1 (en) 2019-10-17

Family

ID=66484143

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/026889 Ceased WO2019200033A1 (en) 2018-04-11 2019-04-11 Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof

Country Status (25)

Country Link
US (3) US11046741B2 (enExample)
EP (2) EP4361177A3 (enExample)
JP (3) JP7575272B2 (enExample)
KR (1) KR102949228B1 (enExample)
CN (2) CN118909141A (enExample)
AU (2) AU2019252262B2 (enExample)
BR (1) BR112020020646A2 (enExample)
CA (1) CA3096420A1 (enExample)
CL (1) CL2020002621A1 (enExample)
CO (1) CO2020012621A2 (enExample)
DK (1) DK3774859T3 (enExample)
EA (1) EA202092458A1 (enExample)
ES (1) ES2980163T3 (enExample)
FI (1) FI3774859T3 (enExample)
HU (1) HUE066892T2 (enExample)
IL (2) IL322374A (enExample)
MX (2) MX2020010740A (enExample)
MY (1) MY204230A (enExample)
PE (1) PE20210111A1 (enExample)
PH (1) PH12020551648A1 (enExample)
PL (1) PL3774859T3 (enExample)
PT (1) PT3774859T (enExample)
SG (1) SG11202009831UA (enExample)
TW (2) TWI834654B (enExample)
WO (1) WO2019200033A1 (enExample)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021052277A1 (zh) * 2019-09-16 2021-03-25 上海泽生科技开发股份有限公司 重组人神经调节蛋白衍生物及其用途
US11242370B2 (en) 2019-04-01 2022-02-08 Eli Lilly And Company Neuregulin-4 compounds and methods of use
WO2023178086A1 (en) * 2022-03-15 2023-09-21 Salubris Biotherapeutics, Inc. Methods of treating fibrosis and arrhythmia with a neuregulin-1 fusion protein
WO2025245112A1 (en) 2024-05-21 2025-11-27 Salubris Biotherapeutics, Inc. Neuregulin-1/anti-her3 antibody fusion protein for use in the treatment of heart failure

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FI3774859T3 (fi) 2018-04-11 2024-05-24 Salubris Biotherapeutics Inc Ihmisen neureguliini-1:n (nrg-1) rekombinanttifuusioproteiinikoostumukset ja niiden käyttömenetelmät
CN114420310B (zh) * 2022-01-18 2024-11-12 河南大学 基于图转换网络的药物ATC Code预测方法
CN116832040B (zh) * 2023-06-12 2026-01-13 北京市心肺血管疾病研究所 细胞周期蛋白依赖性激酶抑制剂在治疗射血分数保留型心力衰竭中的应用
WO2025122581A1 (en) * 2023-12-08 2025-06-12 The Trustees Of Indiana University Compositions comprising neuregulin and methods of using the same to treat or prevent neurotrophic keratitis

Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5202238A (en) 1987-10-27 1993-04-13 Oncogen Production of chimeric antibodies by homologous recombination
US5204244A (en) 1987-10-27 1993-04-20 Oncogen Production of chimeric antibodies by homologous recombination
EP0586607A1 (en) * 1991-05-24 1994-03-16 Genentech, Inc. HEREGULINS (HRGs), BINDING PROTEINS OF P185?erb2
US5464764A (en) 1989-08-22 1995-11-07 University Of Utah Research Foundation Positive-negative selection methods and vectors
US5530109A (en) 1991-04-10 1996-06-25 Ludwig Institute For Cancer Research DNA encoding glial mitogenic factors
WO1997009425A1 (en) 1995-09-08 1997-03-13 President And Fellows Of Harvard College Cerebellum-derived growth factors, and uses related thereto
US5716930A (en) 1991-04-10 1998-02-10 Ludwig Institute For Cancer Research Glial growth factors
US5834229A (en) 1991-05-24 1998-11-10 Genentech, Inc. Nucleic acids vectors and host cells encoding and expressing heregulin 2-α
US5932447A (en) 1994-05-17 1999-08-03 Bristol-Myers Squibb Company Cloning and expression of a gene encoding bryodin 1 from Bryonia dioica
WO2000064400A2 (en) 1999-04-23 2000-11-02 Cambridge Neuroscience, Inc. Methods for treating congestive heart failure
WO2006017184A2 (en) * 2004-07-09 2006-02-16 Wayne State University HYBRID PROTEINS WITH ErbB4 EXTRACELLULAR DOMAIN AND NEUREGULIN HEPARIN-BINDING DOMAIN FOR TARGETING
US20070081992A1 (en) * 2005-10-07 2007-04-12 Pardridge William M Fusion proteins for blood-brain barrier delivery
WO2007062594A1 (en) * 2005-12-02 2007-06-07 Zensun (Shanghai) Science & Technology Limited Neuregulin variants and methods of screening and using thereof
EP2555788A1 (en) * 2010-03-24 2013-02-13 Massachusetts Institute of Technology Methods and compositions for cardioprotection and cardioregeneration
WO2015155998A1 (en) * 2014-04-10 2015-10-15 Daiichi Sankyo Company, Limited Anti-her3 antibody-drug conjugate

Family Cites Families (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AUPP785098A0 (en) * 1998-12-21 1999-01-21 Victor Chang Cardiac Research Institute, The Treatment of heart disease
AU2002304965A1 (en) * 2002-05-24 2003-12-12 Zensun (Shanghai) Sci-Tech.Ltd Neuregulin based methods and compositions for treating viral myocarditis and dilated cardiomyopathy
AU2008312580A1 (en) 2007-10-16 2009-04-23 Symphogen A/S Compositions comprising optimized Her1 and Her3 multimers and methods of use thereof
WO2009114110A1 (en) * 2008-03-08 2009-09-17 Immungene, Inc. Engineered fusion molecules immunotherapy in cancer and inflammatory diseases
TW201014602A (en) * 2008-07-08 2010-04-16 Abbott Lab Prostaglandin E2 binding proteins and uses thereof
EP2370458B1 (en) 2008-11-28 2014-10-15 Zensun (Shanghai) Science and Technology Limited Neuregulin peptides and their use
AU2010303443A1 (en) * 2009-10-09 2012-04-19 Merck Sharp & Dohme Corp. Generation, characterization and uses thereof of anti-Her 3 antibodies
CN102139095A (zh) 2010-01-29 2011-08-03 上海泽生科技开发有限公司 神经调节蛋白用于预防、治疗或延迟心脏缺血再灌注损伤的方法和组合物
WO2013053076A1 (en) 2011-10-10 2013-04-18 Zensun (Shanghai)Science & Technology Limited Compositions and methods for treating heart failure
CN105849125B (zh) * 2013-11-07 2020-05-15 国家医疗保健研究所 神经调节蛋白变构抗her3抗体
CN110946993A (zh) 2014-01-03 2020-04-03 上海泽生科技开发股份有限公司 纽兰格林制剂的配方
WO2016038609A1 (en) * 2014-09-08 2016-03-17 Yeda Research And Development Co. Ltd. Anti-her3 antibodies and uses of same
CN111407882A (zh) 2014-10-17 2020-07-14 上海泽生科技开发股份有限公司 神经调节蛋白用于预防、治疗或延迟射血分数保留的心力衰竭的方法和组合物
US11421028B2 (en) 2016-02-06 2022-08-23 Epimab Biotherapeutics, Inc. Fabs-in-tandem immunoglobulin and uses thereof
BR112019005001A2 (pt) 2016-09-15 2019-06-04 Universität Stuttgart proteína de ligação ao antígeno, proteína de fusão, ácido nucleico, vetor recombinante, célula hospedeira recombinante, composição farmacêutica, uso médico da proteína de ligação ao antígeno e método de inibição do crescimento tumoral
FI3774859T3 (fi) 2018-04-11 2024-05-24 Salubris Biotherapeutics Inc Ihmisen neureguliini-1:n (nrg-1) rekombinanttifuusioproteiinikoostumukset ja niiden käyttömenetelmät

Patent Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5204244A (en) 1987-10-27 1993-04-20 Oncogen Production of chimeric antibodies by homologous recombination
US5202238A (en) 1987-10-27 1993-04-13 Oncogen Production of chimeric antibodies by homologous recombination
US5464764A (en) 1989-08-22 1995-11-07 University Of Utah Research Foundation Positive-negative selection methods and vectors
US5487992A (en) 1989-08-22 1996-01-30 University Of Utah Research Foundation Cells and non-human organisms containing predetermined genomic modifications and positive-negative selection methods and vectors for making same
US5716930A (en) 1991-04-10 1998-02-10 Ludwig Institute For Cancer Research Glial growth factors
US5530109A (en) 1991-04-10 1996-06-25 Ludwig Institute For Cancer Research DNA encoding glial mitogenic factors
US5834229A (en) 1991-05-24 1998-11-10 Genentech, Inc. Nucleic acids vectors and host cells encoding and expressing heregulin 2-α
EP0586607A1 (en) * 1991-05-24 1994-03-16 Genentech, Inc. HEREGULINS (HRGs), BINDING PROTEINS OF P185?erb2
US5932447A (en) 1994-05-17 1999-08-03 Bristol-Myers Squibb Company Cloning and expression of a gene encoding bryodin 1 from Bryonia dioica
WO1997009425A1 (en) 1995-09-08 1997-03-13 President And Fellows Of Harvard College Cerebellum-derived growth factors, and uses related thereto
WO2000064400A2 (en) 1999-04-23 2000-11-02 Cambridge Neuroscience, Inc. Methods for treating congestive heart failure
WO2006017184A2 (en) * 2004-07-09 2006-02-16 Wayne State University HYBRID PROTEINS WITH ErbB4 EXTRACELLULAR DOMAIN AND NEUREGULIN HEPARIN-BINDING DOMAIN FOR TARGETING
US20070081992A1 (en) * 2005-10-07 2007-04-12 Pardridge William M Fusion proteins for blood-brain barrier delivery
WO2007062594A1 (en) * 2005-12-02 2007-06-07 Zensun (Shanghai) Science & Technology Limited Neuregulin variants and methods of screening and using thereof
EP2555788A1 (en) * 2010-03-24 2013-02-13 Massachusetts Institute of Technology Methods and compositions for cardioprotection and cardioregeneration
WO2015155998A1 (en) * 2014-04-10 2015-10-15 Daiichi Sankyo Company, Limited Anti-her3 antibody-drug conjugate

Non-Patent Citations (66)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", 1992, JOHN WILEY & SONS
"Current Protocols in Molecular Biology", 1999, GREENE PUBLISHING ASSOCIATES, INC. AND JOHN WILEY & SONS, INC., article "Current Protocols, a joint venture between"
"Fundamental Immunology", 1999, RAVEN PRESS
"GenBank", Database accession no. AAH02706.1
"Vectors: A Survey of Molecular Cloning Vectors and Their Uses", 1988, BUTTERWORTHS
ALIMANDI M ET AL., ONCOGENE, vol. 10, 1995, pages 1813 - 1821
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL, NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402
ANDREW JABBOUR ET AL: "Parenteral administration of recombinant human neuregulin-1 to patients with stable chronic heart failure produces favourable acute and chronic haemodynamic responses", EUROPEAN JOURNAL OF HEART FAILURE, vol. 13, no. 1, 1 January 2011 (2011-01-01), NL, pages 83 - 92, XP055599027, ISSN: 1388-9842, DOI: 10.1093/eurjhf/hfq152 *
AUSUBEL, F. ET AL.: "Current Protocols in Molecular Biology", 1987, GREENE PUBLISHING AND WILEY INTERSCIENCE
AUSUBEL: "Current Protocols in Molecular Biology", 1989, JOHN WILEY AND SONS
BAMES, L.M. ET AL., CYTOTECHNOLOGY, vol. 32, 2000, pages 109 - 123
BARNES, L.M. ET AL., BIOTECH. BIOENG., vol. 73, 2001, pages 261 - 270
BOERNER, P. ET AL., J. IMMUNOL., vol. 147, 1991, pages 86 - 95
BOOTH ET AL., IMMUNOL. LETT., vol. 19, 1988, pages 65 - 70
BRUEGGEMANN, M.D., YEAR IMMUNOL., vol. 7, 1993, pages 33 - 40
CARRAWAY ET AL., NATURE, vol. 387, 1997, pages 512 - 516
CARTER, P. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285 - 4289
CHANG ET AL., NATURE, vol. 387, 1997, pages 509 - 512
CHANG ET AL.: "Somatic Gene Therapy", 1995, CRC PRESS
COLE, A. ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, pages: 77
DUROCHER, Y. ET AL., NUCL. ACIDS. RES., vol. 30, 2002, pages E9
GAO ET AL., J AM COLL CARDIOL, vol. 55, 2010, pages 1907 - 14
GARDELLA ET AL., J. BIOL. CHEM., vol. 265, 1990, pages 15854 - 15859
GEISSE, S. ET AL., PROTEIN EXPR. PURIF., vol. 8, 1996, pages 271 - 282
GILBOA, BIOTECHNIQUES, vol. 4, no. 6, 1986, pages 504 - 512
HELLYER, N.J., J. BIOL. CHEM., vol. 276, 2001, pages 42153 - 4261
HIGASHIYAMA ET AL., J. BIOCHEM., vol. 122, 1997, pages 675 - 680
HIGGINS, METHODS ENZYMOL., vol. 266, 1996, pages 383 - 402
HIJAZI ET AL., INT. J. ONCOL., vol. 13, 1998, pages 1061 - 1067
HOLMES ET AL., SCIENCE, vol. 256, 1992, pages 1205 - 1210
HOOGENBOOM, H.R.; WINTER, G., J. MOL. BIOL., vol. 227, 1992, pages 381 - 388
HUSTON, J.S., METHODS IN ENZYMOL., vol. 203, 1991, pages 46 - 88
JABBOUR ET AL., EUROPEAN JOURNAL OF HEART FAILURE, vol. 13, 2011, pages 83 - 92
JAKOBOVITS, A. ET AL., NATURE, vol. 362, 1993, pages 255 - 258
JAKOBOVITS, A. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551 - 2555
KARLIN; ALTSCHUL, PROC. NAT!. ACAD. SCI. USA, vol. 87, 1990, pages 2264 - 2268
KARLIN; ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5877
KAUFMAN, R.J., MOL. BIOTECHNOL., vol. 16, 2000, pages 151 - 161
KRAUS, M.H. ET AL., PNAS, vol. 86, 1989, pages 9193 - 9197
KRAUS, M.H. ET AL., PNAS, vol. 90, 1993, pages 2900 - 2904
LEFRANC, M.-P., CURRENT PROTOCOLS IN IMMUNOLOGY, 2000
LENIHAN ET AL., J AM COLL CARDIOL BASIC TRANS SCIENCE, vol. 2, no. 16, pages 576 - 86
MAKRIDES, S.C., PROTEIN EXPR. PURIF., vol. 17, 1999, pages 183 - 202
MARKS, J.D. ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
MORRISON, S.L. ET AL., PROC. NATL. ACAD SCI. USA, vol. 81, 1984, pages 6851 - 6855
NEUBERGER, M.S. ET AL., NATURE, vol. 314, 1985, pages 268 - 270
NICO JACOBI ET AL: "ErbB Family Signalling: A Paradigm for Oncogene Addiction and Personalized Oncology", CANCERS, vol. 9, no. 12, 12 April 2017 (2017-04-12), pages 33, XP055599065, DOI: 10.3390/cancers9040033 *
NORDERHAUG, L. ET AL., J. IMMUNOL. METHODS, vol. 204, 1997, pages 77 - 87
ORLANDI, R. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 3833 - 3837
PEARSON; LIPMAN, PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 2444 - 8
PENICHET ET AL.: "Antibody-cytokine fusion proteins for the therapy of cancer", J IMMUNOL METHODS, vol. 248, 2001, pages 91 - 101, XP002664486, DOI: doi:10.1016/S0022-1759(00)00345-8
PLOWMAN, G.D. ET AL., PNAS, vol. 87, 1990, pages 4905 - 4909
RIECHMANN, L., NATURE, vol. 332, 1988, pages 323 - 327
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRINGS HARBOR LABORATORY
SAMBROOK ET AL.: "Molecular Cloning—A Laboratory Manual", vol. 1-3, 1989, COLD SPRING HARBOR LABORATORY
SCHLAEGER, E.-J., J. IMMUNOL. METHODS, vol. 194, 1996, pages 191 - 199
SCHLAEGER, E.-J.; CHRISTENSEN, K., CYTOTECHNOLOGY, vol. 30, 1999, pages 71 - 83
SINGER, E., J. BIOL.
SLIWKOWSKI M.X. ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 14661 - 14665
STUDIER ET AL., METHODS IN ENZYMOL., vol. 185, 1990, pages 60 - 89
TORELLIS; ROBOTTI, COMPUT. APPL. BIOSCI., vol. 10, 1994, pages 3 - 5
VAN DIJK, M.A.; VAN DE WINKEL, J.G., CURR. OPIN. CHEM. BIOL., vol. 5, 2001, pages 368 - 374
VEGA: "Gene Targeting", 1995, CRC PRESS
WATSON ET AL.: "Molecular Biology of the Gene", 1987, THE BEJACMIN/CUMMINGS PUB.CO., pages: 224
WERNER, R.G., DRUG RES., vol. 48, 1998, pages 870 - 880

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11242370B2 (en) 2019-04-01 2022-02-08 Eli Lilly And Company Neuregulin-4 compounds and methods of use
US12145972B2 (en) 2019-04-01 2024-11-19 Eli Lilly And Company Neuregulin-4 compounds and methods of use
WO2021052277A1 (zh) * 2019-09-16 2021-03-25 上海泽生科技开发股份有限公司 重组人神经调节蛋白衍生物及其用途
WO2023178086A1 (en) * 2022-03-15 2023-09-21 Salubris Biotherapeutics, Inc. Methods of treating fibrosis and arrhythmia with a neuregulin-1 fusion protein
WO2025245112A1 (en) 2024-05-21 2025-11-27 Salubris Biotherapeutics, Inc. Neuregulin-1/anti-her3 antibody fusion protein for use in the treatment of heart failure

Also Published As

Publication number Publication date
SG11202009831UA (en) 2020-11-27
CA3096420A1 (en) 2019-10-17
HUE066892T2 (hu) 2024-09-28
US11046741B2 (en) 2021-06-29
JP2023134436A (ja) 2023-09-27
IL322374A (en) 2025-09-01
AU2023285793A1 (en) 2024-01-18
EP3774859A1 (en) 2021-02-17
TW201945389A (zh) 2019-12-01
EP4361177A3 (en) 2024-08-14
US11718652B2 (en) 2023-08-08
MY204230A (en) 2024-08-16
MX2025002112A (es) 2025-05-02
IL277790A (en) 2020-11-30
KR102949228B1 (ko) 2026-04-06
JP7575272B2 (ja) 2024-10-29
JP2021535727A (ja) 2021-12-23
ES2980163T3 (es) 2024-09-30
JP7631420B2 (ja) 2025-02-18
EP3774859B1 (en) 2024-03-13
EP4361177A2 (en) 2024-05-01
AU2019252262B2 (en) 2023-10-05
AU2019252262A1 (en) 2020-10-22
TW202426470A (zh) 2024-07-01
TWI834654B (zh) 2024-03-11
TWI888027B (zh) 2025-06-21
US20210347841A1 (en) 2021-11-11
PT3774859T (pt) 2024-05-27
PE20210111A1 (es) 2021-01-19
JP2025072502A (ja) 2025-05-09
FI3774859T3 (fi) 2024-05-24
AU2023285793B2 (en) 2026-01-22
DK3774859T3 (da) 2024-05-27
NZ768694A (en) 2024-10-25
US20200010522A1 (en) 2020-01-09
PH12020551648A1 (en) 2021-07-26
US20230322877A1 (en) 2023-10-12
PL3774859T3 (pl) 2024-10-14
CN118909141A (zh) 2024-11-08
CN113166218A (zh) 2021-07-23
IL277790B1 (en) 2025-09-01
EA202092458A1 (ru) 2021-02-08
CL2020002621A1 (es) 2021-06-11
BR112020020646A2 (pt) 2021-02-23
MX2020010740A (es) 2021-01-20
CN113166218B (zh) 2024-08-13
CO2020012621A2 (es) 2020-12-21
IL277790B2 (en) 2026-01-01
KR20210022542A (ko) 2021-03-03

Similar Documents

Publication Publication Date Title
US11718652B2 (en) Human neuregulin-1 (NRG-1) recombinant fusion protein compositions and methods of use thereof
US20230045048A1 (en) Il-15 compositions and methods of use thereof
US20250228917A1 (en) Methods of treating fibrosis and arrhythmia with a neuregulin-1 fusion protein
HK40106026A (en) Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
HK40044003B (en) Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
HK40044003A (en) Human neuregulin-1 (nrg-1) recombinant fusion protein compositions and methods of use thereof
EA052095B1 (ru) Композиции на основе рекомбинантного слитого белка, содержащего нейрегулин-1 (nrg-1) человека, и способы их применения
EA046026B1 (ru) Композиции на основе рекомбинантного слитого белка, содержащего нейрегулин-1 (nrg-1) человека, и способы их применения
KR20260061438A (ko) 인간 뉴레귤린-1(nrg-1) 재조합 융합 단백질 조성물 및 이의 사용 방법
HK40115251A (zh) 用神经调节蛋白-1融合蛋白治疗纤维化及心律失常的方法
CN118922437A (zh) 用神经调节蛋白-1融合蛋白治疗纤维化及心律失常的方法
WO2025245112A1 (en) Neuregulin-1/anti-her3 antibody fusion protein for use in the treatment of heart failure
IL323340A (en) Anti-5t4 antigen binding regions, drug-antibody conjugates and methods of using them

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19723548

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3096420

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2019252262

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2020556258

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020020646

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: NC2020/0012621

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 2019252262

Country of ref document: AU

Date of ref document: 20190411

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20207032449

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019723548

Country of ref document: EP

Effective date: 20201111

WWP Wipo information: published in national office

Ref document number: NC2020/0012621

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112020020646

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20201008

WWG Wipo information: grant in national office

Ref document number: NC2020/0012621

Country of ref document: CO

WWG Wipo information: grant in national office

Ref document number: MX/A/2020/010740

Country of ref document: MX

WWR Wipo information: refused in national office

Ref document number: 1020207032449

Country of ref document: KR

WWR Wipo information: refused in national office

Ref document number: 1020207032449

Country of ref document: KR

WWC Wipo information: continuation of processing after refusal or withdrawal

Ref document number: 1020207032449

Country of ref document: KR

WWD Wipo information: divisional of initial pct application

Ref document number: 322374

Country of ref document: IL

WWG Wipo information: grant in national office

Ref document number: 11202009831U

Country of ref document: SG

WWP Wipo information: published in national office

Ref document number: 11202009831U

Country of ref document: SG