WO2019191079A1 - Methods and compositions for targeting liver and lymph node sinusoidal endothelial cell c-type lectin (lsectin) - Google Patents
Methods and compositions for targeting liver and lymph node sinusoidal endothelial cell c-type lectin (lsectin) Download PDFInfo
- Publication number
- WO2019191079A1 WO2019191079A1 PCT/US2019/024052 US2019024052W WO2019191079A1 WO 2019191079 A1 WO2019191079 A1 WO 2019191079A1 US 2019024052 W US2019024052 W US 2019024052W WO 2019191079 A1 WO2019191079 A1 WO 2019191079A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antigen
- polypeptide
- lsectin
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2851—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0008—Antigens related to auto-immune diseases; Preparations to induce self-tolerance
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/001—Preparations to induce tolerance to non-self, e.g. prior to transplantation
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
Definitions
- LSECtin liver sinusoidal endothelial cells C-type lectin
- liver sinusoidal endothelial cells are highly specialized endothelial cells representing the interface between blood cells on the one side and hepatocytes and hepatic stellate cells on the other side.
- LSECs Liver sinusoidal endothelial cells
- an underappreciated function of the liver is its role in immunity.
- the liver is subject to blood-borne pathogens to which it must mount a productive immune response, such as in hepatitis and malaria.
- the liver is home to the largest population of tissue resident macrophages, Kupffer cells, as well as the largest concentration of Natural Killer cells and Natural Killer T cells (Jenne and Kubes, Nat.
- the anatomy of the liver is suited for immune interactions. Blood slows significantly as it passes through the liver sinusoids, and the endothelium is fenestrated, exposing sub-endothelial cells residing in the space of Disse to circulating cells. Together this allows for intimate interactions between circulating lymphocytes and cells in the sinusoids, including hepatocytes, dendritic cells, Kupffer cells, and liver sinusoidal endothelial cells (LSECs).
- LSECs liver sinusoidal endothelial cells
- Immune responses are necessary for protection against potentially pathogenic microorganisms.
- undesired immune activation can cause injurious processes leading to damage or destruction of one's own tissues.
- Undesired immune activation occurs, for example, in autoimmune diseases where antibodies and/or T lymphocytes react with self- antigens to the detriment of the body's tissues. This is also the case in allergic reactions characterized by an exaggerated immune response to certain environmental matters and which may result in inflammatory responses leading to tissue destruction, as well as in rejection of transplanted organs mediated by alloreactive T cells present in the host.
- Immune tolerance is the acquired lack of specific immune responsiveness to an antigen to which an immune response would normally occur. Typically, to induce tolerance, there must be an exposure to a tolerizing antigen, which results in the death or functional inactivation of certain lymphocytes. This process generally accounts for tolerance to self- antigens, or self-tolerance.
- Immunosuppressive agents are useful in prevention or reduction of undesired immune responses, e.g ., in treating patients with autoimmune diseases or with allogeneic transplants. However, immunosuppressive agents can also cause systemic immune suppression, toxicity and even death due to opportunistic infections.
- Embodiments described herein address the unmet need in inducing immune tolerance by targeting the liver (e.g, LSECs) for purposes of modulating the immune system.
- the liver e.g, LSECs
- the tolerogenic nature of the liver is under investigation.
- transplants It was found that transplanted livers were accepted across Major Histocompatibility Complex (MHC) barriers in the absence of immunosuppression (Calne et al., 1969).
- MHC Major Histocompatibility Complex
- LSECs are involved in the dichotomy between immunity and tolerance. LSECs have been shown to be extremely efficient at endocytosis (Magnusson and Berg, Biochem. J 257:651-56, 1989). These cells express components necessary for T cell activation, including MHC class II and co-stimulatory molecules (Lohse et al., Gastroenterology 110: 1175-81, 1996).
- LSECs can process and present antigen to CD4+ T cells, but they may also cross present antigen to CD8 T cells, a capability that has otherwise only been described in dendritic cells and a subset of macrophages (Knolle et al., Gastroenterology 116: 1428-40, 1999; Limmer et al., Nat. Med. 6: 1348-54, 2000).
- LSECs express Toll-like receptors (TLRs) that enable them to mount productive immune responses.
- TLRs Toll-like receptors
- ETpon stimulation by a variety of pathogen associated molecular patterns they may produce immunogenic cytokines such as interferon beta, interleukin 6, and interleukin 12, and may activate CD8+ T cells as well as control hepatitis B virus replication in hepatocytes (Wu etal. Immunology 129:363-74, 2010; Martin-Armas etal. J Hepatol. 44:939-46, 2006; Wu et al. Hepatology 46: 1769-78, 2007; Liu et al. ./. Immunol. 191 :6178-90, 2013).
- immunogenic cytokines such as interferon beta, interleukin 6, and interleukin 12
- CD8+ T cells as well as control hepatitis B virus replication in hepatocytes
- LSECs also express a variety of endocytic receptors, such as mannose receptor, FCyRIIb, and LSECtin (Magnusson and Berg, Biochem. J. 257:651-56, 1989; Mousavi et al. Hepatology 46:871-84, 2007; Liu et al. J. Biol. Chem. 279: 18748-58, 2004).
- the former two have been shown to mediate traffic to endosomal compartments and lead to antigen presentation, so it is reasonable to assume that LSECtin, given its role in mediating endocytosis, will have a similar function in antigen presentation (Mousavi et al.
- LSECs are the only cells that express LSECtin in the liver (Liu et al. J. Biol. Chem. 279: 18748-58, 2004).
- LSECtin is a scavenger receptor that is capable of binding mannose and N-acetyl-glucosamine, and triggers rapid internalization of antigens.
- antigens targeted to LSECtin can be engulfed exclusively by the many LSECs lining the liver sinusoids, and that this antigen would be presented efficiently to circulating T cells. Prior to the embodiments described herein, it was unknown if this route of antigen presentation would lead to productive immunity or tolerogenic immunity. Described herein is the targeting of antigens to LSECtin to induce tolerogenic immunity, leading to new methods, compositions, and uses thereof for inducing antigen-specific tolerance.
- a composition for induction of antigen-specific tolerance comprising: a binding moiety that binds to Liver Sinusoidal Endothelial Cell C-Type Lectin (LSECtin) comprising an LSECtin-binding moiety and an antigen to which tolerance is desired.
- LSECtin-binding moiety is specific for human LSECtin.
- the LSECtin-binding moiety is cross-reactive with one or more additional species.
- the LSECtin-binding moiety binds to both primate (cynomolgus) and human LSECtin.
- the LSECtin-binding moiety comprises a heavy chain complementarity determining region (CDRH) comprising an amino acid sequence of SISSYY (SEQ ID NO: 100).
- the antigen to which tolerance is desired comprises a full length antigen, while in several embodiments, the antigen comprises one or more antigens or one or more fragments of the one or more antigens.
- the antigen to which tolerance is desired is covalently coupled to the LSECtin-binding moiety or joined to the LSECtin-binding moiety via a linker.
- the subject when a subject is exposed to the antigen alone, the subject reacts to the antigen alone with an unwanted immune response. However, as disclosed herein, when the subject is exposed to the compositions disclosed herein, the subject has a reduced immune response to a subsequent exposure to the antigen.
- LSECtin binding-moiety comprises a heavy chain complementarity determining region (CDRH) comprising an amino acid sequence of SISSYY (SEQ ID NO: 100).
- CDRH heavy chain complementarity determining region
- the LSECtin-binding moiety is specific for human LSECtin.
- the LSECtin-binding moiety is cross-reactive with one or more additional species.
- the LSECtin-binding moiety binds to both primate (cynomolgus) and human LSECtin.
- the antigen to which tolerance is desired comprises a full-length antigen, while in several embodiments, the antigen comprises one or more antigens or one or more fragments of the one or more antigens.
- the antigen to which tolerance is desired is covalently coupled to the LSECtin-binding moiety or joined to the LSECtin-binding moiety via a linker.
- when a subject is exposed to the antigen alone the subject reacts to the antigen alone with an unwanted immune response.
- administration of the compositions disclosed herein to the subject results in antigen-specific tolerance being developed to the antigen and as a result, the subject has a reduced immune response to a subsequent exposure to the antigen.
- the LSECtin-binding moiety is an LSECtin-specific antibody or a fragment of an LSECtin-specific antibody. In several embodiments, the LSECtin-binding moiety is fragment of an LSECtin-specific antibody, for example an scFv or a Fab.
- the LSECtin-binding moiety further comprises an additional CDRH comprising an amino acid sequence of SSI. In several embodiments, the CDRH comprises an amino acid sequence of SISSYYX3YTX4 (SEQ ID NO:68) and the additional CDRH comprises an amino acid sequence of X1SX2SSI (SEQ ID NO:67).
- CDRHs having at least about 80% sequence identity to those in SEQ ID NO: 67 or 68 are used.
- the LSECtin-binding moiety further comprises at least a third CDRH and a light chain complementarity determining region (CDRL).
- the CDRH comprises an amino acid sequence of SISSYYGYTY (SEQ ID NO:59) and the additional CDRH comprises an amino acid sequence of LSSSSI (SEQ ID NO:55).
- the LSECtin-binding moiety further comprises a light chain complementarity determining region (CDRL) having an amino acid sequence of SYWYPV (SEQ ID NO:5 l) or a CDRL having at least about 80% sequence identity to SEQ ID NO:5 l .
- the LSECtin-binding moiety further comprises at least a third CDRH having an amino acid sequence of NDDWYIWD WYYTRWY GL (SEQ ID NO:63), or a third CDRH having at least about 80% sequence identity to SEQ ID NO:63.
- the LSECtin-binding moiety further comprises one or more additional CDRL.
- the CDRH comprises an amino acid sequence of SISSYYSYTS (SEQ ID NO: 12) and the additional CDRH comprises an amino acid sequence of VSYSSI (SEQ ID NO:9) or polypeptides having at least about 80% sequence identity to SEQ ID NO: 12 or 9.
- the LSECtin-binding moiety further comprises a light chain complementarity determining region (CDRL) having an amino acid sequence of YLAYQSPL (SEQ ID NO:4), or a CDRL having at least about 80% sequence identity to SEQ ID NO:4.
- the LSECtin-binding moiety further comprises at least a third CDRH having an amino acid sequence of YEEWAYYSSEMAF (SEQ ID NO: 18) or a third CDRH having at least about 80% sequence identity to SEQ ID NO: 18. In several embodiments, the LSECtin-binding moiety further comprises one or more additional CDRL.
- the LSECtin-binding moiety has been affinity matured or is subjected to an affinity maturation campaign.
- the CDRH and/or CDRL sequences are humanized.
- the antigen to which tolerance is desired can vary.
- the antigen (or fragment, or combination of fragments) is associated with one or more of multiple sclerosis, Celiac disease and/or Type I Diabetes.
- the antigen comprises a polypeptide comprising a portion of SEQ ID NO:26. In several embodiments, the antigen comprises a polypeptide comprising a portion of SEQ ID NO:27. In several embodiments, the antigen comprises a polypeptide comprising a portion of SEQ ID NO:28. In several embodiments, the antigen comprises a polypeptide comprising a portion of SEQ ID NO:26 and a portion of SEQ ID NO:27 and/or a portion of SEQ ID NO:28.
- the antigen comprises a polypeptide comprising SEQ ID NO:69 or a polypeptide having at least about 85% sequence identity thereto and SEQ ID NO:70 or a polypeptide having at least about 85% sequence identity thereto.
- the antigen comprises a polypeptide comprising SEQ ID NO:7l or a polypeptide having at least about 85% sequence identity thereto and SEQ ID NO:75 or a polypeptide having at least about 85% sequence identity thereto.
- the antigen comprises a polypeptide comprising SEQ ID NO:72 or a polypeptide having at least about 85% sequence identity thereto and SEQ ID NO:76 or a polypeptide having at least about 85% sequence identity thereto.
- the antigen comprises a polypeptide comprising SEQ ID NO:73 or a polypeptide having at least about 85% sequence identity thereto and SEQ ID NO:35 or a polypeptide having at least about 85% sequence identity thereto.
- the antigen comprises a polypeptide comprising a portion of SEQ ID NO:26, a portion of SEQ ID NO:27, and a portion of SEQ ID NO:28.
- the antigen comprises a polypeptide comprising one or more of SEQ ID NO:35, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:7l, and SEQ ID NO:72, or a polypeptide having at least about 85% sequence identity to any of SEQ ID NO:35, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:7l, or SEQ ID NO:72.
- the antigen comprises a polypeptide comprising one or more of SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID NO:76, and SEQ ID NO:35, or a polypeptide having at least about 85% sequence identity to any of SEQ ID NO: 73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID NO:76, or SEQ ID NO:35.
- the antigen comprises a polypeptide comprising one or more of SEQ ID NO:35, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:7l, SEQ ID NO:73, SEQ ID NO:74, and SEQ ID NO:72, or a polypeptide having at least about 85% sequence identity to any of SEQ ID NO:35, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:7l, SEQ ID NO:73, SEQ ID NO:74, or SEQ ID NO:72.
- the antigen comprises a polypeptide comprising one or more of the amino acids sequences of SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, SEQ ID NO:33, SEQ ID NO:34 and SEQ ID NO:35.
- the antigen comprises a polypeptide comprising an amino acid sequence of SEQ ID NO:29.
- the antigen comprises a polypeptide comprising an amino acid sequence of SEQ ID NO:30.
- the antigen comprises a polypeptide comprising an amino acid sequence of SEQ ID NO:3 l .
- the antigen comprises a polypeptide comprising an amino acid sequence of SEQ ID NO:32.
- the antigen comprises a polypeptide comprising an amino acid sequence of SEQ ID NO:33. In several embodiments, the antigen comprises a polypeptide comprising an amino acid sequence of SEQ ID NO:34. In several embodiments, the antigen comprises a polypeptide comprising an amino acid sequence of SEQ ID NO:35. In several embodiments, the antigen comprises a polypeptide comprising an amino acid sequence of SEQ ID NO:42 or SEQ ID NO:43, or a polypeptide having at least about 85% sequence identity to any of SEQ ID NO:42 or SEQ ID NO:43.
- the antigen comprises a polypeptide comprising an amino acid sequence of SEQ ID NO:77, SEQ ID NO:78 or SEQ ID NO:79, or a polypeptide having at least about 85% sequence identity to any of SEQ ID NO:77, SEQ ID NO:78, or SEQ ID NO:79.
- the antigen comprises a polypeptide comprising a portion of SEQ ID NO:23.
- the antigen comprises a polypeptide comprising an amino acid sequence comprising a portion of SEQ ID NO:23 and a portion of SEQ ID NO:80.
- the antigen comprises one or more polypeptides selected from the group consisting of SEQ ID NO:9l, SEQ ID NO:92, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:95, and SEQ ID NO:96, or a polypeptide having at least about 85% sequence identity to any of SEQ ID NO:9l, SEQ ID NO:92, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:95 or SEQ ID NO:96.
- the antigen comprises one or more polypeptides selected from the group consisting of SEQ ID NO:82, SEQ ID NO:83, SEQ ID NO:84, SEQ ID NO:85, SEQ ID NO:86, SEQ ID NO:87, SEQ ID NO:88, SEQ ID NO:89, and SEQ ID NO:90, or a polypeptide having at least about 85% sequence identity to any of SEQ ID NO:82, SEQ ID NO:83, SEQ ID NO:84, SEQ ID NO:85, SEQ ID NO:86, SEQ ID NO:87, SEQ ID NO:88, SEQ ID NO:89 or SEQ ID NO:90.
- the antigen comprises one or more of high molecular weight glutenin; low molecular weight glutenin; alpha-, gamma- and omega-gliadin; hordein; secalin; avenin; a portion of any of the antigens, and a mimetic of any of antigens.
- the antigen comprises one or more of gliadin, a portion of gliadin, and a mimetic of any of the antigens.
- the antigen comprises one or more of insulin, proinsulin, preproinsulin, glutamic acid decarboxylase-65 (GAD-65), GAD-67, insulinoma-associated protein 2 (IA-2), and insulinoma-associated protein 213 (IA-213), ICA69, ICA12 (SOX-13), carboxypeptidase H, Imogen 38, GLIMA 38, chromogranin- A, HSP-60, caboxypeptidase E, peripherin, glucose transporter 2, hepatocarcinoma-intestine-pancreas/pancreatic associated protein, S 100b, glial fibrillary acidic protein, regenerating gene II, pancreatic duodenal homeobox 1, dystrophia myotonica kinase, islet-specific glucose-6- phosphatase catalytic subunit-related protein, SST G-protein coupled receptors 1-5, and a portion of any of the antigens, and a mim
- the antigen comprises one or more of myelin basic protein, myelin oligodendrocyte glycoprotein and proteolipid protein, a portion of any of the antigens, and a mimetic of any of the antigens.
- the antigen comprises one or more of Abciximab, Adalimumab, Agalsidase alfa, Agalsidase beta, Aldeslukin, Alglucosidase alfa, Factor VIII, Factor IX, Infliximab, L-asparaginase, Laronidase, Natalizumab, Octreotide, Phenylalanine ammonia-lyase (PAL), or Rasburicase (uncase), a portion of any of the antigens, and a mimetic of any of the antigens.
- the antigen comprises one or more subunits of the MHC class I and MHC class II haplotype proteins, and minor blood group antigens RhCE, Kell, Kidd, Duffy and Ss.
- the antigen comprises one or more of insulin, proinsulin, preproinsulin, a tolerogenic portion of any of the antigens, or a mimetic of any one of the antigens.
- Antigens associated with multiple sclerosis can be used in a composition and method for treating multiple sclerosis in a subject.
- Antigens associated with Celiac disease can be used in a composition and method for treating Celiac disease in a subject.
- Antigens associated with food allergy can be used in a composition and method for treating food allergy in a subject.
- Antigens associated with Type 1 diabetes can be used in a composition and method for treating Type 1 diabetes in a subject.
- LSECtin binding moieties that specifically bind LSECtin.
- the LSECtin binding moieties are antibodies, LSECtin binding fragments (e.g ., Fabs), or portions of antibodies (e.g, CDRs) that specifically bind to LSECtin.
- the LSECtin binding moieties are operatively coupled to an antigen for the purpose of delivering the antigen to LSECs.
- an antigen or antigens
- a fragment of an antigen e.g., an immunogenic portion of an antigen
- a mimotope of an antigen either in purified forms or cell-derived forms such as exosomes, cell fragments, or cells
- the LSECtin binding moiety e.g, LSECtin binding antibody or LSECtin binding fragment thereof
- the LSEC targeting complex can be used to induce immunological tolerance to an antigen that is included in the LSEC targeting complex and is delivered to LSECs.
- an LSECtin binding moiety such as an antibody or antibody fragment
- antigen X is conjugated to antigen X forming a LBM complex having the formula [A- B-X], where A is an LSECtin binding moiety; B is an optional linker; and X is a foreign transplant antigen, or alloantigen, or autoimmune antigen, or a fragment(s) of any such antigens.
- the antigen can be an antigen (or fragment(s)) against which a subject, such as a transplant recipient or autoimmune patient, develops an unwanted immune response.
- the antigen can be a foreign extracellular vesicle, cell fragment, or cell containing alloantigens against which transplant recipients or autoimmune patients develop and unwanted immune response.
- the antigen can be a foreign food, animal, plant or environmental antigen (or fragment(s) thereof) against which patients develop an unwanted immune response.
- the antigen can be a foreign therapeutic agent (or fragment(s) thereof) against which patients develop an unwanted immune response.
- the antigen can be a synthetic self-antigen (or fragments(s) thereof) to which patients develop an unwanted immune response.
- the antigen can be a tolerogenic (e.g., immunogenic) portion of a larger antigen.
- an antigen or antigen portion is, is at least, or is at most 3, 4, 5, 6, 7, 8, 9, 10, 11,
- an LSECtin binding moiety such as an antibody or antibody fragment
- a plurality of antigens, or antigenic fragments e.g., XI, X2, X3, Xn
- A is an LSECtin binding moiety
- B is an optional linker
- XI, X2, X3, and Xn are antigens as disclosed herein.
- XI, X2, X3 etc. may be the same, or different, antigens.
- XI, X2, X3, etc. may be a fragment derived from a different portion of an antigen of interest, for example a first, second, and third immunogenic region (overlapping in some embodiments) of a larger antigen of interest.
- an“antigen-binding molecule relates to molecules, in particular proteins such as antibodies, which contain antibody variable regions that provide specific binding to an epitope or portion of an antigen.
- the antibody variable region can be present in, for example, a complete antibody, an antibody fragment, and a recombinant derivative or analog of an antibody or antibody fragment.
- Antigen-binding fragments containing antibody variable regions include, but are not limited to“Fv,”“Fab,” and“F(ab')2” regions, “single domain antibodies (sdAb),” “nanobodies,” “single chain Fv (scFv)” fragments, “tandem scFvs” (VHA-VLA-VHB-VLB), “diabodies,” “triabodies” or “tribodies,” “single-chain diabodies (scDb),” and“bi-specific T-cell engagers (BiTEs)”.
- Antigen-binding molecules can also be antibodies of nonhuman origin, such as camelid antibodies.
- the antigen binding molecule is not a complete antibody but is less than full length.
- the antigen binding molecule is a humanized antigen binding molecule.
- an LSECtin binding moiety is, is at least, or is at most 20,
- a linker is, is at least, or is at most 20, 21, 22, 23, 24, 25, 26,
- the linker can be a synthetic linker in certain embodiments.
- nucleic acid there is a nucleic acid encoding all or part of a polypeptide, e.g. , a LSECtin targeting complex.
- the nucleic acid is in a plasmid or vector or expression construct.
- the nucleic acid is in a recombinant host cell.
- A“chemical modification” refers to a change in the naturally-occurring chemical structure of one or more amino acids of a polypeptide. Such modifications can be made to a side chain or a terminus, e.g ., changing the amino-terminus or carboxyl terminus. In some embodiments, the modifications are useful for creating chemical groups that can conveniently be used to link the polypeptides to other materials, or to attach a therapeutic agent.
- Conservative changes can generally be made to an amino acid sequence without altering activity. These changes are termed“conservative substitutions” or mutations; that is, an amino acid belonging to a grouping of amino acids having a particular size or characteristic can be substituted for another amino acID Substitutes for an amino acid sequence can be selected from other members of the class to which the amino acid belongs.
- the nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, methionine, and tyrosine.
- the polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine and glutamine.
- the positively charged (basic) amino acids include arginine, lysine and histidine.
- the negatively charged (acidic) amino acids include aspartic acid and glutamic acid. Such substitutions are not expected to substantially affect apparent molecular weight as determined by polyacrylamide gel electrophoresis or isoelectric point. Conservative substitutions also include substituting optical isomers of the sequences for other optical isomers, specifically d amino acids for 1 amino acids for one or more residues of a sequence. Moreover, all of the amino acids in a sequence can undergo a d to 1 isomer substitution.
- Exemplary conservative substitutions include, but are not limited to, Lys for Arg and vice versa to maintain a positive charge; Glu for Asp and vice versa to maintain a negative charge; Ser for Thr so that a free -OH is maintained; and Gln for Asn to maintain a free -ML ⁇ .
- Yet another type of conservative substitution constitutes the case where amino acids with desired chemical reactivities are introduced to impart reactive sites for chemical conjugation reactions, if the need for chemical derivatization arises.
- Such amino acids include but are not limited to Cys (to insert a sulfhydryl group), Lys (to insert a primary amine), Asp and Glu (to insert a carboxylic acid group), or specialized noncanonical amino acids containing ketone, azide, alkyne, alkene, and tetrazine side-chains.
- Conservative substitutions or additions of free -ML ⁇ or -SH bearing amino acids can be particularly advantageous for chemical conjugation of Fabs to antigens or vesicles.
- point mutations, deletions, and insertions of the polypeptide sequences or corresponding nucleic acid sequences can in some cases be made without a loss of function of the polypeptide or nucleic acid fragment.
- Substitutions can include, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 or more residues (including any number of substitutions between those listed).
- a variant usable in certain embodiments may exhibit a total number of up to 100 (e.g, up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100, including any number in between those listed) changes (e.g, exchanges, insertions, deletions, N-terminal truncations, and/or C-terminal truncations) in the in the amino acid or nucleotide sequence per, for example every 500 amino acids or nucleotides.
- the number of changes is greater than 100 while maintaining the desired character (e.g., function or antigenic nature) of the polypeptide.
- the variants include polypeptide sequences or corresponding nucleic acid sequences that exhibit a degree of functional equivalence with a reference (e.g, unmodified or native sequence). In several embodiments, the variants exhibit about 80%, about 85%, about 90%, about 95%, about 97%, about 98%, about 99% functional equivalence to an unmodified or native reference sequence (and any degree of functional equivalence between those listed, including endpoints).
- amino acid residues described herein employ either the single letter amino acid designator or the three-letter abbreviation in keeping with the standard polypeptide nomenclature. All amino acid residue sequences are represented herein by formulae with left and right orientation in the conventional direction of amino-terminus to carboxy -terminus.
- an effective amount refers to that amount of a composition of the disclosure that is sufficient to effect treatment, as defined herein, when administered to a mammal in need of such treatment. This amount will vary depending upon the subject and disease condition being treated, the weight and age of the subject, the severity of the disease condition, the particular composition of the disclosure chosen, the dosing regimen to be followed, timing of administration, manner of administration and the like, all of which can readily be determined by one of ordinary skill in the art.
- n an integer representing a mixture including from about 1 to 100, where the mixture typically encompasses the integer specified as n ⁇ about 10% (or for smaller integers from 1 to about 25, ⁇ 3), it should be understood that n can be an integer from about 1 to 100 (e.g., 1, 2, 3, 4, 5, 6,
- a peptide, protein, or fragment that specifically binds a particular target is referred to as a“ligand” for that target.
- A“polypeptide” is a term that refers to a chain of amino acid residues, regardless of post-translational modification (e.g ., phosphorylation or glycosylation) and/or complexation with additional polypeptides, and/or synthesis into multi-subunit complexes with nucleic acids and/or carbohydrates, or other molecules. Proteoglycans therefore also are referred to herein as polypeptides.
- polypeptides can be produced by a number of methods, many of which are well known in the art. For example, polypeptides can be obtained by extraction (e.g., from isolated cells), by expression of a recombinant nucleic acid encoding the polypeptide, or by chemical synthesis. Polypeptides can be produced by, for example, recombinant technology, and expression vectors encoding the polypeptide introduced into host cells (e.g, by transformation or transfection) for expression of the encoded polypeptide.
- pharmaceutically acceptable carrier or “pharmaceutically acceptable excipient” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like. In several embodiments, these media and agents can be used in combination with pharmaceutically active substances. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.
- purified refers to a polypeptide that has been chemically or biologically synthesized and is thus substantially uncontaminated by other polypeptides, or has been separated or isolated from most other cellular components by which it is naturally accompanied (e.g ., other cellular proteins, nucleic acids, or cellular components such as lipid membrane).
- An example of a purified polypeptide is one that is at least 70%, by dry weight, free from the proteins and naturally occurring organic molecules with which it naturally associates.
- a preparation of a purified polypeptide therefore can be, for example, at least 80%, at least 90%, or at least 99%, by dry weight, the polypeptide.
- Polypeptides also can be engineered to contain a tag sequence (e.g., a polyhistidine tag, a myc tag, a FLAG ® tag, a SNAP ® tag, or other affinity tag) that facilitates purification or marking (e.g, capture onto an affinity matrix, visualization under a microscope).
- a purified composition that comprises a polypeptide refers to a purified polypeptide unless otherwise indicated.
- isolated indicates that the polypeptides or nucleic acids of the disclosure are not in their natural environment. Isolated products of the disclosure can thus be contained in a culture supernatant, partially enriched, produced from heterologous sources, cloned in a vector or formulated with a vehicle, etc.
- sequence identity is used with regard to polypeptide sequence comparisons. This expression in particular refers to a percentage of sequence identity, for example at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% to the respective reference polypeptide or to the respective reference polynucleotide.
- the polypeptide in question and the reference polypeptide exhibit the indicated sequence identity over a continuous stretch of 20, 30, 40, 45, 50, 60, 70, 80, 90, 100 or more amino acids or over the entire length of the reference polypeptide.
- Specific binding refers to a molecule that binds to a target with a relatively high affinity as compared to non-targets, and generally involves a plurality of non-covalent interactions, such as electrostatic interactions, van der Waals interactions, hydrogen bonding, and the like. Specific binding interactions characterize antibody-antigen binding, enzyme- substrate binding, and certain protein-receptor interactions; while such molecules might bind tissues besides their specific targets from time to time, to the extent that such non-target binding is inconsequential, the high-affinity binding pair can still fall within the definition of specific binding.
- treatment means any treatment of a disease or disorder in a mammal, including: preventing or protecting against the disease or disorder, that is, causing the clinical symptoms not to develop; inhibiting the disease or disorder, that is, arresting or suppressing the development of clinical symptoms; and/or relieving the disease or disorder, that is, causing the regression of clinical symptoms.
- the term“unwanted immune response” refers to a reaction by the immune system of a subject, which in the given situation is not desirable.
- the reaction of the immune system is unwanted if such reaction does not lead to the prevention, reduction, or healing of a disease or disorder but instead causes, enhances or worsens a disorder or disease.
- a reaction of the immune system causes, enhances or worsens a disease if it is directed against an inappropriate target.
- an unwanted immune response includes but is not limited to transplant rejection, immune response against a therapeutic agent, autoimmune disease, and allergy or hypersensitivity.
- variant is to be understood as a protein that differs in comparison to the protein from which it is derived by one or more changes in its length, sequence, or structure.
- the polypeptide from which a protein variant is derived is also known as the parent polypeptide or polynucleotide that genetically encodes the polypeptide.
- variant comprises "fragments” or “derivatives” of the parent molecule. Typically, “fragments” are smaller in length or size than the parent molecule, whilst “derivatives” exhibit one or more differences in their sequence or structure in comparison to the parent molecule.
- modified molecules such as but not limited to post-translationally modified proteins (e.g glycosylated, phosphorylated, ubiquitinated, palmitoylated, or proteolytically cleaved proteins) and modified nucleic acids such as methylated DNA.
- post-translationally modified proteins e.g glycosylated, phosphorylated, ubiquitinated, palmitoylated, or proteolytically cleaved proteins
- modified nucleic acids such as methylated DNA.
- variant Naturally occurring and artificially constructed variants are to be understood to be encompassed by the term "variant” as used herein.
- variants usable in severable embodiments may also be derived from homologs, orthologs, or paralogs of the parent molecule or from artificially constructed variant, provided that the variant exhibits at least one biological activity of the parent molecule, i.e., is functionally active.
- a variant can be characterized by a certain degree of sequence identity to the parent polypeptide from which it is derived. More precisely, a protein variant in the context of the present disclosure may exhibit at least 80% sequence identity to its parent polypeptide. In several embodiments, the sequence identity of protein variants is over a continuous stretch of 20, 30, 40, 45, 50, 60, 70, 80, 90, 100 or more amino acids.
- variants exhibit about 80%, about 85%, about 90%, about 95%, about 97%, about 98%, about 99% functional equivalence to an unmodified or native reference sequence (and any degree of functional equivalence between those listed).
- operatively linked refers to a situation where two components are combined to form the active complex prior to binding at the target site.
- a molecule conjugated to one-half of a biotin-streptavidin complex and an antigen complexed to the other one-half of the biotin-streptavidin complex are operatively linked through complexation of the biotin and streptavidin molecules.
- the term operatively linked is also intended to refer to covalent or chemical linkages that conjugate two molecules together.
- the words“comprising” (and any form of comprising, such as“comprise” and“comprises”),“having” (and any form of having, such as “have” and“has”),“including” (and any form of including, such as“includes” and“include”) or“containing” (and any form of containing, such as“contains” and“contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps.
- FIG. 1 KingFisher plate layout used for phage display.
- the first row included streptavidin beads (Dynabeads) with 300 nM, 150 nM, 75 nM, or 20 nM biotinylated LSECtin variants, corresponding to the second, third, fourth, and fifth rounds of display.
- the next well row contained phage and 2 mM biotinylated SNAP protein, to remove potential SNAP binders.
- the following row contained 1 mM biotin to saturate biotin sites on the streptavidin beads.
- the following 4 rows contained 1 mM SNAP to wash.
- the last row contained thrombin, to elute phage. All steps contained TBS + 10 mM CaCh.
- FIG. 2 Fab hits from phage display. After sequencing approximately 96 single phage from display against each of three variants of LSECtin, numerous converging sequences were identified. The CDRL3, CDRH1, CDRH2, and CDRH3 of selected sequences is provided in Figure 2, as well as how many times the same sequence appeared in the screening.
- CDRL3 having an amino acid sequence of SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO: 7; CDRH1 having an amino acid sequence of SEQ ID NO: 8, SEQ ID NO: 9, or SEQ ID NO: 10; CDRH2 having an amino acid sequence of , SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: l3, SEQ ID NO: l4, SEQ ID NO: l5, or SEQ ID NO: l6; and CDRH3 having an amino acid sequence of SEQ ID NO: 17, SEQ ID NO: 18 (also referred to in shorthand notation as“YEE”), SEQ ID NO: 19, SEQ ID NO:20, SEQ ID NO:2l, or SEQ ID NO:22.
- YEE shorthand notation
- CDRL3 having an amino acid sequence of SEQ ID NO:5 l, SEQ ID NO:52, SEQ ID NO:53, or SEQ ID NO:54; CDRH1 having an amino acid sequence of SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, or SEQ ID NO:58; CDRH2 having an amino acid sequence of SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:6l, or SEQ ID NO:62; and CDRH3 having an amino acid sequence of SEQ ID NO:63 (also referred to in shorthand notation as“A1A1”), SEQ ID NO:64, SEQ ID NO:65, or SEQ ID NO:66.
- FIG. 3 Flow cytometry data for Fab binding to LSECtin immobilized on streptavidin polystyrene beads.
- SNAP -LSECtin was biotinylated and bound to Avidin polystyrene beads.
- Fab was added and detecting with anti-F(ab’)2 secondary antibody.
- Dotted line is an irrelevant antibody
- solid line is the YEE (SEQ ID NO: 18) containing Fab.
- FIGS. 4A-B Fab sequences. Full sequence of non-limiting embodiments of anti- LSECtin Fabs.
- A depicts selected CDR sequences from the Fab referred to as YEE.
- B depicts selected CDR sequences from the Fab referred to as A1A1.
- FIGS. 5A-B Flow cytometry of Fab binding to primary murine LSECs.
- A Liver cells were isolated as described above and stained for CD31 and Stabilin 2, markers sufficient to specifically identify LSECs.
- FIG. 6. Enzyme-linked immunosorbent assay for Fab binding to LSECtin.
- FIGS. 7A-C Immunofluorescence of anti-LSECtin Fab binding to liver sections.
- A Mouse sections stained with stabilin 2 and Al Al and imaged with 60x magnification.
- B Mouse sections stained with Al Al and imaged with 20x magnification.
- C Monkey sections stained with Al Al and imaged with 60x magnification.
- FIGS. 8A-B Uptake analysis of anti-LSECtin Fab.
- A Fab was recombinantly expressed with mCherry on the heavy chain. Fab-mCherry was added to LSECs at 4C for 20 minutes and washed to remove excess Fab. LSECs were incubated at 37C to allow for endocytosis and subsequently stained with an anti-Fab antibody.
- B LSECs were incubated with AlAl-mCherry or irrelevant Fab-mCherry 2 hours at 37C and the fluorescence intensity of mCherry was measured by flow cytometry.
- FIGS. 9A-B Biodistribution of anti-LSECtin Fab in vivo. 25 pg of Fab-800 were injected in vivo (A), and fluorescence was measured in nude mice for 24 hours (IVIS, Perkin Elmer). (B) To measure uptake specifically by LSECs, Fabs were conjugated to the fluorescent dye DY-649 (Dyomics). 2.5 pg of Fab-649 were injected into mice, and mice were sacrificed 30 minutes after injection. LSECs were isolated as in Example 7 and analyzed by flow cytometry for mean fluorescence intensity of Fab.
- FIGS. 10A-B Cathepsin cleaveable linkers between Fab and payload.
- Figure demonstrates that (A) Fab-CtsLl -mCherry is efficiently cleaved by cathepsin L at pH of 6, but not at a pH of 7.5 (B) Fab-mCherry without a linker is not cleaved at pH 6.
- FIGS. 11A-B Results of in vivo tolerance study to model antigens. Data depicted in the Figure demonstrate tolerance to antigens in vivo.
- A Percentage of CD45.1+ OTI or OTII cells in lymph node.
- B Production of interferon gamma after restimulation with SIINFEKL (SEQ ID NO: 115) or ISQ.
- the present disclosure provides certain therapeutic compositions (and method of using such compositions) that target the liver, for example, several embodiments target LSEC C-type lectin (LSECtin), a protein found primarily on LSECs in the liver (Liu et al., J. Biol. Chem. 279: 18748-58, 2004).
- LSECtin LSEC C-type lectin
- Targeting of these compositions to LSECs is accomplished by a high affinity binding moiety, e.g ., antibody (whether human or nonhuman or analog thereof, such as camelid), a high affinity fragment antibody (Fab) or related IgG or related single chain variable fragment (scFv) that binds specifically and with high affinity to LSECtin.
- a high affinity binding moiety e.g ., antibody (whether human or nonhuman or analog thereof, such as camelid), a high affinity fragment antibody (Fab) or related IgG or related single chain variable fragment (scFv) that binds
- the Fab (and/or a related form) can be chemically conjugated or recombinantly expressed as a fusion with an antigen (or an immunogenic fragment, or fragments, of an antigen).
- the antigen can be endogenous (a self-antigen) or exogenous (a foreign antigen), including but not limited to: a foreign transplant antigen against which transplant recipients develop an unwanted immune response (e.g, transplant rejection), an extracellular vesicle, cell fragment, or cell containing antigens against which transplant recipients develop an unwanted immune response (e.g, transplant rejection), a foreign food, animal, plant or environmental antigen to which patients develop an unwanted immune response (e.g, allergy or hypersensitivity), a therapeutic agent to which patients develop an unwanted immune response (e.g, hypersensitivity and/or reduced therapeutic activity), a self-antigen to which patients develop an unwanted immune response (e.g, autoimmune disease), or a portion (e.g, a fragment or an epitope) thereof.
- compositions are useful for inducing tolerance to the antigen.
- a full-length antigen need not be used, rather, in several embodiments, an immunogenic fragment, or fragments, of an antigen are used.
- an immunogenic fragment, or fragments, of an antigen are used.
- One of ordinary skill in the art would readily be able to, without undue experimentation, determine whether a given fragment, or fragments, of a larger antigen would be immunogenic (e.g., able to induce tolerance when administered with compositions according to embodiments disclosed herein).
- the LSEC-targeting polypeptide can be conjugated to an antibody, antibody fragment, or ligand that binds (e.g, specifically) a circulating protein or peptide or antibody that is causatively involved in transplant rejection, immune response against a therapeutic agent, autoimmune disease, and/or allergy (as discussed above).
- these compositions are useful for clearing and/or inducing tolerance to the circulating protein, peptide, or antibody.
- the compositions of the present disclosure can be used for treating an unwanted immune response, e.g, transplant rejection, an immune response against a therapeutic agent, an autoimmune disease, and/or an allergy.
- L SEC tin-binding molecule as used herein relates to molecules, in particular to proteins such as antibodies, which contain antibody regions (e.g ., variable regions) that provide specific binding to an epitope, or portion of LSECtin.
- the antibody variable region can be present in, for example, a complete antibody, an antibody fragment, and a recombinant derivative of an antibody or antibody fragment, or an analog thereof.
- LSECtin-binding fragments containing antibody variable regions include (without limitation)“Fv,”“Fab,” and “F(ab')2” regions,“single domain antibodies (sdAb),”“nanobodies,”“single chain Fv (scFv)” fragments,“tandem scFvs” (VHA-VLA-VHB-VLB),“diabodies,”“triabodies” or“tribodies,” “single-chain diabodies (scDb),” and“bi-specific T-cell engagers (BiTEs),” as well other protein scaffolds (i.e., analogs) that can support antibody variable regions and maintain their binding specificity.
- LSECtin-binding molecules can also be antibodies of nonhuman origin, such as camelid antibodies. These include human, non-human (such as mouse) and non-natural (i.e., engineered) proteins, antibodies, chimeric antibodies, humanized antibodies, camelid antibodies, and non-antibody binding scaffolds, such as protein frameworks including complementary determining regions such as fibronectins, knottins, anticalins, affibodies, 4- helix bundle proteins, ankyrin repeat proteins (e.g., DARPins), tetranectins, adnectins, A- domain proteins, lipocalins, immunity protein ImmE7, cytochrome b562, amyloid b-protein precursor inhibitor, cellulose binding domain from cellobiohydrolase Cel7A, carbohydrate binding module CBM4-2; RNA; DNA aptamers; and molecularly imprinted nanoparticles.
- nonhuman origin such as camelid antibodies.
- non-antibody binding scaffolds such as protein
- the LSECtin binding moiety is an antibody.
- the antibody can have a light chain having a light chain amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 113 and/or a heavy chain amino acid sequence of SEQ ID NO:2 or SEQ ID NO: 114.
- One non-limiting example of a LSECtin binding moiety is an antibody having one or more CDRs.
- an antibody or LSECtin binding moiety can comprise 1, 2, 3, 4, 5, or 6 CDRs selected from CDRL3 having an amino acid sequence of SEQ ID NO:5 l, SEQ ID NO:52, SEQ ID NO:53, or SEQ ID NO:54; CDRH1 having an amino acid sequence of SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, or SEQ ID NO:58; CDRH2 having an amino acid sequence of SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:6l, or SEQ ID NO: 62; and/or a CDRH3 having an amino acid sequence of SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO:65, or SEQ ID NO:66.
- an antibody or LSECtin binding moiety can comprise 1, 2, 3, 4, 5, or 6 CDRs selected from CDRL1 having an amino acid sequence of SEQ ID NO:49; CDRL2 having an amino acid sequence of SEQ ID NO:50; CDRL3 having an amino acid sequence of SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7; CDRH1 having an amino acid sequence of SEQ ID NO:8, SEQ ID NO: 9, or SEQ ID NO: 10; CDRH2 having an amino acid sequence of , SEQ ID NO: 11, SEQ ID NO: l2, SEQ ID NO: l3, SEQ ID NO: l4, SEQ ID NO: l5, or SEQ ID NO: l6; and/or a CDRH3 having an amino acid sequence of SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:20, SEQ ID NO:2l, or SEQ ID NO:22.
- combinations selected from CDRL1 having an
- An“antigen” is any substance that serves as a target for the receptors of an adaptive immune response, such as the T cell receptor, major histocompatibility complex class I and II, CDld, B cell receptor or an antibody, or otherwise induces or increases an adverse immune response.
- An antigen may originate from within the body ("self,”“auto” or“endogenous”).
- An antigen may originate from outside the body (“non-self,”“foreign” or“exogenous”, or “allogeneic”), having entered, for example, by inhalation, ingestion, injection, or transplantation, and at times biochemically modified in the body.
- Foreign antigens include, but are not limited to, food antigens, animal antigens, plant antigens, environmental antigens, therapeutic agents, as well as antigens present in an allograft transplant.
- a conjugate may also be an assortment of one or more antigens, as with extracellular vesicles derived from B cells, dendritic cells, monocytes, or other antigen presenting cell, or serum plasma of a donor.
- the antigen is one in which a tolerogenic immune response is desired, whether that be anergy, deletion, or regulation.
- An “epitope”, also known as antigenic determinant, is the segment of a macromolecule, e.g ., a protein, which is recognized by the adaptive immune system, such as by antibodies, B cells, major histocompatibility complex molecules, CDld molecules, T cells, or NKT cells.
- An epitope is that part or segment of a macromolecule capable of binding to an antibody or antigen-binding fragment thereof.
- binding in particular relates to a specific binding.
- the term“epitope” refers to the segment of protein or polypeptide that is recognized by the immune system.
- the antigen coupled to the LSECtin binding moiety or specific antibody or fragments thereof can be a protein or a peptide, e.g. , the antigen may be a complete or partial therapeutic agent, a full-length transplant protein or peptide thereof, a full- length autoantigen or peptide thereof, a full-length allergen or peptide thereof, and/or a nucleic acid, or a mimetic of an antigen.
- the antigen can comprise an extracellular vesicle derived from B cells, dendritic cells, macrophages, monocytes, or other cell types, or from serum plasma, being transferred across major or minor antigen mismatches, such as from one MHC haplotype to another.
- the antigen is housed in, integrated into or otherwise carried by, for example, cell fragments such as exosomes or extracellular vesicles or whole cells containing transplant or autoimmune antigens.
- antigens comprise, but are not limited to one or more (a), (b), (c) and (d), as follows (including combinations thereof): (a) Therapeutic agents that are proteins, peptides, lipids, saccharides, antibodies and antibody-like molecules, including antibody fragments and fusion proteins with antibodies and antibody fragments. These include, but are not limited to, human, non-human (such as mouse) and non-natural ( e.g .
- the antigen can be a complete protein, a portion of a complete protein, a peptide, or the like (e.g., a mimetic or antigenic fragment), and can be derivatized (as discussed herein) for attachment to a linker moiety, can be a variant, and/or can contain conservative substitutions.
- a full-length antigen need not be used, rather, in several embodiments, an immunogenic fragment, or fragments, of an antigen are used.
- multiple copies of an immunogenic fragment are used, e.g., the antigen portion of a composition comprises XI -XI -XI -XI (an optional linker may be included between the XI portions, in some embodiments).
- multiple fragments of an antigen are used, e.g., XI, X2, X3, the fragments optionally being distinct regions of the antigen in some embodiments, while in other embodiments the regions can be at least partially overlapping.
- multiple fragments from multiple antigens are used, e.g, the antigen portion of a composition comprises XI, Yl, Zl .
- antigens can be selected from the following list, without limitation (Leader et ah, Nat Rev Drug Discov 7:21-39, 2008, hereby incorporated by reference): Abatacept, Abciximab, Adalimumab, Adenosine deaminase, Ado-trastuzumab emtansine, Agalsidase alfa, Agalsidase beta, Aldeslukin, Alglucerase, Alglucosidase alfa, a-l- proteinase inhibitor, Anakinra, Anistreplase (anisoylated plasminogen streptokinase activator complex), Antithrombin III, Antithymocyte globulin, Ateplase, Bevacizumab, Bivalirudin, Botulinum toxin type A,
- the therapeutic protein, peptide, antibody or antibody-like molecules are Abciximab, Adalimumab, Agalsidase alfa, Agalsidase beta, Aldeslukin, Alglucosidase alfa, Factor VIII, Factor IX, Infliximab, Insulin (including rHu Insulin), L- asparaginase, Laronidase, Natalizumab, Octreotide, Phenylalanine ammonia-lyase (PAL), or Rasburicase (uricase) and generally IgG monoclonal antibodies in their varying formats.
- Another particular group includes the hemostatic agents (Factor VIII and IX), Insulin (including rHu Insulin), and the non-human therapeutics uricase, PAL and asparaginase.
- Unwanted immune responses in hematology and transplants include autoimmune aplastic anemia, transplant rejection (generally), and Graft vs. Host Disease (bone marrow transplant rejection).
- the antigen is a human allograft transplantation antigen
- specific sequences can be selected from: subunits of the various MHC class I and MHC class II haplotype proteins (for example, donor/recipient differences identified in tissue cross-matching), and single-amino-acid polymorphisms on minor blood group antigens including RhCE, Kell, Kidd, Duffy and Ss.
- Such compositions can be prepared individually for a given donor/recipient pair.
- antigen is a human allograft transplantation antigen
- specific sequences may be present at purified molecular entities, or they may be contained in whole cells or cell fragments and extracellular vesicles, for examples from B cells, dendritic cells, macrophages, monocytes, or other cell types, or from blood serum or plasma, being transferred across major or minor mismatches, such as from one MHC haplotype to another.
- antigens can be selected from, but not limited to: [0082] In type 1 diabetes mellitus, several antigens have been identified and include, but are not limited to: insulin, proinsulin, preproinsulin, glutamic acid decarboxylase-65 (GAD- 65 or glutamate decarboxylase 2), GAD-67, glucose-6 phosphatase 2 (IGRP or islet-specific glucose 6 phosphatase catalytic subunit related protein), insulinoma-associated protein 2 (IA- 2), and insulinoma-associated protein 2b (IA-2b); other antigens include ICA69, ICA12 (SOX- 13), carboxypeptidase H, Imogen 38, GLIMA 38, chromogranin-A, HSP-60, caboxypeptidase E, peripherin, glucose transporter 2, hepatocarcino
- insulin is an example of an antigen that can be characterized both as a self-antigen and a therapeutic protein antigen.
- rHu Insulin and bovine insulin are therapeutic protein antigens (that are the subject of unwanted immune attack), whereas endogenous human insulin is a self-antigen (that is the subject of an unwanted immune attack). Because endogenous human insulin is not available to be employed in a pharmaceutical composition a recombinant form is employed in selected compositions of the disclosure.
- Human insulin including an exogenously obtained form useful in several embodiments, has the following sequence (UNIPROT P01308): MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTR REAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
- GAD-65 including an exogenously obtained form useful in several embodiments, has the following sequence (UNIPROT Q05329):
- IGRP including an exogenously obtained form useful in several embodiments, has the following sequence (UNIPROT QN9QR9):
- IA-2 including an exogenously obtained form useful in several embodiments, has the following sequence (NCBI Reference Sequence: XP_016860098.1):
- VNAILKALPQ (SEQ ID NO: 80).
- antigens include, but are not limited to, thyroglobulin (TG), thyroid peroxidase (TPO) and thyrotropin receptor (TSHR); other antigens include sodium iodine symporter (NIS) and megalin.
- TG thyroglobulin
- TPO thyroid peroxidase
- TSHR thyrotropin receptor
- other antigens include sodium iodine symporter (NIS) and megalin.
- NIS sodium iodine symporter
- an antigen is insulin-like growth factor 1 receptor.
- a main antigen is calcium sensitive receptor.
- antigens include, but are not limited to, 21 -hydroxylase, 17a- hydroxylase, and P450 side chain cleavage enzyme (P450scc); other antigens include ACTH receptor, P450c2l and P450cl7.
- P450scc P450 side chain cleavage enzyme
- antigens include, but are not limited to, FSH receptor and a-enolase.
- main antigens include, but are not limited to, pituitary gland-specific protein factor (PGSF) la and 2; another antigen is type 2 iodothyronine deiodinase.
- PGSF pituitary gland-specific protein factor
- antigens include, but are not limited to, myelin basic protein (“MBP”), myelin oligodendrocyte glycoprotein (“MOG”) and myelin proteolipid protein (“PLP”).
- MBP myelin basic protein
- MOG myelin oligodendrocyte glycoprotein
- PGP myelin proteolipid protein
- MBP including an exogenously obtained form useful in several embodiments, has the following sequence (UNIPROT P02686):
- MOG including an exogenously obtained form useful in several embodiments, has the following sequence (UNIPROT Q16653):
- PLP including an exogenously obtained form useful in several embodiments, has the following sequence (UNIPROT P60201):
- Peptides/epitopes useful in several embodiments for treating multiple sclerosis include some or all of the following sequences, individually or in combination (including multiple repetitions of one or more of the following: MBP13-32: KYLATASTMDHARHGFLPRH (SEQ ID NO:29); MBP83-99: ENPWHFFKNIVTPRTP (SEQ ID NO: 30); MBP111-129: L SRF S W GAEGQRPGF GY GG (SEQ ID NO: 31); MBP146- 170: AQGTL SKIFKLGGRD SRSGSPMARR (SEQ ID NO:32); MOG1-20:
- antigens include, but are not limited to, collagen II, immunoglobulin binding protein, the fragment crystallizable region of immunoglobulin G, double-stranded DNA, and the natural and cirtullinated forms of proteins implicated in rheumatoid arthritis pathology, including fibrin/fibrinogen, vimentin, collagen I and II, and alpha-enolase.
- an antigen is H+,K+-ATPase.
- an antigen is intrinsic factor.
- antigens include, but are not limited to, tissue transglutaminase and the natural and deamidated forms of gluten or gluten-like proteins, such as alpha-, gamma-, and omega-gliadin, glutenin, hordein, secalin, and avenin.
- tissue transglutaminase and the natural and deamidated forms of gluten or gluten-like proteins, such as alpha-, gamma-, and omega-gliadin, glutenin, hordein, secalin, and avenin.
- alpha gliadin turns more immunogenic in the body through deamidation by tissue glutaminase converting alpha gliadin’ s glutamines to glutamic acid.
- alpha gliadin is originally a foreign food antigen, once it has been modified in the body to become more immunogenic it can be characterized as a self-antigen.
- Peptides/epitopes useful in several embodiments for treating celiac disease include some or all of the following sequences, individually or in combination (including multiple repetitions of one or more of the following: DQ-2 related native gliadin: LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF (SEQ ID NO:42); DQ-2 related deamidated gliadin: LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF (SEQ ID NO:43); DQ-8 related alpha-gliadin: QQYPSGQGSFQPSQQNPQ (SEQ ID NO:44), DQ-8 related omega-gliadin: QPFPQPEQPFPW (SEQ ID NO:45), an immunogenic fragment of gliadin: PQ
- antigens are tyrosinase, and tyrosinase related protein 1 and 2.
- MART1 Melanoma antigen recognized by T cells 1, Melan-A, including an exogenously obtained form useful in several embodiments , has the following sequence (UNIPROT Q 16655):
- Tyrosinase including an exogenously obtained form useful in several embodiments, has the following sequence (UNIPROT P14679):
- Melanocyte protein PMEL has the following sequence (UNIPROT P40967): MDL VLKRCLLHL A VIGALL A V GATK VPRN QD WLGV SRQLRTK AWNRQL YPEWTE AQRLDCWRGGQ V SLKV SNDGPTLIGANASF SIALNFPGSQKVLPDGQ VIWVNNTIIN GSQ VW GGQP VYPQETDD ACIFPDGGPCPS GS W SQKRSF VYVWKTW GQ YWQ VLGG P VSGLSIGTGRAMLGTHTMEVT VYHRRGSRS YVPLAHS S S AFTITDQVPF S VS VSQLR ALDGGNKHFLRN QPLTF ALQLHDP S GYL AE ADL S YT WDF GD S SGTLI SRAL V VTHT Y LEPGPVTAQVVLQAAIPLTSCGS
- an antigen is acetylcholine receptor.
- antigens are desmoglein 3, 1 and 4; other antigens include pemphaxin, desmocollins, plakoglobin, perplakin, desmoplakins, and acetylcholine receptor.
- antigens include BP 180 and BP230; other antigens include plectin and laminin 5.
- antigens include, endomysium and tissue transglutaminase.
- an antigen in epidermolysis bullosa acquisita, a non-limiting example of an antigen is collagen VII.
- antigens include, but are not limited to, matrix metalloproteinase 1 and 3, the collagen-specific molecular chaperone heat-shock protein 47, fibrillin- 1, and PDGF receptor; other antigens include Scl-70, Ul RNP, Th/To, Ku, Jol, NAG-2, centromere proteins, topoisomerase I, nucleolar proteins, RNA polymerase I, II and III, PM-Slc, fibrillarin, and B23.
- antigens are nuclear antigens SS- A and SS-B; other antigens include fodrin, poly(ADP-ribose) polymerase and topoisomerase, muscarinic receptors, and the Fc-gamma receptor Illb.
- antigens include nuclear proteins including the “Smith antigen,” SS-A, high mobility group box 1 (HMGB 1), nucleosomes, histone proteins and double-stranded DNA (against which auto-antibodies are made in the disease process).
- SS-A nuclear proteins
- HMGB 1 high mobility group box 1
- nucleosomes nucleosomes
- histone proteins double-stranded DNA (against which auto-antibodies are made in the disease process).
- antigens include glomerular basement membrane proteins including collagen IV.
- an antigen is cardiac myosin.
- autoimmune poly endocrine syndrome type 1 non-limiting example of antigens include aromatic L-amino acid decarboxylase, histidine decarboxylase, cysteine sulfmic acid decarboxylase, tryptophan hydroxylase, tyrosine hydroxylase, phenylalanine hydroxylase, hepatic P450 cytochromes P4501A2 and 2A6, SOX-9, SOX-10, calcium-sensing receptor protein, and the type 1 interferons interferon alpha, beta and omega.
- an antigen is AQP4.
- Aquaporin-4 including an exogenously obtained form useful in several embodiments , has the following sequence (UNIPROT P55087): MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGST INWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAK SVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFT IF ASCD SKRTD VTGSIALAIGF S VAIGHLF AINYTGASMNPARSFGP AVIMGNWENHW IYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQV ETDDLILKPGVVHVID VDRGEEKKGKDQ S GEVL S S V (SEQ ID NO:39).
- S-arrestin including an exogenously obtained form useful in several embodiments , has the following sequence (UNIPROT P10523):
- IRBP including an exogenously obtained form useful in several embodiments, has the following sequence (UNIPROT P 10745):
- VLTS S QTRGV AEDIAHILKQMRRAI V V GERT GGGALDLRKLRIGE SDFFF T VP V SRSL
- specific antigens include, but are not limited to: Peanut antigen(s): conarachin (Ara h 1), allergen II (Ara h 2), arachis agglutinin, conglutin (Ara h 6); conarachin, for example has the sequence identified as UNIPROT Q6PSET6; Apple antigen: 31 kda major allergen/disease resistance protein homolog (Mal d 2), lipid transfer protein precursor (Mal d 3), major allergen Mal d 1.03D (Mal d 1); Milk antigen: a-lactalbumin (ALA), lactotransferrin; from kiwi: actinidin (Act c 1, Act d 1), phytocy statin, thaumatin-like protein (Act d 2), kiwellin (Act d 5); egg white antigen: ovomu
- Peptides/epitopes useful, in several embodiments, for treating Celiac Disease include some or all of the following sequences, individually or in combination:
- DQ-8 relevant, Omega-gliadin (wheat, U5UA46): QPFPQPEQPFPW (SEQ ID NO:45).
- antigens can, include, but are not limited to, for example: cat, mouse, dog, horse, bee, dust, tree and goldenrod, including the following proteins or peptides derived from: (a) weeds, (including ragweed allergens amb a 1, 2, 3, 5, and 6, and Amb t 5; pigweed Che a 2 and 5; and other weed allergens Par j 1, 2, and 3, and Par o 1); (b) grass (including major allergens Cyn d 1, 7, and 12; Dac g 1, 2, and 5; Hol 1 1.01203; Lol p 1, 2, 3, 5, and 11; Mer a 1; Pha a 1; Poa p 1 and 5); (c) pollen from ragweed and other weeds (including curly dock, lambs quarters, pigweed, plantain, sheep sorrel, and s
- X is an antibody, antibody fragment or ligand that specifically binds a circulating protein or peptide or antibody, which circulating protein or peptide or antibody gives rise to transplant rejection, immune response against a therapeutic agent, autoimmune disease, and/or allergy (or other unwanted immune reaction).
- X binds an endogenous circulating protein or peptide or antibody.
- X is a fluorophore such as Alexa Fluor 405, Alexa Fluor 488, Alexa Fluor 555, Alexa Fluor 594, Alexa Fluor 647, Alexa Fluor 700, AmCyan, allophycocyanin (APC), APC/Alexa Fluor 750, APC/Cy5.5, APC/Cy7, BD Horizon V450, BD Horizon V500, BD Horizon BB515, BD Horizon BUV395, BD Horizon BUV4956, BD Horizon BUV737, Brilliant Violet 421, Brilliant Violet 510, Brilliant Violet 570, Brilliant Violet 605, Brilliant Violet 650, Brilliant Violet 711, Brilliant Violet 785, Cascade Blue, Cascade Yellow, CFP, CFSE, Cy3, Cy5, DAPI, DRAQ5, DRAQ7, DsRed-Express, dTomato, eBFP, eCFP, eFluor 450, eF
- X is an extracellular vesicle.
- antigen-presenting cells monocytes, B cells, or dendritic cells
- RPMI 4% exosome-free fetal bovine serum, 1% penicillin/streptomycin
- supernatant is isolated and centrifuged at 300 x g for 5 minutes at 4C to pellet cells.
- Supernatant is isolated and centrifuged at 2000 x g for 5 minutes at 4C.
- a patient can be tested to identify an antigen against which an unwanted immune response has developed, and a protein, peptide or the like can be developed based on that antigen and incorporated as X in a composition according to embodiments of the present disclosure.
- Linkers such as amino acid or peptidimimetic sequences may be inserted between the LSECtin binding moiety and antigen.
- Linkers may have one or more properties that include a flexible conformation, an inability to form an ordered secondary structure or a hydrophobic or charged character which could promote or interact with either domain.
- Examples of amino acids typically found in flexible protein regions may include Gly, Asn, and Ser.
- Other near neutral amino acids, such as Thr and Ala may also be used in the linker sequence.
- the length of the linker sequence may vary without significantly affecting the function or activity of the fusion protein (see, U.S. Patent 6,087,329).
- a LBM and antigen are joined by a peptide sequence having from about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, to 25 amino acid residues.
- linkers may also include chemical moieties and conjugating agents, such as sulfo-succinimidyl derivatives (sulfo-SMCC, sulfo-SMPB), disuccinimidyl suberate (DSS), disuccinimidyl glutarate (DSG) and disuccinimidyl tartrate (DST).
- the linker can be a dipeptide linker, such as a valine-citrulline (val-cit), a phenylalanine-lysine (phe-lys) linker, or maleimidocapronic-valine-citruline-p-aminobenzyloxycarbonyl (vc) linker.
- the linker is sulfosuccinimidyl-4-[N-maleimidomethyl]cyclohexane-l- carboxylate (smcc).
- Sulfo-smcc conjugation occurs via a maleimide group which reacts with sulfhydryls (thiols, -SH), while its Sulfo-NHS ester is reactive toward primary amines (as found in Lysine and the protein or peptide N-terminus).
- the linker may be maleimidocaproyl (me).
- a linker is a bifunctional linker and includes reagents for molecular conjugation reactions to provide structural stability or assistance in protein-cell, protein-cell fragment, protein-exosome, protein-extracellular vesicle, protein-protein, protein- peptide, protein-polymer, polymer-small molecule, peptide/protein-small molecule interactions, immobilization for assays or purification, as well as various peptide-nucleic acid and nucleic-nucleic acid conjugations, among many others.
- bifunctional linkers contain functional groups, such as primary amines, sulfhydryls, acids, alcohols and bromides. Specifically maleimide (sulfhydryl reactive) and succinimidyl ester (NHS) or isothiocyanate (ITC) groups that react with amines may find used in the current embodiments.
- a bifunctional linker can be used as a spacer between an LSECtin binding moiety and an antigen.
- cleavable linkers used in chemical biology classified according to their cleavage conditions by, for example, enzymes, nucleophilic/basic reagents, photo-irradiation, electrophilic/acidic reagents, organometallic and metal reagents, or oxidizing reagents.
- a LSECtin binding moiety can be linked to extracellular vesicles and the like.
- a LSECtin binding moiety can be chemically conjugated to extracellular vesicles, cell fragments, or cells.
- LSECtin binding moieties may also be linked to extracellular vesicles, cell fragments, or cells via non-covalent mechanisms (Armstrong et al., Therapeutics. ACS Nano , 2017).
- a bi-functional molecule may be produced by recombinant expressed or chemical conjugation, such that on one side it is the LSECtin binding moiety, and on the other binds to a protein or molecule on the extracellular vesicle, cell fragment, or cell, ( e.g ., a tetraspanin).
- Cells may be genetically engineered to express a LSECtin binding moiety with a membrane insertion sequence, such that once expressed, LSECtin binding moiety is inserted into the membrane, and cells and all derivatives thereof will have a LSECtin binding moiety inserted into the membrane.
- a LSECtin binding moiety may be recombinantly expressed such that it has a hydrophobic membrane insertion region that may be inserted into extracellular vesicles, cell fragments, or cells in vitro.
- Extracellular vesicles, cell fragments, and cells may be permeabilized, such as by electroporation, to allow for a LSECtin binding moiety to be inserted into the membrane.
- compositions of the present disclosure find use in a variety of applications including, but not limited to, detection of LSECtin protein such as by flow cytometry, western blot, and immunohistochemistry, and treatment of transplant rejection, immune response against a therapeutic agent, autoimmune disease, and food allergy.
- compositions of the disclosure are used to modulate, particularly down-regulate, antigen-specific undesirable immune response.
- compositions disclosed herein are useful to bind and clear from the circulation specific undesired proteins, including antibodies endogenously generated in a patient (z.e., not exogenous antibodies administered to a patient), peptides and the like, which cause autoimmunity and associated pathologies, allergy, inflammatory immune responses, and anaphylaxis.
- antigens are targeted to the liver for presentation via liver sinusoidal endothelial cells (LSECs) to specifically down-regulate the immune system or for clearance of unwanted circulating proteins.
- LSECs liver sinusoidal endothelial cells
- compositions and methods to treat unwanted immune response to self-antigens and foreign antigens including but not limited to: a foreign transplant antigen against which transplant recipients develop an unwanted immune response (e.g., transplant rejection), a foreign antigen to which patients develop an unwanted immune (e.g., allergic or hypersensitivity) response, a therapeutic agent to which patients develop an unwanted immune response (e.g., hypersensitivity and/or reduced therapeutic activity), a self-antigen to which patients develop an unwanted immune response (e.g., autoimmune disease).
- Autoimmune disease states that can be treated using the methods and compositions provided herein include, but are not limited to: Acute Disseminated Encephalomyelitis (ADEM); Acute interstitial allergic nephritis (drug allergies); Acute necrotizing hemorrhagic leukoencephalitis; Addison’s Disease; Alopecia areata; Alopecia universalis; Ankylosing Spondylitis; Arthritis, juvenile; Arthritis, psoriatic; Arthritis, rheumatoid; Atopic Dermatitis; Autoimmune aplastic anemia; Autoimmune gastritis; Autoimmune hepatitis; Autoimmune hypophysitis; Autoimmune oophoritis; Autoimmune orchitis; Autoimmune polyendocrine syndrome type 1; Autoimmune polyendocrine syndrome type 2; Autoimmune thyroiditis; Behcet’s disease; Bronchiolitis
- a particular group of autoimmune disease states that can be treated using the methods and compositions provided herein include, but are not limited to: Acute necrotizing hemorrhagic leukoencephalitis; Addison’s Disease; Arthritis, psoriatic; Arthritis, rheumatoid; Autoimmune aplastic anemia; Autoimmune hypophysitis; Autoimmune gastritis; Autoimmune polyendocrine syndrome type 1; Bullous pemphigoid; Celiac disease; Coxsackie myocarditis; Dermatitis herpetiformis Duhring; Diabetes mellitus (Type 1); Epidermolysis bullosa acquisita; Giant cell myocarditis; Goodpasture’s syndrome; Graves’ disease; Hashimoto’s thyroiditis; Mixed connective tissue disease; Multiple sclerosis; Myasthenia gravis; Neuromyelitis optica; Pernicious angemis; Pemphigus vulgaris and
- treatment can be provided for reactions against, for example: peanut, apple, milk, egg whites, egg yolks, mustard, celery, shrimp, wheat (and other cereals), strawberry and banana.
- a patient can be tested to identify a foreign antigen against which an unwanted immune response has developed, and a composition of the disclosure can be developed based on that antigen.
- compositions provided for herein in binding to liver and sinusoidal endothelial cells (LSECs) in vivo can be established. This can be accomplished, for example, by employing a marker (such as the fluorescent marker Alexa Fluor 647) in a composition of the disclosure.
- the composition is administered to suitable experimental subjects. Controls, e.g., irrelevant Fab or vehicle (saline) are administered to other group(s) of subjects.
- the composition and controls are allowed to circulate for a period of 10 minutes to 5 hours, after which the spleens and livers of the subjects are harvested and measured for fluorescence.
- the specific cells in which fluorescence is found can be subsequently identified.
- experimental subjects may be imaged in real time using an in vivo imaging system. Compositions of the disclosure, when tested in this manner, show higher levels of concentration in the antigen-presenting cells of the liver as compared with irrelevant Fab or vehicle.
- Humoral immune response can be tested by administering a composition of the disclosure incorporating a known antigen, such as OVA (a gold standard antigen in immunological testing), as compared with the administration of the antigen alone or antigen conjugated to an irrelevant Fab, and measuring the levels of resulting antibodies.
- a composition of the disclosure when tested in this manner, in several embodiments, show very low (e.g., background) levels of antibody formation responsive to their administration and the administration of vehicle, with significantly higher levels of antibody formation responsive to administration of the antigen or antigen conjugated to irrelevant Fab.
- Disease-focused experimental models are well known to those skilled in the art and include the NOD (or non-obese diabetic) mouse model of autoimmunity and tolerance and the EAE (experimental autoimmune encephalomyelitis) model for the human inflammatory demyelinating disease, multiple sclerosis.
- NOD or non-obese diabetic
- EAE experimental autoimmune encephalomyelitis
- immunization with myelin oligodendrocyte glycoprotein (MOG) or immunogenic peptides derived from MOG, emulsified in complete Freud’s adjuvant (CFA) leads to immune-mediated demyelination and symptoms mimicking those of multiple sclerosis.
- Fabs may be chemically conjugated or recombinantly expressed with MOG or MOG peptides to assess prevention and treatment of EAE.
- extracellular vesicles will be isolated as described above from B ALB/c mice, which express the H2-K d haplotype of major histocompatibility molecules (MHC).
- MHC major histocompatibility molecules
- Fab will be conjugated to extracellular vesicles as described above.
- Fab-EV will be injected into C57B1/6J mice, which express the H2-K b haplotype of MHC, serving as a complete MHC mismatch.
- Tail skin from Balb/c mice will be transplanted onto the flank of C57B1/6J mice that previously received Fab-EV. Grafts will be checked daily for signs of necrosis or rejection. Grafts will be considered rejected if they are over 20% necrotic or if they fall off. Grafts will be considered accepted if they remain 60 days after transplantation.
- compositions of the disclosure are administered at a therapeutically effective dosage, e.g. , a dosage sufficient to provide treatment for the disease states previously described.
- Administration of the compounds of the disclosure can be via any of the accepted modes of administration for agents that serve similar utilities.
- mice the doses in mice are from the about 2.5 pg to 200 pg/gram body weight.
- an individual human dose is from about 0.01 to 2.0 mg/kg of body weight, about 0.1 to 1.5 mg/kg of body weight, or about 0.3 to 1.0 mg/kg of body weight, depending on the embodiment, or any dose between those listed, including the endpoints.
- Treatment can be administered for a single day or a period of days, and can be repeated at intervals of several days, one or several weeks, or one or several months.
- Administration can be as a single dose (e.g, as a bolus) or as an initial bolus followed by continuous infusion of the remaining portion of a complete dose over time, e.g, 1 to 7 days.
- the amount of active compound administered may, depending on the embodiment, be dependent on any or all of the following: the subject and disease state being treated, the severity of the affliction, the manner and schedule of administration and the judgment of the prescribing physician. It will also be appreciated that amounts administered may depend upon the molecular weight of the antigen, antibody, antibody fragment or ligand as well as the size of the linker, which may vary from embodiment to embodiment.
- compositions of the disclosure can be administered either alone or in combination with other pharmaceutically acceptable excipients. While all typical routes of administration are contemplated, several embodiments provide for liquid dosage forms suitable for injection.
- the formulations may include a conventional pharmaceutical carrier or excipient and a composition of the disclosure or a pharmaceutically acceptable salt thereof.
- compositions can include other medicinal agents, pharmaceutical agents, carriers, and the like, including, but not limited to the therapeutic protein, peptide, antibody or antibody-like molecule corresponding to the antigen (X) employed in the composition of the disclosure, and other active agents that can act as immune- modulating agents and more specifically can have inhibitory effects on B-cells, including anti folates, immune suppressants, cytostatics, mitotic inhibitors, and anti-metabolites, or combinations thereof.
- active agents that can act as immune- modulating agents and more specifically can have inhibitory effects on B-cells, including anti folates, immune suppressants, cytostatics, mitotic inhibitors, and anti-metabolites, or combinations thereof.
- the pharmaceutically acceptable composition will contain about 0.1% to 95%, or about 0.5% to 50%, by weight of a composition of the disclosure, the remainder being suitable pharmaceutical excipients, carriers, etc. Dosage forms or compositions containing active ingredient in the range of 0.005% to 95% with the balance made up from non-toxic carrier can be prepared.
- Liquid pharmaceutically administrable compositions can, for example, be prepared by dissolving, dispersing, etc. an active composition of the disclosure (e.g, a lyophilized powder) and optional pharmaceutical adjuvants in a carrier, such as, for example, water (water for injection), saline, aqueous dextrose, glycerol, glycols, ethanol or the like, to thereby form a solution or suspension.
- a carrier such as, for example, water (water for injection), saline, aqueous dextrose, glycerol, glycols, ethanol or the like, to thereby form a solution or suspension.
- the pharmaceutical composition to be administered can also contain minor amounts of nontoxic auxiliary substances such as wetting agents, emulsifying agents, stabilizing agents, solubilizing agents, pH buffering agents and the like, for example, sodium acetate, sodium citrate, cyclodextrine derivatives, sorbitan monolaurate, triethanolamine acetate and triethanolamine oleate, etc., osmolytes, amino acids, sugars and carbohydrates, proteins and polymers, salts, surfactants, chelators and antioxidants, preservatives, and specific ligands. Actual methods of preparing such dosage forms are known, or will be apparent, to those skilled in this art.
- the composition or formulation to be administered will, in any event, contain a quantity of the active compound in an amount effective to treat the symptoms of the subject being treated.
- a thrombin-cleavable site followed by a (His)6 tag was included to enable protein purification on a Ni-NTA column.
- the entire sequence was cloned into the pHEK293 ETltra expression vector (Takara).
- the plasmid was transfected into HEK suspension cells seeded at 1 million cells per mL. After 6-8 days of culture, supernatant was harvested, passed through a 0.22 mM filter, and purified on an HisTrap column on the Akta pure 25 M system (GE Healthcare).
- the phage library used was kindly provided by Anthony Kossiakoff at the University of Chicago.
- the library consists of humanized Fab based on the anti-HER2 antibody 4D5.
- CDR complementarity determining regions
- CDR-L1 and CDR-L2 from the light chain are constant, CDR-L3, CDR-H1, and CDR-H2 have limited diversity, and CDR-H3 is completely randomized.
- the actual diversity of the library is 3 x 10 10 , which can cover a broad range of targets.
- Eluted phages were incubated with 5 mL of XL1 Blue with M13-K07 helper phage overnight at 37 °C to propagate the phage.
- Cells were pelleted and supernatant containing phage was kept.
- PEG-NaCl (20% PEG 8k, 2.5 M NaCl) was added to supernatant at equal volumes to precipitate phage.
- Phage was centrifuged and suspended in PBST-BSA for the next round of panning. For subsequent panning, KingFisher plates were used with the KingFisher device in a plate setup as demonstrated in FIG. 1.
- the first row included streptavidin beads (Dynabeads) with 300 nM, 150 nM, 75 nM, or 20 nM biotinylated LSECtin variants, corresponding to the second, third, fourth, and fifth rounds of display.
- the next well row contained phage and 2 mM biotinylated SNAP protein, to remove potential SNAP binders.
- the following row contained 1 mM biotin to saturate biotin sites on the streptavidin beads.
- the following 4 rows contained 1 mM SNAP to wash.
- the last row contained thrombin, to elute phage. All steps contained TBS + 10 mM CaCb. Eluted phage was incubated with XL1, helper phage, and ampicillin overnight at 37 °C.
- PHAGE SEQUENCING [0160] After 5 rounds of panning on each of the three LSECtin variants, XL1 with phage was plated on LB-agar plates supplemented with ampicillin. Single clones were grown overnight at 37 °C in 96 deep well plates in 400 pL 2XYT supplemented with 100 pg/mL ampicillin and M13-K07 helper phage. Three plates corresponding to panning on the three variants of LSECtin were sent to the DNA Sequencing Core Facility at the ETniversity of Chicago.
- Ligated product was transfected into Stellar competent cells and plated on LB-agar plates supplemented with ampicillin. Single clones were sequenced to confirm proper ligation.
- Fab-pSFV4 plasmids were transfected into BL21-DE3 in overnight cultures of 5 mL in 2XYT supplemented with ampicillin.
- E. coli was grown up in a 1L volume in a 4L flask of 2XYT supplemented with 100 pg/mL ampicillin until an optical density of 0.6 - 0.8 was achieved. Protein expression was then induced by 1 mM Isopropyl b-D-l-thiogalactopyranoside for four hours.
- Cells were harvested by centrifugation and stored at -20 °C. The following day cell pellets from were suspended in 30 mL phosphate buffered saline supplemented with protease inhibitors and benzonase and sonicated on ice. Lysate was spun down at 10,000 RPM to remove debris, and supernatant was incubated with Protein G resin provided by Anthony Kossiakoff for 1 hour at 4 °C. Resin was spun down at 1000 RPM for 2 minutes, and subsequently washed with phosphate buffered saline. Resin was washed with 30 column volumes of phosphate buffered saline with 500 mM NaCl.
- Fabs were eluted with 100 mM glycine, pH 2.6.
- Fabs were neutralized with 1 M Tris- HC1, pH 8, and dialyzed overnight against 5 L phosphate buffered saline.
- Assays involving in vivo use of Fabs once Fabs were eluted with 100 mM glycine pH 2.6 they underwent cation exchange chromatography to remove endotoxin. In brief, Fabs were applied to HiTrap column (GE Healthcare) and washed with 50 mM sodium acetate buffer, pH 4.5.
- Fabs were eluted with a gradient up to 600 mM NaCl in 50 mM sodium acetate buffer, pH 4.5. Fractions were pooled and dialyzed against 5 L of PBS. After dialysis, samples were concentrated with 10,000 molecular weight cutoff ultracentrifugal filters (Amicon).
- LSECs were isolated from mouse livers as previously described (Meyer et al., Exp. Cell Res. 349:291-301, 2016). Briefly, mice were sacrificed and catheter was inserted in the inferior vena cava. The liver was perfused with 25 mL of calcium-free HBSS supplemented with 12.5 pmol EGTA, 125 units heparin, 62.5 pL 40% glucose, 625 pmol HEPES, and 1% penicillin/streptomycin.
- liver To digest the liver, it was then perfused under a heating lamp with IMDM supplemented with GlutaMax, 25 mg Collagenase IV (Worthington) and 2 pg DNAse I (Sigma). Liver was excised and cells were immediately removed in a petri dish and passed through a 70 pM cell strainer. Cells were centrifuged at 68 x g to remove pelleted hepatocytes. Supernatant was centrifuged at 600 x g to pellet all remaining cells. Cells were suspended in 10 mL of DMEM.
- a two-step Percoll gradient was created by placing 20 mL of 50% Percoll as the bottom layer, 20 mL of 25% Percoll as top layer, and layering 10 mL of cell suspension on top. Cells were immediately spun at 1350 x g with no brake. The resulting layer of cells between the two gradients was taken and washed with PBS. Cells were first stained with Live/Dead Viability Dye (Invitrogen) and Fc block (BD). Cells were washed with PBS + 2% FBS. Cells were stained for CD31, Stabilin II, and CD45 and with 5 pg/mL Fab for 30 minutes at 4 °C.
- mice were injected with 40 picomoles of YEE- SIINFEKL(‘ YEEW A Y Y S SEM AF’ -‘ SIINFEKL’ ( SEQ ID NO: 117), YEE-ISQ (‘ YEEW A Y Y S SEMAF’-‘IS Q A VH AAH AEINE AGRE V V G’ (SEQ ID NO: 118), free SIINFEKL (SEQ ID NO: 115) peptide, free ISQ peptide, or saline.
- mice were challenged with either 10 pg of ovalbumin with 50 ng of lipopolysaccharide in the footpad or saline (naive control). Mice were sacrificed at day 18 and lymph nodes and spleen were analyzed, as seen in FIG. 6A-B, for numbers of OTI and OTII cells, ability to synthesize effector molecules (e.g, interferon gamma) upon restimulation with antigen, and markers of exhaustion or tolerance.
- effector molecules e.g, interferon gamma
- Anti-LSECtin Fab may be recombinantly expressed with, or chemically conjugated to, an autoimmune antigen or derivative thereof for induction of tolerance to said autoimmune antigen.
- an autoimmune antigen or derivative thereof for induction of tolerance to an immunodominant epitope of myelin oligodendrocyte protein, a major immune target of multiple sclerosis, MOG30-60 may be recombinantly expressed with the Fab, for example on the C terminus of the heavy chain of the Fab, but also may be expressed on other locations in the Fab that do not disrupt binding to LSECtin.
- the antigen expressed will include the natural cleavage sites in the protein, as was done above for immunodominant epitopes of ovalbumin, such that the immunogenic epitope will be processed and presented as would occur naturally. This may be done for any autoimmune antigen.
- Anti-LSECtin Fab may be conjugated to extracellular vesicles for induction of tolerance to those antigens on the extracellular vesicle, for example for induction of tolerance to major histocompatibility complexes. This may be done by chemical conjugation or by a variety of other methods as described above.
- An example of a conjugation strategy is that Fabs may be recombinantly expressed to include a cysteine, which has a free thiol.
- Sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-l-carboxylate may be used to react its maleimide on the one hand with the free thiol on the Fab, and the NHS-ester on the other hand with free amines on the extracellular vesicles.
- mice were perfused with Hank’ s Buffered Salt Solution followed by zinc fixative to fix the liver. Livers were fixed overnight in zinc fixative, transferred to a 10% sucrose solution for 24 hours at 4°C, and then to a 30% sucrose solution for 24 hours at 4°C. Livers were flash frozen and cryosectioned. Sections were stained with Al Al anti-LSECtin Fab or irrelevant Fab control overnight, and rat anti-mouse Stabilin 2 (MBL International) at 4°C in 0.5% casein in TBST.
- MBL International rat anti-mouse Stabilin 2
- Sections were washed and stained with anti-human F(ab)2 Alexa Fluor 594 (Jackson Immunoresearch) and anti-rat Alexa Fluor 488 secondary antibodies for 1 hour at room temperature in 0.5% casein in TBST. Sections were mounted with ProLong Gold Antifade Mountant with DAPI (Life Technologies) and imaged on an Olympus confocal microscope. Data are shown in FIG. 7.
- (B) Mouse sections stained with A1A1 and imaged with 20x magnification.
- C Monkey sections stained with Al Al and imaged with 60x magnification.
- LSECs were isolated from mice as described above and sorted based on the expression of CD31 and Stabilin 2 and lack of CD45 and F4/80.
- FIG. 8A Fab was recombinantly expressed with mCherry on the heavy chain. Fab-mCherry was added to LSECs at 4°C for 20 minutes and washed to remove excess Fab. LSECs were incubated at 37°C to allow for endocytosis and subsequently stained with an anti-Fab antibody.
- FIG. 8B LSECs were incubated with AlAl-mCherry or irrelevant Fab-mCherry 2 hours at 37°C and the flourescence intensity of mCherry was measured by flow cytometry.
- the enhanced signal detected and shown in Fig. 8B indicate that Fab are taken up ( e.g ., endocytosed) by LSECs, which further indicates that the tolerogenic compositions disclosed herein would be internalized by the LSECs (through binding to LSECtin), leading to processing of the antigen by the immune system to be recognized as self - thus inducing tolerance to the antigen.
- FIG. 8A shows the imaging data that demonstrates that Fab A1A1 yields highly specific localization to the liver, in contrast to a Fab of irrelevant specificity.
- Fab D3C9 also demonstrated localization to the liver in vivo.
- RNAseq data reveals that the most prevalent cathepsins in LSECs are cathepsin L and cathepsin B (Ding et al., Mol Cell Proteomics 15:3190-202, 2016). Potential sequences were obtained from Sudo et al who performed mass spectrometry on peptide isolates after incubation of cells with the respective cathepsins and identified predicted cathepsin specificities (Sudo et al., J Control Release 255: 1-11, 2017).
- Fabs were designed to have a Gly 4 Ser linker, cathepsin cleaveable sequence, and payload (OVA or mCherry).
- OVA OVA or mCherry
- proteins were incubated at 0.2 pg/mL with 1 : 100 mouse cathepsin L in pH 6 or pH 7.5 for varying time points at 37°C.
- Fabs were designed to include endosomal escape peptides. After Fab internalization and delivery to cytosolic compartments, endosomal escape peptides would enable Fab-payload release from the endosome, transfer to cytoplasm, and degradation by the proteasome. This would lead to enhanced presentation on class I MHC.
- INF7 a variant of the HA2 fusogenic peptide derived from influenza hemagglutinin, was chosen as it has been widely demonstrated to enhance endosomal escape (Plank et ah, Journal of Biological Chem, 1994).
- cathepsin cleaveable linkers were added along with escape peptides so that if the escape peptide is bound to membrane, cathepsins will be able to cleave payload and it may be released into the cytoplasm.
- various linkers such as SPDP may be used to join Fab, payload, and endosomal escape peptide such that the linkers would be reduced in an endosome or lysosome and the payload released from the escape peptide.
- Fabs will be recombinantly expressed with the aforementioned sequences (Example 12) and mCherry as payload.
- LSECs will be isolated as described above and cultured on glass coverslips. LSECs will be incubated with Fab-EEP -mCherry variants for 20 minutes at 4°C. LSECs will then be incubated at 37°C for 1 hour, washed, fixed in 2% paraformaldehyde, stained with markers of early and late endosomal compartments, and imaged using a confocal microscope.
- An escape peptide will be considered effective if mCherry is no longer seen colocalizing with endosomal markers but rather diffuse in the cytoplasm.
- LSECs will be isolated, pulsed with Fab-mCherry endosomal escape variants, and live imaged with a lattice lightsheet microscope to observe live escape from endosomal compartments.
- LSECs will be isolated and cultured. LSECs will be pulsed with 100 pg/mL Fab-OVA cathepsin and endosomal escape variants for 12-16 hours, and stained with an anti-H2-Kb-SIINFEKL antibody which recognizes CD8 immunodominant epitope SIINFEKL presented on class I MHC.
- OTI and OTII T cells which recognize the CD8 and CD4 epitopes of ovalbumin presented on class I MHC and class II MHC, respectively, will be added to LSECs pulsed with Fab-OVA variants and assessed for proliferation and markers of activation.
- actions such as“administering an L SEC tin-binding protein” include“instructing the administration of an LSECtin-binding protein.”
- actions such as“administering an L SEC tin-binding protein” include“instructing the administration of an LSECtin-binding protein.”
- sequence“comprises”,“consists of’ or“consists essentially of’ the recited sequence.
- the indefinite article“a” or“an” does not exclude a plurality.
- the term“about” as used herein to, for example, define the values and ranges of molecular weights means that the indicated values and/or range limits can vary within ⁇ 20%, e.g., within ⁇ 10%.
- the use of “about” before a number includes the number itself.
- “about 5” provides express support for“5”.
- Numbers provided in ranges include overlapping ranges and integers in between; for example a range of 1-4 and 5-7 includes for example, 1-7, 1-6, 1-5, 2-5, 2-7, 4-7, 1, 2, 3, 4, 5, 6 and 7.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Public Health (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Transplantation (AREA)
- Rheumatology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/733,657 US20210171642A1 (en) | 2018-03-26 | 2019-03-26 | Methods and compositions for targeting liver and lymph node sinusoidal endothelial cell c-type lectin (lsectin) |
| EP19774313.1A EP3774890A4 (en) | 2018-03-26 | 2019-03-26 | METHODS AND COMPOSITIONS FOR THE TARGETING OF C-TYPE LECTIN FROM SINUSOIDAL ENDOTHELIAL CELLS OF THE LIVER AND LYMPH NODES (LSECTIN) |
| JP2020551882A JP2021519305A (ja) | 2018-03-26 | 2019-03-26 | 肝臓およびリンパ節の類洞内皮細胞C型レクチン(LSECtin)を標的とするための方法および組成物 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862647911P | 2018-03-26 | 2018-03-26 | |
| US62/647,911 | 2018-03-26 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019191079A1 true WO2019191079A1 (en) | 2019-10-03 |
Family
ID=68060405
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/024052 Ceased WO2019191079A1 (en) | 2018-03-26 | 2019-03-26 | Methods and compositions for targeting liver and lymph node sinusoidal endothelial cell c-type lectin (lsectin) |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US20210171642A1 (https=) |
| EP (1) | EP3774890A4 (https=) |
| JP (1) | JP2021519305A (https=) |
| WO (1) | WO2019191079A1 (https=) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10800838B2 (en) | 2010-08-10 | 2020-10-13 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
| US10821157B2 (en) | 2014-02-21 | 2020-11-03 | Anokion Sa | Glycotargeting therapeutics |
| US10919963B2 (en) | 2010-08-10 | 2021-02-16 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
| US10940209B2 (en) | 2014-02-21 | 2021-03-09 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
| US10946079B2 (en) | 2014-02-21 | 2021-03-16 | Ecole Polytechnique Federale De Lausanne | Glycotargeting therapeutics |
| US10953101B2 (en) | 2014-02-21 | 2021-03-23 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
| US11246943B2 (en) | 2010-08-10 | 2022-02-15 | École Polytechnique Fédérale De Lausanne (Epfl) | Antigen-specific tolerance and compositions for induction of same |
| US11253579B2 (en) | 2017-06-16 | 2022-02-22 | The University Of Chicago | Compositions and methods for inducing immune tolerance |
| US12383617B2 (en) | 2018-05-09 | 2025-08-12 | The University Of Chicago | Compositions and methods concerning immune tolerance |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113710229B (zh) | 2019-02-25 | 2026-01-06 | 芝加哥大学 | 用与抗炎剂连接的ecm亲和肽治疗炎症性和自身免疫性病症的方法和组合物 |
| KR20250005069A (ko) * | 2022-02-18 | 2025-01-17 | 더 유니버서티 오브 시카고 | 성장호르몬 수용체 표적 폴리펩티드 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110123536A1 (en) * | 2007-03-22 | 2011-05-26 | Urrma R&D | Novel human anti-r7v antibodies and uses thereof |
| US20130059299A1 (en) * | 2008-03-28 | 2013-03-07 | Mitomics Inc. | Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefore |
| WO2017044308A1 (en) * | 2015-09-10 | 2017-03-16 | Albert Einstein College Of Medicine, Inc. | Synthetic antibodies to bax and uses thereof |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080171059A1 (en) * | 2006-08-07 | 2008-07-17 | Shanshan Wu Howland | Methods and compositions for increased priming of t-cells through cross-presentation of exogenous antigens |
-
2019
- 2019-03-26 WO PCT/US2019/024052 patent/WO2019191079A1/en not_active Ceased
- 2019-03-26 EP EP19774313.1A patent/EP3774890A4/en not_active Withdrawn
- 2019-03-26 JP JP2020551882A patent/JP2021519305A/ja active Pending
- 2019-03-26 US US15/733,657 patent/US20210171642A1/en not_active Abandoned
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110123536A1 (en) * | 2007-03-22 | 2011-05-26 | Urrma R&D | Novel human anti-r7v antibodies and uses thereof |
| US20130059299A1 (en) * | 2008-03-28 | 2013-03-07 | Mitomics Inc. | Aberrant mitochondrial dna, associated fusion transcripts and translation products and hybridization probes therefore |
| WO2017044308A1 (en) * | 2015-09-10 | 2017-03-16 | Albert Einstein College Of Medicine, Inc. | Synthetic antibodies to bax and uses thereof |
Non-Patent Citations (3)
| Title |
|---|
| DOMINGUEZ-SOTO ET AL.: "The DC-SIGN-related lectin LSECtin mediates antigen capture and pathogen binding by human myeloid cells", BLOOD, vol. 109, no. 12, 15 June 2007 (2007-06-15), pages 5337 - 5345, XP002549381, DOI: 10.1182/blood-2006-09-048058 * |
| KONTOS ET AL.: "Engineering antigen-specific immunological tolerance", CURRENT OPINION IN IMMUNOLOGY, vol. 35, August 2015 (2015-08-01), pages 80 - 88, XP055640544 * |
| See also references of EP3774890A4 * |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11246943B2 (en) | 2010-08-10 | 2022-02-15 | École Polytechnique Fédérale De Lausanne (Epfl) | Antigen-specific tolerance and compositions for induction of same |
| US12060414B2 (en) | 2010-08-10 | 2024-08-13 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
| US10919963B2 (en) | 2010-08-10 | 2021-02-16 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
| US10800838B2 (en) | 2010-08-10 | 2020-10-13 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
| US11884721B2 (en) | 2010-08-10 | 2024-01-30 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
| US10940209B2 (en) | 2014-02-21 | 2021-03-09 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
| US10953101B2 (en) | 2014-02-21 | 2021-03-23 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
| US11654188B2 (en) | 2014-02-21 | 2023-05-23 | Ecole Polytechnique Federale De Lausanne (Epfl) | Glycotargeting therapeutics |
| US11666638B2 (en) | 2014-02-21 | 2023-06-06 | Ecole Polytechnique Federale De Lausanne (Epfl) | Glycotargeting therapeutics |
| US11793882B2 (en) | 2014-02-21 | 2023-10-24 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
| US11801305B2 (en) | 2014-02-21 | 2023-10-31 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
| US10946079B2 (en) | 2014-02-21 | 2021-03-16 | Ecole Polytechnique Federale De Lausanne | Glycotargeting therapeutics |
| US10821157B2 (en) | 2014-02-21 | 2020-11-03 | Anokion Sa | Glycotargeting therapeutics |
| US11253579B2 (en) | 2017-06-16 | 2022-02-22 | The University Of Chicago | Compositions and methods for inducing immune tolerance |
| US12383617B2 (en) | 2018-05-09 | 2025-08-12 | The University Of Chicago | Compositions and methods concerning immune tolerance |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3774890A4 (en) | 2022-05-04 |
| JP2021519305A (ja) | 2021-08-10 |
| EP3774890A1 (en) | 2021-02-17 |
| US20210171642A1 (en) | 2021-06-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20210171642A1 (en) | Methods and compositions for targeting liver and lymph node sinusoidal endothelial cell c-type lectin (lsectin) | |
| US20250059263A1 (en) | Erythrocyte-binding therapeutics | |
| US20220125945A1 (en) | Compositions and methods for inducing antigen-specific tolerance | |
| US20240279330A1 (en) | Erythrocyte-binding therapeutics | |
| AU2017276218B2 (en) | Erythrocyte-binding therapeutics | |
| JP2021059563A (ja) | アントラサイクリン誘導体を含む、結合タンパク質薬物複合体(Binding protein drug conjugates) |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19774313 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2020551882 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2019774313 Country of ref document: EP Effective date: 20201026 |