WO2019190022A1 - 단백질-단백질 결합체를 형성 매개 펩타이드 및 이를 이용한 단백질-단백질 결합체 형성 방법 - Google Patents

단백질-단백질 결합체를 형성 매개 펩타이드 및 이를 이용한 단백질-단백질 결합체 형성 방법 Download PDF

Info

Publication number
WO2019190022A1
WO2019190022A1 PCT/KR2018/014818 KR2018014818W WO2019190022A1 WO 2019190022 A1 WO2019190022 A1 WO 2019190022A1 KR 2018014818 W KR2018014818 W KR 2018014818W WO 2019190022 A1 WO2019190022 A1 WO 2019190022A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
seq
amino acid
acid sequence
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2018/014818
Other languages
English (en)
French (fr)
Inventor
이지오
이혜림
김지원
조근영
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Korea Advanced Institute of Science and Technology KAIST
Original Assignee
Korea Advanced Institute of Science and Technology KAIST
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Korea Advanced Institute of Science and Technology KAIST filed Critical Korea Advanced Institute of Science and Technology KAIST
Publication of WO2019190022A1 publication Critical patent/WO2019190022A1/ko
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/305Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F)
    • C07K14/31Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F) from Staphylococcus (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • the present invention relates to a protein-protein conjugate forming mediated peptide and a method for forming a protein-protein conjugate using the same.
  • Bioconjugation is a technology that combines two molecules containing at least one biomaterial and plays an important role in the development of effective vaccines, affinity substrates, drug delivery systems, and the like.
  • ADC antibody-drug conjugates
  • ADC is a technology that focuses on targeting a specific cell to a drug by taking full advantage of the antibody. It consists of three components: the drug, a monoclonal antibody, and a linker that links the antibody to the drug.
  • ADCs are most commonly used to deliver anticancer agents to tumor cells using antibodies that specifically bind to specific antigens expressed on the surface of cancer cells.
  • protein-protein conjugation is used as a method for discovering a target protein for drug development.
  • proteins function through binding to other proteins. Changes in protein expression, changes in cell position, and structural changes through post-translational modification lead to changes in protein binding. Since the abnormalities in protein interactions caused by these changes are associated with diseases, identification of protein interactions using protein-protein binding and discovery of target proteins related to diseases based on these are important processes for drug development.
  • Split inteins also perform protein trans-splicing, a naturally occurring process in living organisms, which is a multistage biochemical reaction consisting of cleavage and formation of peptide bonds. Specifically, two protein fragments including the split intein are combined to form an enzyme, followed by a process of removing the intein itself and catalyzing the linking of the flanking sequence.
  • Intein is functional in exogenous environments and can be used to chemically manipulate virtually any polypeptide backbone, which has been applied to basic biological research as well as in therapeutic development (Shah, NH & Muir, TW, Chem. Sci). 5, 446-461 (2014). Bonds formed through such a reaction are known to be fairly stable bonds, such as being resistant to proteases.
  • the present inventors specifically bind to a variant of human-derived 3LRH intrabody and a variant of 3LRH intrabody to remove a factor that can induce an immune response in forming bioconjugation.
  • the present invention was completed by making peptides that form a protein and confirming that they can mediate specific and firm binding of two or more proteins.
  • the present invention provides a protein comprising an amino acid sequence represented by SEQ ID NO: 6 or SEQ ID NO: 10.
  • the present invention also provides a polynucleotide encoding the protein.
  • the present invention includes 1) a first fusion protein comprising a peptide consisting of the amino acid sequence of SEQ ID NO: 6 and a first target protein, and a peptide consisting of the amino acid sequence of SEQ ID NO: 10 and a second target protein. Preparing a second fusion protein; And 2) mixing the first fusion protein and the second fusion protein to form a bond between the first fusion protein and the second fusion protein. ) Provides a formation method.
  • the present invention also provides a conjugate of the first target protein and the second target protein formed by the method for forming a conjugate of the first target protein and the second target protein.
  • the present invention can form a conjugate of a first target protein and a second target protein using a peptide consisting of an amino acid sequence of SEQ ID NO: 6 or SEQ ID NO: 10, which is a protein derived from human, Binding using a peptide consisting of the amino acid sequence set forth in No. 10 is specific for binding in an antigen-antibody reaction and can form a strong bond including disulfide bonds, thereby forming a conjugate of the first target protein and the second target protein. It can be usefully used.
  • Figure 1 shows the docking of the huntingtin peptide-3LRH antibody structure and protein A using a molecular modeling program.
  • Figure 2 shows the amino acid sequence of the overlapping regions of the huntingtin peptide and protein A and the amino acid sequence of the engineered epitope of # 8188 protein A.
  • Figure 3 shows the alignment of the helix (helice) of the protein A and huntingtin peptide (red color is the huntingtin amino acid, gray is the amino acid of the protein A domain).
  • FIG. 4 shows the amino acid sequence in which cysteine is introduced into 3LRH cys antibody and # 8188 protein A for disulfide bridge formation between 3LRH cys antibody and # 8188 cys protein A.
  • FIG. 5 shows the crystal structure of 3LRH antibody and # 8188 Protein A.
  • FIG. 6 is an enlarged view of the engineered epitope portion of # 8188 Protein A of FIG. 5 (amino acid residues of # 8188 Protein A and huntingtin peptide interacting with 3LRH antibody in gray and red, respectively).
  • FIG. 7 compares the structure of native protein A and engineered protein A, # 8188 protein A.
  • FIG. 8 shows the results of SDS-PAGE analysis for confirming disulfide bridge formation of 3LRH cys antibody and # 8188 cys protein A.
  • Figure 9 shows the crystal structure of # 8188 cys protein A bound to the 3LRH cys antibody (disulfide bridge is indicated by a yellow line, electron density map around the disulfide bridge is represented by a gray mesh).
  • the present invention provides a protein comprising the amino acid sequence set forth in SEQ ID NO: 6 or SEQ ID NO: 10.
  • the protein preferably comprises an amino acid sequence represented by SEQ ID NO: 6 or SEQ ID NO: 10 at the N-terminus, internal or C-terminus, but is not limited thereto.
  • the protein may be a fusion protein of the amino acid sequence set forth in SEQ ID NO: 6 or SEQ ID NO: 10 with any desired protein.
  • the peptide consisting of the amino acid sequence described in SEQ ID NO: 6 is a 3LRH cys antibody which is a variant of the 3LRH antibody, in the present invention, the 3LRH antibody binds to a short alpha helix peptide present in the human huntingtin protein, SEQ ID NO: An immunoglobulin light chain composed of the amino acid sequence set forth in 1.
  • the 3LRH cys antibody is a mutated tyrosine (Y), the 53rd amino acid of the 3LRH antibody, to cysteine (cystein, C).
  • # 8188 protein A refers to a peptide consisting of the amino acid sequence of SEQ ID NO: 4 having a helical epitope to which the 3LRH antibody can bind
  • # 8188 cys protein A is a variant of the # 8188 protein A
  • peptide means the peptide consisting of the amino acid sequence shown in SEQ ID NO: 8.
  • the # 8188 cys protein A may be a mutated alanine (alanine, A) that is the 51st amino acid of the # 8188 protein A with cysteine (cystein, C).
  • the peptide consisting of the amino acid sequence of SEQ ID NO: 6 and the peptide consisting of the amino acid sequence of SEQ ID NO: 8 may form a bond between the peptides.
  • the region of SEQ ID NO: 46 to 59 is a region that forms a bond with the 3LRH cys antibody, and more specifically, described in SEQ ID NO: 9 Among the amino acid sequences, the 2nd (K, lysine), 6th (C, cysteine), 9th (S, serine), 10th (L, leucine) and 13th (F, phenylalanine) amino acids are combined with 3LRH cys antibody.
  • amino acid sequences set forth in SEQ ID NO: 9 2nd (K, lysine), 6th (C, cysteine), 9th (S, serine), 10th (L, leucine) and 13th (F, phenylalanine) amino acids
  • Peptides consisting of the amino acid sequence set forth in SEQ ID NO: 10, conserved only, may form a bond with the 3LRH cys antibody. If the amino acid sequence of the region of the protein that binds the antibody in the protein is preserved, the specific amino acids directly involved in the binding of the antibody toward the antibody, and if the remaining amino acid sequence is replaced with another amino acid, the binding force similar to the original antigen-antibody binding Can be combined.
  • amino acid sequence described in SEQ ID NO: 10 may be an amino acid sequence described in SEQ ID NO: 9.
  • the present invention also provides a polynucleotide encoding the protein.
  • the polynucleotide encoding the peptide may be the nucleotide sequence of SEQ ID NO: 7.
  • the polynucleotide encoding the peptide may be the nucleotide sequence of SEQ ID NO: 11, but is not limited thereto. no.
  • the present inventors prepared # 8188 protein A into which a spiral epitope into which protein 3A binds 3LRH antibody was introduced. Specifically, the alignment of the helices of protein A and huntingtin peptides is directed to amino acids (K47 (not shown), E50, S51, P54 (not shown) and K55 (not shown) directed toward 3LRH antibodies in protein A and important for binding to the antibody). 3), and the amino acids of protein A were replaced with the corresponding amino acids of the huntingtin peptide to prepare # 8188 protein A with engineered epitopes (FIG. 2 and table). 2).
  • # 8188 protein A and the 3LRH antibody form a complex, and the complex is substantially identical to the structure of the complex of the original huntingtin peptide-3LRH antibody that binds by antigen-antibody reaction ( 5 to 7).
  • the 3LRH cys antibody mutated tyrosine (Y), the 53rd amino acid tyrosine (Y) of the 3LRH antibody that binds to the short alpha helix peptide present in the human huntingtin protein (cystein, C) # 8188 cys protein A was prepared by mutating alanine (A), the 51st amino acid of # 8188 protein A having a helical epitope to which 3LRH antibodies can bind (cystein, C) (Table 1). 3 and Table 4).
  • the inventors prepared a complex of 3LRH cys antibody- # 8188 cys antigen protein using 3LRH cys antibody and # 8188 cys protein A (see FIG. 4).
  • the inventors of the SDS-PAGE analysis confirmed that the disulfide bridge between the 3LRH cys antibody and # 8188 cys protein A was formed in the non-reducible gel to shift the band.
  • the electron density map It was confirmed that the disulfide bridge is formed through (see FIGS. 8 and 9).
  • the peptide consisting of the amino acid sequence represented by SEQ ID NO: 6 or SEQ ID NO: 8 is derived from human beings and does not have side effects such as inducing an immune response, and the binding between the peptides can be specifically bound because they bind by antigen-antibody reactions.
  • a disulfide bond can form a strong bond, it can be used as a useful system for bioconjugation between fusion proteins containing each of these peptides.
  • the present invention includes 1) a first fusion protein comprising a peptide consisting of the amino acid sequence of SEQ ID NO: 6 and a first target protein, and a peptide consisting of the amino acid sequence of SEQ ID NO: 10 and a second target protein. Preparing a second fusion protein; And 2) mixing the first fusion protein and the second fusion protein to form a bond between the first fusion protein and the second fusion protein. ) Provides a formation method.
  • target protein means a protein or peptide to be conjugated, and may be included without limitation in kind or size as long as it is a protein or peptide.
  • fusion protein is an artificially synthesized protein in which two or more proteins or peptides are linked to each other, and specifically, a peptide composed of the target protein and the amino acid sequence described in SEQ ID NO: 6 or SEQ ID NO: 10 of the present invention. It may include.
  • first fusion protein refers to a fusion protein comprising a peptide (3LRH cys antibody) consisting of an amino acid sequence represented by SEQ ID NO: 6 and a first target protein
  • second fusion protein refers to SEQ ID NO: 10. It means a fusion protein comprising a peptide consisting of the amino acid sequence described as and the second target protein.
  • the peptide consisting of the amino acid sequence set forth in SEQ ID NO: 6 may be present at the N-terminus, internal or C-terminus of the first target protein sequence.
  • the peptide consisting of the amino acid sequence set forth in SEQ ID NO: 10 may be present at the N-terminus, internal or C-terminus of the sequence of the second target protein.
  • the "conjugate of the first target protein and the second target protein” is to prepare the first fusion protein and the second fusion protein in order to bind any first target protein and the second target protein.
  • the conjugate is between a peptide consisting of the amino acid sequence of SEQ ID NO: 6 contained in the first fusion protein (3LRH cys antibody) and a peptide consisting of the amino acid sequence of SEQ ID NO: 10 contained in the second fusion protein. It is formed by a bond.
  • the fusion protein may be prepared by a chemical synthesis method known in the art, or by cloning and expressing a polynucleotide encoding the fusion protein in an expression vector.
  • the binding of step 2) may be a bond between the peptide consisting of the amino acid sequence of SEQ ID NO: 6 and the peptide consisting of the amino acid sequence of SEQ ID NO: 10.
  • the binding between the peptides may be bound by an antigen-antibody reaction.
  • the binding between the peptides may further include a disulfide bond to the one bound by the antigen-antibody reaction.
  • amino acid sequence described in SEQ ID NO: 10 may be an amino acid sequence described in SEQ ID NO: 9.
  • the present invention also provides a conjugate of the first target protein and the second target protein formed by the method of forming a conjugate of the first target protein and the second target protein.
  • the present inventors cloned a polynucleotide encoding 3LRH cys antibody and # 8188 cys protein A into a vector and transformed the vector into E. coli to transform the 3LRH cys antibody and # 8188 cys.
  • Protein A was prepared and a complex of 3LRH cys antibody- # 8188 cys antigen protein was prepared (see Table 3, Table 4 and FIG. 4).
  • a conjugate between the target protein is formed by binding between 3LRH cys antibody and # 8188 cys protein A. It can manufacture.
  • Polynucleotides encoding 3LRH antibodies were synthesized based on amino acid sequence information stored in a PDB database.
  • Polynucleotides encoding the 3LRH antibody (SEQ ID NO: 2) were cloned into the pET28a vector and then transformed into E. coli strain BL21 (DE3) for protein production.
  • Transformed E. coli BL21 (DE3) was inoculated in LB medium added with 50 ⁇ g / mL kanamycin and incubated at 37 ° C. When the value of OD 600 reached 0.7, 0.5 mM IPTG (Isopropyl ⁇ -D-1-thiogalactopyranoside) was added to induce protein production and incubated overnight at 21 ° C. After obtaining E.
  • the harvested cell pellets are resuspended in lysis buffer containing 20 mM Tris pH 8.0, 200 mM NaCl, and 0.5 mM PMSF, and then resuspended with a microfluidizer (Microfluidics). Homogenized. After centrifugation, the supernatant was loaded onto a Ni-NTA metal affinity column, and the buffer containing 20 mM Tris pH 8.0, 200 mM NaCl and 500 mM imidazole pH 8.0 was removed. 6XHis-tagged protein was eluted.
  • the eluted antibody protein was treated with thrombin (Sigma, Cat #. T4648) overnight.
  • the cleaved 3LRH antibody was purified by loading it on a Superdex 200 size-exclusion column (GE Healthcare) equilibrated with 20 mM Tris pH 8.0, 200 mM NaCl.
  • 3LRH antibodies bind to an alpha helical stretch of 14 amino acids in human huntingtin protein.
  • FIG. 2 shows the first 10 amino acids of the huntingtin peptide overlapped with the molecular modeling program and the last 10 amino acids of the C-terminal helix of Protein A (see FIG. 2).
  • amino acids of protein A except lysine were replaced with the corresponding amino acids of the huntingtin peptide to prepare # 8188 protein A having an engineered epitope (see FIG. 2 and Table 2). Since lysine (K47) was found at both the huntingtin peptide and the corresponding position in the protein A sequence, no change was necessary, and the 54th and 55th amino acids, the N-terminal regions of Protein A, were 13, the N-terminal region of the huntingtin peptide. To the 18th amino acid sequence.
  • Amplified # 8188 polynucleotide (SEQ ID NO: 5) was cloned into the pET28a vector and then transformed into E. coli strain BL21 (DE3) for protein production.
  • Transformed E. coli BL21 (DE3) was inoculated in LB medium added with 50 ⁇ g / mL kanamycin and incubated at 37 ° C. When the value of OD 600 reached 0.6, it was further incubated for 4 hours at 37 °C after adding 0.5 mM IPTG.
  • coli was obtained, then resuspended in lysis buffer containing 20 mM Tris pH 8.0, 200 mM NaCl and 0.5 mM PMSF and homogenized with a microfluidizer (Microfluidics). Cell suspension was removed by centrifugation and the supernatant was loaded onto a Ni-NTA chromatography column. 6XHis-tagged proteins are eluted using a buffer comprising 20 mM Tris pH 8.0, 200 mM NaCl and 500 mM imidazole pH 8.0, and the imidazole is a PD-10 desalting column (GE Healthcare). Removal was performed to obtain purified # 8188 Protein A.
  • PCR was performed using forward primer 1 (SEQ ID NO: 14) and reverse primer 1 (SEQ ID NO: 15) to obtain template 1.
  • template 2 was obtained by PCR using forward primer 2 (SEQ ID NO: 16) and reverse primer 2 (SEQ ID NO: 17). Template 1 and template 2 were simultaneously PCR with forward primer 1 and reverse primer 2 to complete overlap PCR.
  • Reverse primer 1 (SEQ ID NO: 15): ATCATCATCACACATTAATAACTCCGGGGCACGGC;
  • Forward primer 2 (SEQ ID NO: 16): TTATTAATGTGTGATGATGATTTATTAGCACCCG;
  • Reverse primer 2 (SEQ ID NO: 17): ACTACGCGGCCGCTCATGCGGACAGCACCGTAACT)
  • the polynucleotide encoding the amplified 3LRH cys antibody (SEQ ID NO: 7) was cloned into the pET28a vector, and then 3LRH cys antibody was obtained by the method described in Example 1.
  • PCR was performed with a polynucleotide encoding # 8188 protein A as a template to encode # 8188 cys protein A.
  • a polynucleotide was prepared.
  • the mutations were obtained by PCR using synthetic oligonucleotides.
  • Specific PCR procedure is as follows. 20 seconds in the denaturation step (95 ° C.) using a gene encoding protein # 8188 as a template and using a forward primer (SEQ ID NO: 18) and a reverse primer (SEQ ID NO: 19); 20 seconds in the annealing step (56 ° C.); PCR (30 cycles in total) was performed according to the 30 second condition in the extension step (72 ° C.).
  • Polynucleotides encoding the amplified # 8188 cys protein A (SEQ ID NO: 11) were cloned into the pET28a vector and then transformed into E. coli strain BL21 (DE3) for protein production.
  • Transformed E. coli BL21 (DE3) was inoculated in LB medium added with 50 ⁇ g / mL kanamycin and incubated at 37 ° C. When the value of OD 600 reached 0.6, it was further incubated for 4 hours at 37 °C after adding 0.5 mM IPTG.
  • coli was obtained, then resuspended in lysis buffer containing 20 mM Tris pH 8.0, 200 mM NaCl and 0.5 mM PMSF and homogenized with a microfluidizer (Microfluidics). Cell suspension was removed by centrifugation and the supernatant was loaded onto a Ni-NTA chromatography column. 6XHis-tagged proteins are eluted using a buffer comprising 20 mM Tris pH 8.0, 200 mM NaCl and 500 mM imidazole pH 8.0, and the imidazole is a PD-10 desalting column (GE Healthcare). Removal was carried out to obtain purified # 8188 cys protein A.
  • 3LRH cys antibody - # 8188 cys protein to produce the conjugate of A carried out in the 3LRH cys antibody and # 8188 cys protein A non-reducing environment (non-reducing conditions) to one prepared in Example 3 1: 1 molar ratio (molar ratio) Mixed at 4 ° C. overnight.
  • the complex of 3LRH antibody- # 8188 protein A prepared in Example 4 was crystallized using a crystallization solution containing 35% PEG 4000, 0.1 M MOPS pH 6.5 and 30% glycerol as a cryoprotectant. Crystals were frozen in liquid nitrogen at -170 ° C.
  • Diffraction data were collected at Pohang Accelerator Laboratory's 7A and 5C beam lines, and the package HKL2000 was used to process the diffraction data (HKL research).
  • the structure of the amino acid interacting with the 3LRH antibody is substantially the same as that of the complex of the original huntingtin peptide-3LRH antibody, and the overall structure of # 8188 Protein A and native Protein A can be overlapped with C ⁇ rmsd of 0.408 kV (FIGS. 6 and 7).
  • a disulfide bridge was formed between 3LRH cys antibody and # 8188 cys protein A, and the band was shifted. After overnight culture (16 hr), the disulfide bridge was formed at almost 100% efficiency. Was confirmed. With only # 8188 cys protein A, with no antibody to bind, homodimers were formed under non-reducing conditions.
  • Cysteine mutations can increase the stability of the complex.
  • disulfide bridges can be formed only when the two cysteines are close enough to each other, making them a convenient tool for confirming the successful design of epitopes and the formation of complexes.
  • binding of # 8188 cys protein A to 3LRH cys antibody can be rapidly monitored by non-reducing SDS-PAGE, using only minimal amounts of protein without purification.
  • the complex of 3LRH cys antibody- # 8188 cys protein A prepared in Example 5 was crystallized using a crystallization solution containing 45% PEG 4000, 0.1 M HEPES pH 7.5 and 30% glycerol as a cryoprotectant. Crystals were frozen in liquid nitrogen at -170 ° C.
  • Diffraction data were collected at Pohang Accelerator Laboratory's 7A and 5C beam lines, and the package HKL2000 was used to process the diffraction data (HKL research).
  • the electron density map clearly shows the disulfide bridge (FIG. 9).
  • the disulfide bridge is indicated by a yellow line in FIG. 9, and the electron density map around the disulfide bridge is indicated by a gray mesh. It also shows that the disulfide bridge itself does not interfere with the interaction between 3LRH cys antibody- # 8188 cys protein A.
  • 3LRH cys antibody- # 8188 cys protein A stabilized with disulfide bridges can be a useful tool for bioconjugation. Since 3LRH and # 8188 Protein A are derived from human proteins, the limitations of conventional bioconjugation methods that have been previously limited as therapeutic agents due to side effects such as immunological complications can be solved. In addition, since 3LRH cys antibody or # 8188 cys protein A is small in size, there is an advantage that it can be easily produced in large quantities as a fusion tag in E. coli .

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열을 포함하는 단백질에 관한 것으로, 구체적으로 인간 유래의 단백질인 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드를 이용하여, 제1 목적 단백질 및 제2 목적 단백질의 결합체를 형성할 수 있고, 상기 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드를 이용한 결합은 항원-항체 반응으로 결합하여 특이적이고, 이황화 결합을 포함하여 견고한 결합을 형성할 수 있으므로 제1 목적 단백질 및 제2 목적 단백질의 결합체를 형성하는 데에 유용하게 사용될 수 있다.

Description

단백질-단백질 결합체를 형성 매개 펩타이드 및 이를 이용한 단백질-단백질 결합체 형성 방법
본 발명은 단백질-단백질 결합체(conjugate) 형성 매개 펩타이드 및 이를 이용한 단백질-단백질 결합체 형성 방법에 관한 것이다.
바이오컨쥬게이션(bioconjugation)은 적어도 하나 이상의 생체물질을 포함한 두 분자를 결합시키는 기술로서, 효과적인 백신, 친화성 기질, 약물 전달 시스템 등의 개발에 중요한 역할을 한다.
가장 대표적인 바이오 컨쥬게이트(conjugate)로는 치료제로 쓰이는 항체-약물 결합체(antibody-drug conjugate, ADC)가 있다. ADC는 항체의 장점을 최대로 활용하여 약물이 특정 세포만 타켓팅하는데 초점을 맞춘 기술로, 약물, 단클론 항체, 그리고 항체와 약물을 연결하는 링커(linker)를 포함한 세 가지 구성 요소로 구성되어 있다. ADC는 주로 암 세포의 표면에 발현된 특정 항원에 특이적으로 결합하는 항체를 사용하여 항암제를 종양세포에 전달하는 데 가장 많이 이용되고 있다.
그 외에도 신약 개발을 위한 표적 단백질 발굴 방법으로, 단백질-단백질 결합(protein-protein conjugation)이 이용되고 있다. 생체 내에서 단백질은 다른 단백질과의 결합을 통해 기능을 나타낸다. 단백질의 발현 변화, 세포 내 위치의 변화, 번역 후 수식(post-translational modification)을 통한 구조의 변화는 단백질 결합의 변화를 유도하게 된다. 이러한 변화로 나타난 단백질 상호 작용의 이상은 질병과 연관되어 있기 때문에, 단백질-단백질 결합을 이용한 단백질 상호작용에 대한 규명 및 이를 기반으로 한 질병과 관련된 표적 단백질 발굴은 신약 개발에 중요한 과정이다.
단백질 성분을 결합(conjugation)시키기 위한 방법들로, 마오(Mao) 등(문헌[Mao, H., et al., J. Am. Chem. Soc. 126 (2004) 2670-2671])은 C-말단 변형을 위한, 소르타제(sortase) 매개 단백질 라이게이션(ligation) 방법을 개발하였고, 사토(Sato)(문헌[Sato, H., Advanced Drug Delivery Reviews 54 (2002) 487-504])등은 키메라 단백질 내에 부위 특이적으로 폴리에틸렌 글리콜을 도입시키기 위해, 트랜스글루타미나제(transglutaminase, TGase)를 사용하는 시스템을 정립하였다. 트랜스글루타미나아제는 글루타민 잔기의 감마-카르복사미드 그룹과 라이신의 일차 입실론 아미노 그룹 간의 아실 트랜스퍼 반응을 촉매하는 효소이다. 또한, 스플릿 인테인(split inteins)은 생물체에서 자연적으로 일어나는 과정인 단백질 트랜스-스플라이싱(protein trans-splicing)을 수행하는데, 이는 펩타이드 결합의 절단 및 형성으로 이루어진 다단계 생화학 반응이다. 구체적으로 스플릿 인테인을 포함하는 두 개의 단백질 단편이 결합하여 효소를 형성한 다음, 인테인 스스로를 삭제(excision)하고 플랭킹 서열(flanking sequence)의 연결을 촉매하는 과정을 거친다. 인테인은 외인성(exogenous) 환경에서도 기능적이며 사실상 모든 폴리펩타이드 백본을 화학적으로 조작하는 데 사용할 수 있어, 치료제 개발 분야 뿐만 아니라 기본적인 생물학적 연구에 적용되고 있다(Shah, N.H. & Muir, T.W., Chem. Sci. 5, 446-461(2014)). 상기와 같은 반응을 통해 형성된 결합은 프로테아제에 대해 내성을 가지는 등 상당히 안정한 결합으로 알려져 있다.
그러나 이러한 단백질 성분을 결합시키기 위한 방법들은 인간 기원이 아닌 단백질이 적용하기 때문에, 면역 반응을 유발할 가능성이 있어 치료제로의 적용이 제한적이다.
이에 본 발명자들은 바이오컨쥬게이션(bioconjugation)을 형성하는 데에 면역 반응을 유발할 수 있는 요인을 제거하기 위하여, 인간 유래의 단백질인 3LRH 인트라바디(intrabody)의 변이체와 3LRH 인트라바디의 변이체와 특이적인 결합을 형성하는 펩타이드를 제조하였고, 이들이 2개 이상 단백질의 특이적이고 견고한 결합을 매개할 수 있음을 확인함으로써, 본 발명을 완성하였다.
본 발명의 목적은 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열을 포함하는 단백질, 상기 단백질을 암호화하는 폴리뉴클레오티드, 상기 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드를 이용한 제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate) 형성 방법 및 상기 형성 방법으로 형성된 제1 목적 단백질 및 제2 목적 단백질의 결합체를 제공하는 것이다.
상기 목적을 달성하기 위하여, 본 발명은 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열을 포함하는 단백질을 제공한다.
또한, 본 발명은 상기 단백질을 암호화하는 폴리뉴클레오티드를 제공한다.
또한, 본 발명은 1) 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드 및 제1 목적 단백질을 포함하는 제1 융합 단백질 및, 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드 및 제2 목적 단백질을 포함하는 제2 융합 단백질을 제조하는 단계; 및 2) 상기 제조된 제1 융합 단백질 및 제2 융합 단백질을 혼합하여 제1 융합 단백질 및 제2 융합 단백질 간 결합을 형성시키는 단계를 포함하는, 제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate) 형성 방법을 제공한다.
또한, 본 발명은 상기 제1 목적 단백질 및 제2 목적 단백질의 결합체 형성 방법으로 형성된 제1 목적 단백질 및 제2 목적 단백질의 결합체를 제공한다.
본 발명은 인간 유래의 단백질인 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드를 이용하여, 제1 목적 단백질 및 제2 목적 단백질의 결합체를 형성할 수 있고, 상기 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드를 이용한 결합은 항원-항체 반응으로 결합하여 특이적이고, 이황화 결합을 포함하여 견고한 결합을 형성할 수 있으므로 제1 목적 단백질 및 제2 목적 단백질의 결합체를 형성하는 데에 유용하게 사용될 수 있다.
도 1은 헌팅틴 펩타이드-3LRH 항체 구조와 단백질 A를 분자 모델링 프로그램을 이용하여 도킹시킨 모습을 나타낸 것이다.
도 2는 헌팅틴 펩타이드와 단백질 A의 겹침 영역(overlapped regions)의 아미노산 서열과 #8188 단백질 A의 조작된 에피토프의 아미노산 서열을 나타낸 것이다.
도 3은 단백질 A와 헌팅틴 펩타이드의 나선(helice)을 구조 정렬한 모습을 나타낸 것이다(붉은 색은 헌팅틴 아미노산, 회색은 단백질 A 도메인의 아미노산을 나타낸다.).
도 4는 3LRHcys 항체와 #8188cys 단백질 A 간의 이황화 다리 형성을 위해, 3LRHcys 항체와 #8188 단백질 A에 시스테인이 도입된 아미노산 서열을 나타낸 것이다.
도 5는 3LRH 항체와 #8188 단백질 A의 결정 구조를 나타낸 것이다.
도 6은 도 5의 #8188 단백질 A의 조작된 에피토프 부분을 확대한 것이다(3LRH 항체와 상호작용하는 #8188 단백질 A와 헌팅틴 펩타이드의 아미노산 잔기를 각각 회색 및 빨간색으로 표시).
도 7은 천연 단백질 A(native protein A)와 조작된 단백질 A인 #8188 단백질 A의 구조를 비교한 것이다.
도 8은 3LRHcys 항체와 #8188cys 단백질 A의 이황화 다리 형성 확인을 위한 SDS-PAGE 분석 결과를 나타낸 것이다.
도 9는 3LRHcys 항체에 결합된 #8188cys 단백질 A의 결정 구조를 나타낸 것이다(이황화 다리는 노란색 선으로 표시, 이황화 다리 주변에 전자 밀도 지도는 회색 메쉬로 표시).
이하, 본 발명을 상세히 설명한다.
본 발명은 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열을 포함하는 단백질을 제공한다.
상기 단백질은 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열을 N-말단, 내부 또는 C-말단에 포함하는 것이 바람직하나 이에 한정되지 않는다.
상기 단백질은 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열과 임의의 목적 단백질의 융합 단백질일 수 있다.
상기 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드는 3LRH 항체의 변이체인 3LRHcys 항체로서, 본 발명에서 3LRH 항체는 인간 헌팅틴(huntingtin) 단백질에 존재하는 짧은 알파 나선의 펩타이드에 결합하는, 서열번호 1로 기재되는 아미노산 서열로 구성된 면역글로불린 경쇄를 의미한다. 상기 3LRHcys 항체는 3LRH 항체의 53번째 아미노산인 티로신(tyrosine, Y)을 시스테인(cystein, C)으로 돌연변이 시킨 것이다.
본 발명에서 #8188 단백질 A는 상기 3LRH 항체가 결합할 수 있는 나선형의 에피토프를 가진, 서열번호 4로 기재되는 아미노산 서열로 구성된 펩타이드를 의미하고, #8188cys 단백질 A는 상기 #8188 단백질 A의 변이체로, 서열번호 8로 기재되는 아미노산 서열로 구성된 펩타이드를 의미한다. 구체적으로, 상기 #8188cys 단백질 A는 상기 #8188 단백질 A의 51번째 아미노산인 알라닌(alanine, A)을 시스테인(cystein, C)으로 돌연변이 시킨 것일 수 있다.
상기 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드와 서열번호 8로 기재되는 아미노산 서열로 구성된 펩타이드는 상기 펩타이드 간의 결합을 형성할 수 있다. 구체적으로, 서열번호 8로 기재되는 아미노산 서열 중, 46번째 아미노산부터 59번째 아미노산까지의 서열(서열번호 9) 영역이 3LRHcys 항체와 결합을 형성하는 영역이고, 더 구체적으로는 서열번호 9로 기재되는 아미노산 서열 중, 2번째(K, 라이신), 6번째(C, 시스테인), 9번째(S, 세린), 10번째(L, 류신) 및 13번째(F, 페닐알라닌) 아미노산은 3LRHcys 항체와의 결합 형성에 중요한 아미노산이다. 서열번호 9로 기재되는 아미노산 서열 중, 2번째(K, 라이신), 6번째(C, 시스테인), 9번째(S, 세린), 10번째(L, 류신) 및 13번째(F, 페닐알라닌) 아미노산만 보존된 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드는 3LRHcys 항체와 결합을 형성할 수 있다. 단백질 내에서 항체와 결합하는 영역의 아미노산 서열 중, 항체를 향하여 항체와의 결합에 직접적으로 관여하는 특정 아미노산들을 보존한다면, 나머지 아미노산 서열을 다른 아미노산으로 치환하더라도 본래의 항원-항체 결합과 유사한 결합력으로 결합될 수 있다.
상기 서열번호 10으로 기재되는 아미노산 서열은 서열번호 9로 기재되는 아미노산 서열일 수 있다.
또한, 본 발명은 상기 단백질을 암호화하는 폴리뉴클레오티드를 제공한다. 상기 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드의 경우, 상기 펩타이드를 암호화하는 폴리뉴클레오티드는 서열번호 7의 염기서열일 수 있다. 또한, 상기 서열번호 10으로 기재되는 아미노산 서열을 포함하는 서열번호 8로 기재되는 아미노산 서열로 구성된 펩타이드의 경우, 상기 펩타이드를 암호화하는 폴리뉴클레오티드는 서열번호 11의 염기서열일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 구체적인 실시예에 의하면, 본 발명자들은 단백질 A에 3LRH 항체가 결합할 수 있는 나선형의 에피토프가 도입된 #8188 단백질 A를 제작하였다. 구체적으로, 단백질 A 및 헌팅틴 펩타이드의 나선을 구조 정렬하여, 단백질 A에서 3LRH 항체를 향하고 항체와의 결합에 중요한 아미노산(K47(미도시), E50, S51, P54(미도시) 및 K55(미도시))을 확인하였고 (도 3 참조), 단백질 A의 상기 아미노산들을 헌팅틴 펩타이드의 상응하는 아미노산으로 치환하여, 조작된 에피토프(engineered epitope)를 가지는 #8188 단백질 A를 제작하였다 (도 2 및 표 2 참조).
또한, 본 발명자들은 #8188 단백질 A와 3LRH 항체가 복합체를 형성하고, 상기 복합체는 항원-항체 반응에 의해 결합하는 본래의 헌팅틴 펩타이드-3LRH 항체의 복합체의 구조와 실질적으로 동일함을 확인하였다 (도 5 내지 도 7 참조).
또한, 본 발명자들은 인간 헌팅틴(huntingtin) 단백질에 존재하는 짧은 알파 나선의 펩타이드에 결합하는 3LRH 항체의 53번째 아미노산인 티로신(tyrosine, Y)을 시스테인(cystein, C)으로 돌연변이 시킨 3LRHcys 항체를 제작하고, 3LRH 항체가 결합할 수 있는 나선형의 에피토프를 가진 #8188 단백질 A의 51번째 아미노산인 알라닌(alanine, A)을 시스테인(cystein, C)으로 돌연변이 시킨 #8188cys 단백질 A를 제작하였다(표 3 및 표 4 참조).
또한, 본 발명자들은 3LRHcys 항체와 #8188cys 단백질 A를 이용하여 3LRHcys 항체-#8188cys 항원 단백질의 복합체(complex)를 제조하였다(도 4 참조).
또한, 본 발명자들은 SDS-PAGE 분석을 실시한 결과, 비환원성 겔에서 3LRHcys 항체와 #8188cys 단백질 A 사이의 이황화 다리가 형성되어 밴드가 이동됨을 확인하였으며, 결정화 구조를 분석한 결과, 전자 밀도 지도를 통해 이황화 다리가 형성됨을 확인하였다(도 8 및 도 9 참조).
따라서, 서열번호 6 또는 서열번호 8로 기재되는 아미노산 서열로 구성된 펩타이드는 인간 유래로서 면역 반응 유도와 같은 부작용이 없고, 상기 펩타이드 간의 결합은 항원-항체 반응으로 결합하기 때문에 특이적으로 결합이 가능하며, 이황화 결합을 통해 견고한 결합을 형성할 수 있으므로, 이들 펩타이드를 각각 포함하는 융합 단백질 간의 바이오컨쥬게이션에 유용한 시스템으로 사용될 수 있다.
또한, 본 발명은 1) 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드 및 제1 목적 단백질을 포함하는 제1 융합 단백질 및, 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드 및 제2 목적 단백질을 포함하는 제2 융합 단백질을 제조하는 단계; 및 2) 상기 제조된 제1 융합 단백질 및 제2 융합 단백질을 혼합하여 제1 융합 단백질 및 제2 융합 단백질 간 결합을 형성시키는 단계를 포함하는, 제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate) 형성 방법을 제공한다.
본 발명에서 "목적 단백질"은 컨쥬게이션 시킬 단백질 또는 펩타이드를 의미하는 것으로서, 단백질 또는 펩타이드라면 종류나 크기의 제한없이 포함될 수 있다.
본 발명에서 "융합 단백질"은 2개 이상의 단백질 또는 펩타이드가 서로 연결된 인위적으로 합성된 단백질로서, 구체적으로는 상기 목적 단백질 및 본 발명의 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드를 포함할 수 있다.
본 발명에서 "제1 융합 단백질"은 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드(3LRHcys 항체)와 제1 목적 단백질을 포함하는 융합 단백질을 의미하고, "제2 융합 단백질"은 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드와 제2 목적 단백질을 포함하는 융합 단백질을 의미한다.
상기 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드는 상기 제1 목적 단백질 서열의 N-말단, 내부 또는 C-말단에 존재할 수 있다. 또한 상기 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드는 상기 제2 목적 단백질의 서열의 N-말단, 내부 또는 C-말단에 존재할 수 있다.
본 발명에서 "제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate)"는 임의의 제1 목적 단백질과 제2 목적 단백질을 결합시키기 위하여, 상기 제1 융합 단백질 및 상기 제2 융합 단백질을 제조하고, 제조한 상기 제1 융합 단백질과 상기 제2 융합 단백질을 결합시킨 결합체를 의미한다. 구체적으로, 상기 결합체는 제1 융합 단백질에 포함된 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드(3LRHcys 항체) 및 상기 제2 융합 단백질에 포함된 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드 간의 결합으로 형성된 것이다.
상기 단계 1)의 융합 단백질을 제조하는 단계에서 상기 융합 단백질은 당해 분야에 공지된 화학적 합성방법으로 제조하거나, 상기 융합 단백질을 코딩하는 폴리뉴클레오티드를 발현벡터에 클로닝하여 발현시켜서 제조할 수 있다.
상기 단계 2)의 결합은 상기 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드와 상기 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드 간의 결합일 수 있다.
상기 펩타이드 간의 결합은 항원-항체 반응으로 결합된 것일 수 있다. 또한, 상기 펩타이드 간의 결합은 상기 항원-항체 반응으로 결합된 것에 이황화 결합(disulfide bond)을 더 포함하는 것일 수 있다.
상기 서열번호 10으로 기재되는 아미노산 서열은 서열번호 9로 기재되는 아미노산 서열일 수 있다.
또한, 본 발명은 상기 제1 목적 단백질 및 제2 목적 단백질의 결합체 형성 방법으로 형성된 제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate)를 제공한다.
본 발명의 구체적인 실시예에 의하면, 본 발명자들은 3LRHcys 항체 및 #8188cys 단백질 A를 각각 암호화하는 폴리뉴클레오티드를 벡터에 클로닝하고, 상기 벡터를 E. coli에 형질전환하여 3LRHcys 항체 및 #8188cys 단백질 A를 제조하였으며, 3LRHcys 항체-#8188cys 항원 단백질의 복합체 제조하였다(표 3, 표 4 및 도 4 참조). 따라서, 3LRHcys 항체와 제1 목적 단백질의 융합 단백질과 #8188cys 단백질 A와 제2 목적 단백질의 융합 단백질을 혼합하는 경우, 3LRHcys 항체와 #8188cys 단백질 A 간의 결합을 통해 목적 단백질 간의 결합체를 제조할 수 있다.
이하, 본 발명을 하기 실시예에 의해 상세히 설명한다.
단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 의해 한정되는 것은 아니다.
<실시예 1> 3LRH 항체의 제작
3LRH 항체를 암호화하는 폴리뉴클레오티드는 PDB 데이터베이스에 저장된 아미노산 서열 정보를 기반으로 합성하였다.
서열번호 항체이름 서열 종류 서열
1 3LRH 아미노산 서열 MGSQPVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYDDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVLSA
2 3LRH 염기서열(5'→3') ATGGGTAGTCAACCAGTACTTACACAAAGCCCGTCTGTGTCTGCCGCTCCACGTCAGAGAGTCACCATCTCAGTTAGTGGTTCTAATTCAAATATAGGATCGAACACAGTGAACTGGATTCAGCAGTTGCCTGGCCGTGCCCCGGAGTTATTAATGTATGATGATGATTTATTAGCACCCGGAGTATCAGATCGCTTTTCAGGAAGCCGTAGTGGCACTAGTGCGTCCTTAACCATTAGCGGGTTACAGTCTGAAGACGAAGCGGACTATTACGCAGCTACGTGGGATGATAGTTTAAATGGCTGGGTTTTTGGTGGTGGTACTAAAGTTACGGTGCTGTCCGCA
3LRH 항체를 암호화할 수 있는 폴리뉴클레오티드(서열번호 2)를 pET28a 벡터에 클로닝한 후, 단백질 생산을 위해, E. coli strain BL21(DE3)에 형질전환하였다. 형질전환된 E. coli BL21(DE3)를 50㎍/mL의 카나마이신(kanamycin)이 첨가된 LB 배지에 접종하고 37℃에서 배양하였다. OD600의 값이 0.7에 도달하였을 때, 0.5 mM IPTG(Isopropyl β-D-1-thiogalactopyranoside)를 첨가하여 단백질 생산을 유도하고, 21℃에서 밤새 배양하였다. E. coli를 수득한 후, 20 mM Tris pH 8.0, 200 mM NaCl 및 0.5 mM PMSF를 포함하는 용해 완충액(lysis buffer)에 수확한 세포 펠릿을 재현탁시키고, 마이크로플루이다이저(microfluidizer, Microfluidics)로 균질화시켰다. 원심분리를 통해 제거하고, 상등액을 Ni-NTA 금속 친화성 컬럼(metal affinity column)에 로딩한 후, 20 mM Tris pH 8.0, 200 mM NaCl 및 500 mM 이미다졸(imidazole) pH 8.0를 포함하는 버퍼를 이용하여 6XHis-태그된 단백질을 용출시켰다.
6XHis 태그를 제거하기 위해, 용출된 항체 단백질에 트롬빈(Sigma, Cat#. T4648)을 함께 밤새 처리하였다. 이를 20 mM Tris pH 8.0, 200 mM NaCl로 평형화된 Superdex 200 크기-배제 컬럼(size-exclusion column, GE Healthcare)에 로딩하여 절단된 3LRH 항체를 정제하였다.
<실시예 2> 에피토프가 도입된 #8188 단백질 A의 제작
단백질 A에 3LRH 항체가 결합할 수 있는 에피토프를 도입하고자 하였다. 3LRH 항체는 인간 헌팅틴 단백질내의 14개 아미노산으로 구성된 알파 나선형 스트레치(alpha helical stretch)에 결합한다.
3LRH 항체에 결합된 헌팅틴 펩타이드 구조를 단백질 A의 C 말단 헬릭스에 오버랩(overlap)시켰다(도 1 참조). 도 2는 분자 모델링 프로그램으로 오버랩된 헌팅틴 펩타이드의 처음 10개의 아미노산과 단백질 A의 C 말단 헬릭스의 마지막 10개의 아미노산을 나타낸 것이다 (도 2 참조).
단백질 A에 에피토프를 설계하기 위해, 단백질 A와 헌팅틴 단백질의 나선을 구조 정렬(structural alignment)한 결과, 단백질 A에서 47번째 아미노산인 라이신(K47) (미도시), 50번째 아미노산인 글루타민(E50) 및 51번째 아미노산인 세린(S51)은 항체를 향하고 결합에 중요한 것으로 확인되었다(도 3 참조). 이외에도 단백질 A에서 54번째 아미노산인 프롤린(P54) (미도시), 및 55번째 아미노산인 라이산(K55) (미도시) 또한 항체를 향하고 결합에 중요한 것으로 확인되었다.
이에 라이신을 제외한 단백질 A의 상기 아미노산들을 헌팅틴 펩타이드의 상응하는 아미노산으로 치환하여, 조작된 에피토프(engineered epitope)를 가지는 #8188 단백질 A를 제작하였다 (도 2 및 표 2 참조). 라이신(K47)은 헌팅틴 펩타이드와 단백질 A 서열의 상응하는 위치에서 모두 발견되었기 때문에, 변경할 필요가 없었고, 단백질 A의 N말단 영역인 54번째 및 55번째 아미노산은 헌팅틴 펩타이드의 N말단 영역인 13 내지 18번째 아미노산 서열로 치환하였다.
서열번호 단백질이름 서열 종류 서열
3 단백질 A 아미노산 서열 MFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPK
4 #8188 단백질 A 아미노산 서열 MFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNKAQASLKSFQ
5 #8188 단백질 A 염기서열(5'→3') ATGTTCAACAAGGATCAGCAGAGCGCCTTCTACGAGATCCTGAACATGCCGAACCTGAACGAGGCCCAGCGCAACGGCTTCATCCAGAGCCTGAAGGATGATCCAGCCAGAGCACGAACGTGCTGGGTGAAGCTAAGAAACTGAACAAAGCTCAGGCTTCTCTGAAATCTTTCCAG
구체적인 #8188 단백질 A의 제작 과정은 다음과 같다. #8188 단백질 A를 암호화하는 폴리뉴클레오티드(서열번호 5)는 합성 올리고뉴클레오티드를 이용한 PCR을 통해 수득하였다. 구체적인 PCR 과정은 다음과 같다. 단백질 A를 암호화하는 유전자를 템플릿으로 하고, 정방향 프라이머 (서열번호 12)과 역방향 프라이머 (서열번호 13)을 이용하여 변성(denaturation) 단계(95℃)에서 20초; 어닐링(annealing) 단계(56℃)에서 20초; 연장(extension step) 단계(72℃)에서 30초 조건에 따라 PCR(총 30 cycle)을 수행하였다. (정방향 프라이머 (서열번호 12): ACTACCATATGTTCAACAAGGATCAGCAGAGCGCC; 역방향 프라이머 (서열번호 13): ACTACGCGGCCGCTCACTGGAAAGATTTCAGAGAAGCCTGAGCTTTGTTCAGTTTCTTAGCTTCACCCAGCACGTTC)
증폭된 #8188의 폴리뉴클레오티드(서열번호 5)를 pET28a 벡터에 클로닝한 후, 단백질 생산을 위해, E. coli strain BL21(DE3)에 형질전환하였다. 형질전환된 E. coli BL21(DE3)를 50㎍/mL의 카나마이신(kanamycin)이 첨가된 LB 배지에 접종하고 37℃에서 배양하였다. OD600의 값이 0.6에 도달했을 때, 0.5 mM IPTG를 첨가한 후 37℃에서 4시간 동안 추가로 배양하였다. E. coli를 수득한 후, 20 mM Tris pH 8.0, 200 mM NaCl 및 0.5 mM PMSF를 포함한 용해 완충액(lysis buffer)에 재현탁시키고, 마이크로플루이다이저(microfluidizer, Microfluidics)로 균질화시켰다. 원심분리를 통해 세포 부유물을 제거하고, 상등액을 Ni-NTA 크로마토그래피 컬럼에 로딩하였다. 20 mM Tris pH 8.0, 200 mM NaCl 및 500 mM 이미다졸(imidazole) pH 8.0를 포함하는 버퍼를 이용하여 6XHis-태그된 단백질을 용출시키고, 이미다졸은 PD-10 탈염 컬럼(desalting column, GE Healthcare)를 이용하여 제거하여, 정제된 #8188 단백질 A를 수득하였다.
<실시예 3> 3LRHcys 항체 및 #8188cys 단백질 A의 제작
3LRH 항체와 #8188 단백질 A 간의 항원-항체 결합 반응을 나노구조체의 제조 등에 적용하기 위하여 상기 두 폴리펩타이드 분자를 이황화 다리(disulfide bridge)로 연결하고자 하였다. Design 2.0 프로그램을 사용하여 3LRH의 경우 53번째 아미노산인 티로신, #8188 단백질 A의 경우 51번째 아미노산인 알라닌을 시스테인(Cys)을 도입할 위치(site)로 결정하였다.
<실시예 3-1> 3LRHcys 항체의 제작
3LRH의 53번째 아미노산인 티로신(tyrosine, Y)을 시스테인(cystein, C)으로 돌연변이시킨 3LRHcys 항체(표 3)을 제작하기 위해, 오버랩 PCR을 수행하였다.
3LRH 항체를 암호화하는 유전자를 템플릿으로 하고, 정방향 프라이머 1(서열번호 14)과 역방향 프라이머 1(서열번호 15)을 이용하여 PCR을 수행하여 템플릿(template) 1을 얻었다. 그 다음, 정방향 프라이머 2(서열번호 16)와 역방향 프라이머 2(서열번호 17)를 이용하여 PCR을 하여 템플릿 2를 얻었다. 정방향 프라이머 1과 역방향 프라이머 2로 템플릿 1과 템플릿 2를 동시에 PCR을 수행하여 오버랩 PCR을 완성하였다.
(정방향 프라이머 1(서열번호 14): ACTACCATATGGGTAGTCAACCAGTACTTACACAA;
역방향 프라이머 1(서열번호 15): ATCATCATCACACATTAATAACTCCGGGGCACGGC;
정방향 프라이머 2(서열번호 16): TTATTAATGTGTGATGATGATTTATTAGCACCCG;
역방향 프라이머 2(서열번호 17): ACTACGCGGCCGCTCATGCGGACAGCACCGTAACT)
서열번호 항체이름 서열 종류 서열
1 3LRH 아미노산 서열 MGSQPVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLM Y DDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVLSA
6 3LRHcys 아미노산 서열 MGSQPVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLM C DDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVLSA
7 3LRHcys 염기서열(5'→3') ATGGGTAGTCAACCAGTACTTACACAAAGCCCGTCTGTGTCTGCCGCTCCACGTCAGAGAGTCACCATCTCAGTTAGTGGTTCTAATTCAAATATAGGATCGAACACAGTGAACTGGATTCAGCAGTTGCCTGGCCGTGCCCCGGAGTTATTAATGTGTGATGATGATTTATTAGCACCCGGAGTATCAGATCGCTTTTCAGGAAGCCGTAGTGGCACTAGTGCGTCCTTAACCATTAGCGGGTTACAGTCTGAAGACGAAGCGGACTATTACGCAGCTACGTGGGATGATAGTTTAAATGGCTGGGTTTTTGGTGGTGGTACTAAAGTTACGGTGCTGTCCGCA
증폭된 3LRHcys 항체를 암호화하는 폴리뉴클레오티드(서열번호 7)를 pET28a 벡터에 클로닝한 후, 실시예 1에 기재된 방법으로 3LRHcys 항체를 얻었다.
<실시예 3-2> #8188cys 단백질 A의 제작
#8188 단백질 A의 51번째 아미노산인 알라닌(alanine, A)을 시스테인(cystein, C)으로 돌연변이시키기 위해, #8188 단백질 A를 암호화하는 폴리뉴클레오티드를 주형으로 PCR을 수행하여 #8188cys 단백질 A를 암호화하는 폴리뉴클레오티드를 제작하였다.
서열번호 단백질이름 서열 종류 서열
4 #8188 단백질 A 아미노산 서열 MFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNK A QASLKSFQ
8 #8188cys단백질 A 아미노산 서열 MFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNK C QASLKSFQ
9 #8188cys단백질 A 내 결합펩타이드 아미노산 서열 KKLNKCQASLKSFQ
10 #8188cys단백질 A 내 결합펩타이드 아미노산 서열 xKxxxCxxSLxxFx
11 #8188cys단백질 A 염기서열(5'→3') ATGTTCAACAAGGATCAGCAGAGCGCCTTCTACGAGATCCTGAACATGCCGAACCTGAACGAGGCCCAGCGCAACGGCTTCATCCAGAGCCTGAAGGATGATCCGAGCCAGAGCACGAACGTGCTGGGTGAAGCTAAGAAACTGAACAAATGTCAGGCTTCTCTGAAATCTTTCCAG
구체적으로 돌연변이는 합성 올리고뉴클레오티드를 이용한 PCR을 통해 수득하였다. 구체적인 PCR 과정은 다음과 같다. #8188 단백질 A를 암호화하는 유전자를 템플릿으로 하고, 정방향 프라이머 (서열번호 18)과 역방향 프라이머 (서열번호 19)을 이용하여 변성(denaturation) 단계(95℃)에서 20초; 어닐링(annealing) 단계(56℃)에서 20초; 연장(extension step) 단계(72℃)에서 30초 조건에 따라 PCR(총 30 cycle)을 수행하였다. (정방향 프라이머 (서열번호 18): ACTACCATATGTTCAACAAGGATCAGCAGAGCGCC; 역방향 프라이머 (서열번호 19): ACTACGCGGCCGCTCACTGGAAAGATTTCAGAGAAGCCTGACATTTGTTCAGTTTCTTAGCTTCACC)
증폭된 #8188cys 단백질 A를 암호화하는 폴리뉴클레오티드(서열번호 11)를 pET28a 벡터에 클로닝한 후, 단백질 생산을 위해, E. coli strain BL21(DE3)에 형질전환하였다. 형질전환된 E. coli BL21(DE3)를 50㎍/mL의 카나마이신(kanamycin)이 첨가된 LB 배지에 접종하고 37℃에서 배양하였다. OD600의 값이 0.6에 도달했을 때, 0.5 mM IPTG를 첨가한 후 37℃에서 4시간 동안 추가로 배양하였다. E. coli를 수득한 후, 20 mM Tris pH 8.0, 200 mM NaCl 및 0.5 mM PMSF를 포함한 용해 완충액(lysis buffer)에 재현탁시키고, 마이크로플루이다이저(microfluidizer, Microfluidics)로 균질화시켰다. 원심분리를 통해 세포 부유물을 제거하고, 상등액을 Ni-NTA 크로마토그래피 컬럼에 로딩하였다. 20 mM Tris pH 8.0, 200 mM NaCl 및 500 mM 이미다졸(imidazole) pH 8.0를 포함하는 버퍼를 이용하여 6XHis-태그된 단백질을 용출시키고, 이미다졸은 PD-10 탈염 컬럼(desalting column, GE Healthcare)를 이용하여 제거하여, 정제된 #8188cys 단백질 A를 수득하였다.
<실시예 4> 3LRH 항체-#8188 단백질 A의 복합체(complex) 제작
3LRH 항체-#8188 단백질 A의 복합체를 제작하기 위해, 실시예 1에서 제작한 3LRH 항체와 실시예 2에서 제작한 #8188 단백질 A를 1:1 몰비(molar ratio)로 4℃에서 1시간 동안 혼합하였다.
Superdex 200 겔-여과 크로마토그래피(gel-filtration chromatography)를 이용하여 3LRH 항체-#8188 단백질 A의 복합체만을 정제하였다.
<실시예 5> 3LRHcys 항체-#8188cys 항원 단백질의 복합체(complex) 제작
3LRHcys 항체-#8188cys 단백질 A의 복합체를 제작하기 위해, 실시예 3에서 제작한 3LRHcys 항체와 #8188cys 단백질 A를 비환원 환경(non-reducing conditions) 하에서 1:1 몰비(molar ratio)로 4℃에서 밤새 혼합하였다.
Superdex 200 겔-여과 크로마토그래피(gel-filtration chromatography)를 이용하여 3LRHcys 항체-#8188cys 항원 펩타이드의 복합체만을 정제하였다.
<실험예 1> 3LRH 항체-#8188 단백질 A의 복합체의 결정 구조 확인
35% PEG 4000, 0.1 M MOPS pH 6.5를 포함하는 결정화 용액(crystallization solution)과 동결보호제인 30% 글리세롤을 이용하여 실시예 4에서 제작한 3LRH 항체-#8188 단백질 A의 복합체를 결정화시켰다. 결정체(crystal)는 -170℃의 액체 질소에서 급속 동결시켰다.
회절 데이터는 포항가속기연구소(Pohang Accelerator Laboratory)의 7A와 5C 빔 라인에서 수집하였고, 회절 데이터의 처리에는 패키지 HKL2000를 사용하였다(HKL research).
구조의 확인과 개선(refinement)의 초기 단계는 PHASER 프로그램을 이용한 분자 대체 기법(molecular replacement technique)으로 계산되었다. 원자 모델은 프로그램 COOT 및 PHENIX를 이용, 반복적인 모델링과 개선(refinement)에 의해 구축되었다.
결정 구조에서, #8188 단백질 A의 변형된 C 말단 나선은 예상대로 3LRH 항체와 상호 작용하였다(도 5 참조). 에피토프 생성을 위해 변이된 아미노산 잔기는 빨간색으로 표시되어 있다.
3LRH 항체와 상호 작용하는 아미노산의 구조는 본래의 헌팅틴 펩타이드-3LRH 항체의 복합체의 구조와 실질적으로 동일하고, #8188 단백질 A 및 천연 단백질 A의 전체 구조는 0.408 Å의 Cα r.m.s.d로 겹쳐질 수 있다(도 6 및 도 7).
<실험예 2> SDS-PAGE를 이용한 3LRHcys 항체-#8188cys 단백질 A 간의 이황화 다리(disulfide bridge)의 형성 확인
실시예 5에 기재된 바와 같이, 3LRHcys 항체와 #8188cys 단백질 A를 혼합하였을 때, 이황화 다리가 제대로 형성되는지를 환원성 및 비환원성 조건에서 SDS-PAGE를 수행하여 모니터링하였다.
도 8을 참고하면, 비환원성 겔에서 3LRHcys 항체와 #8188cys 단백질 A 사이의 이황화 다리가 형성되어 밴드가 이동됨을 확인하였으며, 밤새 배양 후(16 hr) 거의 100% 효율로 이황화 다리가 형성되는 것을 확인되었다. 결합할 항체 없이, #8188cys 단백질 A만 있는 경우, 비환원성 조건에서 동형이량체(homodimer)를 형성하였다.
시스테인 돌연변이는 복합체의 안정성을 증가시킬 수 있다. 뿐만 아니라 이황화 다리는 두 개의 시스테인이 서로 충분히 가까울 때만 형성될 수 있기 때문에, 에피토프의 성공적인 설계와 복합체의 형성을 확인할 수 있는 편리한 도구가 될 수있다. 따라서 3LRHcys 항체에 대한 #8188cys 단백질 A의 결합은 정제 없이도 단백질 최소량만 사용하여, 비환원성 SDS-PAGE에 의해 빠르게 모니터링될 수 있다.
<실험예 3> 3LRHcys 항체-#8188cys 항원 단백질의 복합체의 결정화(crystallization) 구조 확인
45% PEG 4000, 0.1 M HEPES pH 7.5를 포함하는 결정화 용액(crystallization solution)과 동결보호제인 30% 글리세롤을 이용하여 실시예 5에서 제작한 3LRHcys 항체-#8188cys 단백질 A의 복합체를 결정화시켰다. 결정체(crystal)는 -170℃의 액체 질소에서 급속 동결시켰다.
회절 데이터는 포항가속기연구소(Pohang Accelerator Laboratory)의 7A와 5C 빔 라인에서 수집하였고, 회절 데이터의 처리에는 패키지 HKL2000를 사용하였다(HKL research).
구조의 확인과 개선(refinement)의 초기 단계는 PHASER 프로그램을 이용한 분자 대체 기법(molecular replacement technique)으로 계산되었다. 원자 모델은 프로그램 COOT 및 PHENIX를 이용, 반복적인 모델링과 개선(refinement)에 의해 구축되었다.
3LRHcys 항체-#8188cys 단백질 A의 복합체의 구조에서, 전자 밀도 지도(electron density map)는 이황화 다리를 분명하게 나타낸다 (도 9). 이황화 다리는 도 9에 노란색 선으로 표시하였고, 이황화 다리 주변에 전자 밀도 지도는 회색 메쉬로 표시하였다. 또한 이 이황화 다리 자체는 3LRHcys 항체-#8188cys 단백질 A 사이의 상호작용을 방해하지 않음을 보여준다.
이황화 다리로 안정화된 3LRHcys 항체-#8188cys 단백질 A의 복합체 시스템은 바이오컨쥬게이션에 유용한 도구가 될 수 있다. 3LRH와 #8188 단백질 A는 인간 단백질로부터 유래된 것이기 때문에, 기존에 면역학적 합병증과 같은 부작용으로 치료제로서 적용이 제한되어 온 종래의 바이오컨쥬게이션 방법의 한계점을 해결할 수 있다. 또한 3LRHcys 항체 또는 #8188cys 단백질 A는 사이즈가 작으므로, E. coli에서 퓨전 태그(fusion tag)로 쉽게 다량 생산할 수 있다는 장점이 있다.

Claims (10)

  1. 서열번호 6 또는 서열번호 10으로 기재되는 아미노산 서열을 포함하는 단백질.
  2. 제1항의 단백질을 암호화하는 폴리뉴클레오티드.
  3. 청구항 1에 있어서, 상기 서열번호 10으로 기재되는 아미노산 서열은 서열번호 9로 기재되는 아미노산 서열인, 단백질.
  4. 1) 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드 및 제1 목적 단백질을 포함하는 제1 융합 단백질 및, 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드 및 제2 목적 단백질을 포함하는 제2 융합 단백질을 제조하는 단계; 및
    2) 상기 제조된 제1 융합 단백질 및 제2 융합 단백질을 혼합하여 제1 융합 단백질 및 제2 융합 단백질 간 결합을 형성시키는 단계를 포함하는, 제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate) 형성 방법.
  5. 청구항 4에 있어서,
    상기 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드는 상기 제1 목적 단백질 서열의 N-말단, 내부 또는 C-말단에 존재하며,
    상기 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드는 상기 제2 목적 단백질의 서열의 N-말단, 내부 또는 C-말단에 존재하는 것인, 제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate) 형성 방법.
  6. 청구항 4에 있어서,
    상기 단계 2)의 결합은 상기 서열번호 6으로 기재되는 아미노산 서열로 구성된 펩타이드와 상기 서열번호 10으로 기재되는 아미노산 서열로 구성된 펩타이드 간의 결합인, 제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate) 형성 방법.
  7. 청구항 6에 있어서,
    상기 펩타이드 간의 결합은 항원-항체 반응으로 결합된 것인, 제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate) 형성 방법.
  8. 청구항 7에 있어서,
    상기 펩타이드 간의 결합은 이황화 결합(disulfide bond)을 더 포함하는 것인, 제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate) 형성 방법.
  9. 청구항 4 내지 청구항 8에 있어서, 상기 서열번호 10으로 기재되는 아미노산 서열은 서열번호 9로 기재되는 아미노산 서열인, 제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate) 형성 방법.
  10. 청구항 4의 방법으로 형성된 제1 목적 단백질 및 제2 목적 단백질의 결합체(conjugate).
PCT/KR2018/014818 2018-03-30 2018-11-28 단백질-단백질 결합체를 형성 매개 펩타이드 및 이를 이용한 단백질-단백질 결합체 형성 방법 Ceased WO2019190022A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020180037451A KR102140557B1 (ko) 2018-03-30 2018-03-30 단백질-단백질 결합체를 형성 매개 펩타이드 및 이를 이용한 단백질-단백질 결합체 형성 방법
KR10-2018-0037451 2018-03-30

Publications (1)

Publication Number Publication Date
WO2019190022A1 true WO2019190022A1 (ko) 2019-10-03

Family

ID=68062273

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2018/014818 Ceased WO2019190022A1 (ko) 2018-03-30 2018-11-28 단백질-단백질 결합체를 형성 매개 펩타이드 및 이를 이용한 단백질-단백질 결합체 형성 방법

Country Status (2)

Country Link
KR (1) KR102140557B1 (ko)
WO (1) WO2019190022A1 (ko)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102245733B1 (ko) * 2019-10-10 2021-04-28 포항공과대학교 산학협력단 알파나선에 결합하는 항체를 이용한 단백질 구조 규명 방법

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7691608B2 (en) * 2006-12-06 2010-04-06 Repligen Corporation Nucleic acids encoding recombinant protein A
US20100233180A1 (en) * 2002-01-28 2010-09-16 California Institute Of Technology Antibodies that bind to an epitope on the huntington's disease protein
KR101281208B1 (ko) * 2005-05-11 2013-07-26 필로겐 에스.피.에이. 피브로넥틴 ed-b에 대한 항체 l19 및 인터루킨12의 융합 단백질

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100233180A1 (en) * 2002-01-28 2010-09-16 California Institute Of Technology Antibodies that bind to an epitope on the huntington's disease protein
KR101281208B1 (ko) * 2005-05-11 2013-07-26 필로겐 에스.피.에이. 피브로넥틴 ed-b에 대한 항체 l19 및 인터루킨12의 융합 단백질
US7691608B2 (en) * 2006-12-06 2010-04-06 Repligen Corporation Nucleic acids encoding recombinant protein A

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DATABASE Protein 10 October 2012 (2012-10-10), "Chain A, Anti-huntingtin Vl Domain", XP055640504, retrieved from NCBI Database accession no. 3LRH_A *
SCHIEFNER, A. ET AL.: "A disulfide-free single-domain VL intrabody with blocking activity towards huntingtin reveals a novel mode of epitope recognition", JOURNAL OF MOLECULAR BIOLOGY, vol. 414, 2011, pages 337 - 355, XP028126443, doi:10.1016/j.jmb.2011.09.034 *

Also Published As

Publication number Publication date
KR20190114550A (ko) 2019-10-10
KR102140557B1 (ko) 2020-08-03

Similar Documents

Publication Publication Date Title
US10527609B2 (en) Peptide tag systems that spontaneously form an irreversible link to protein partners via isopeptide bonds
Li et al. Ligation of expressed protein α-hydrazides via genetic incorporation of an α-hydroxy acid
Torbeev et al. Convergent chemical synthesis and crystal structure of a 203 amino acid “covalent dimer” HIV‐1 protease enzyme molecule
US6875594B2 (en) Methods of ligating expressed proteins
US8735540B2 (en) Peptides with sequentially arranged streptavidin binding modules
US5874239A (en) Biotinylation of proteins
CN101765608B (zh) 新白蛋白结合组合物、方法及应用
JP2021006024A5 (ko)
CN108884154A (zh) 具有独特剪接活性的断裂内含肽
WO1996013583A2 (en) Targeted hetero-association of recombinant proteins to multi-functional complexes
JP2023016842A (ja) タンパク質ライゲーションの方法及びその使用
Givol et al. The position of various cleavages of rabbit immunoglobulin G
EP1151299A1 (en) Method of site specific labeling of proteins and uses therefor
CN110669109B (zh) 一种酶联标签短肽及其应用
Rosenthal et al. Functional expression and site-directed mutagenesis of a synthetic gene for alpha-bungarotoxin
Beal et al. Modification of bacterial microcompartments with target biomolecules via post-translational SpyTagging
Giesler et al. Protein chirality as a determinant of ligand affinity: insights from l-and d-streptavidin
Okamoto et al. An efficient solid‐phase synthesis of peptidyl‐N‐acetylguanidines for use in native chemical ligation
CN112851765B (zh) 蛋白或肽与核酸共价连接的方法
KR20190114550A (ko) 단백질-단백질 결합체를 형성 매개 펩타이드 및 이를 이용한 단백질-단백질 결합체 형성 방법
Dwyer Amino acid sequence homology between ligands and their receptors: Potential identification of binding sites
EP4169940A1 (en) Immunogenicity-reduced low-molecular antibody and method for producing same
Järver et al. Chemical synthesis and evaluation of a backbone‐cyclized minimized 2‐helix Z‐domain
EP4414386A1 (en) Method of chemical synthesis of single-chain antibody fragments and products thereby obtained
Bockhorn et al. Novel semisynthetic method for generating full length β‐amyloid peptides

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18912351

Country of ref document: EP

Kind code of ref document: A1

122 Ep: pct application non-entry in european phase

Ref document number: 18912351

Country of ref document: EP

Kind code of ref document: A1