WO2019173756A1 - Compositions and methods for treating parkinson's disease - Google Patents
Compositions and methods for treating parkinson's disease Download PDFInfo
- Publication number
- WO2019173756A1 WO2019173756A1 PCT/US2019/021422 US2019021422W WO2019173756A1 WO 2019173756 A1 WO2019173756 A1 WO 2019173756A1 US 2019021422 W US2019021422 W US 2019021422W WO 2019173756 A1 WO2019173756 A1 WO 2019173756A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- acid sequence
- gba
- seq
- amino acid
- nucleic acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/135—Amines having aromatic rings, e.g. ketamine, nortriptyline
- A61K31/138—Aryloxyalkylamines, e.g. propranolol, tamoxifen, phenoxybenzamine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/4427—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
- A61K31/4439—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/28—Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/47—Hydrolases (3) acting on glycosyl compounds (3.2), e.g. cellulases, lactases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0085—Brain, e.g. brain implants; Spinal cord
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/65—Insulin-like growth factors, i.e. somatomedins, e.g. IGF-1, IGF-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/775—Apolipopeptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/81—Protease inhibitors
- C07K14/8107—Endopeptidase (E.C. 3.4.21-99) inhibitors
- C07K14/811—Serine protease (E.C. 3.4.21) inhibitors
- C07K14/8121—Serpins
- C07K14/8125—Alpha-1-antitrypsin
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2468—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1) acting on beta-galactose-glycoside bonds, e.g. carrageenases (3.2.1.83; 3.2.1.157); beta-agarase (3.2.1.81)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/34—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01045—Glucosylceramidase (3.2.1.45), i.e. beta-glucocerebrosidase
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/055—Fusion polypeptide containing a localisation/targetting motif containing a signal for localisation to secretory granules (for exocytosis)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/06—Fusion polypeptide containing a localisation/targetting motif containing a lysosomal/endosomal localisation signal
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]
- C12N2310/141—MicroRNAs, miRNAs
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/13011—Gammaretrovirus, e.g. murine leukeamia virus
- C12N2740/13041—Use of virus, viral particle or viral elements as a vector
- C12N2740/13043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the invention relates to compositions and methods for treating Parkinson’s disease.
- Parkinson’s disease is a progressive disorder of the nervous system that affects movement and produces symptoms such as resting tremor, rigidity, and bradykinesia. Patients suffering from Parkinson’s disease may also experience non-motor symptoms, including depression, constipation, pain, sleep disorders, cognitive decline, and olfactory dysfunction. Post-mortem analyses of PD patient brains often reveal Lewy bodies containing a-synuclein in affected brain regions and a loss of dopaminergic neurons in the substantia nigra pars compacta. Current treatments for PD primarily focus on increasing dopamine levels. There remains a need for improved therapeutic modalities for the treatment of PD.
- the present invention provides methods for treating Parkinson’s disease using pluripotent cells, such as CD34+ cells and hematopoietic stem cells, among others, expressing glucocerebrosidase (GBA).
- the cells may be administered to a patient having Parkinson’s disease by one or more of a variety of routes, including directly to the central nervous system of the patient (e.g., by intracerebroventricular administration) or systemically (e.g., by intravenous administration), among others.
- the cells may further express one or more additional transgenes, such as a transgene encoding an M2-promoting agent.
- the invention also features compositions containing such pluripotent cells, as well as kits containing these cells for the treatment of Parkinson’s disease.
- the invention provides a method of treating Parkinson’s disease in a subject by administering to the subject a composition containing a population of pluripotent cells that express a transgene encoding GBA.
- the GBA is full-length GBA, such as GBA having an amino acid sequence of SEQ ID NO. 1 or a variant thereof having at least 85% sequence identity thereto (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 1 00% sequence identity to SEQ ID NO. 1 ).
- the GBA is mature GBA protein.
- the GBA is a catalytic domain of GBA, such as a catalytic domain of SEQ ID NO. 1 (e.g., a catalytic domain containing residues 76-381 and 41 6-430 of SEQ ID NO. 1 .
- the transgene encoding GBA contains a polynucleotide encoding wild- type human GBA (SEQ ID NO. 1 ). In some embodiments, the transgene encoding GBA includes a polynucleotide encoding a polypeptide having at least 85% sequence identity (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to a polypeptide having the amino acid sequence of SEQ ID NO. 1 .
- the transgene encoding GBA includes a polynucleotide encoding polypeptide that contains one or more amino acid substitutions, such as one or more conservative amino acid substitutions, relative to a polypeptide having the sequence of SEQ ID NO. 1 (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0 or more amino acid substitutions, such as 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more conservative amino acid substitutions).
- the transgene encoding GBA contains a polynucleotide having at least 85% sequence identity (e.g., at least 85%, 90%, 95%, 96%,
- the transgene encoding GBA contains a codon-optimized polynucleotide having at least 85% sequence identity (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to the nucleic acid sequence of SEQ ID NO. 7.
- the transgene encoding GBA encodes non-secreted GBA. In some embodiments, the transgene encoding non-secreted GBA has been codon-optimized. In some embodiments, the transgene encoding secreted GBA comprises a signal peptide, such as a GBA signal peptide (e.g., a 39-amino acid GBA signal peptide). In some embodiments, the transgene encoding secreted GBA comprises a modified signal peptide.
- the GBA comprising a modified signal peptide has an amino acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the amino acid sequence of SEQ ID NO. 5.
- the transgene encoding secreted GBA comprising a modified signal peptide has a nucleic acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the nucleic acid sequence of SEQ ID NO. 1 1 .
- the modified signal peptide has an amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO. 16.
- the modified signal peptide is encoded by a polynucleotide having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 1 00% sequence identity) to the nucleic acid sequence of SEQ ID NO. 20.
- the transgene encoding GBA encodes secreted GBA. In some embodiments, the transgene encoding secreted GBA has been codon-optimized. In some embodiments, the transgene encoding secreted GBA comprises a secretory signal peptide. In some embodiments, the secretory signal peptide is a GBA secretory signal peptide. In some embodiments, the secretory signal peptide is an alpha-1 antitrypsin secretory signal peptide. In some embodiments, the secretory signal peptide is an insulin-like growth factor II (IGF-II) secretory signal peptide.
- IGF-II insulin-like growth factor II
- the GBA is a GBA fusion protein.
- the transgene encoding GBA encodes a GBA fusion protein.
- the GBA fusion protein has an amino acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%,
- the GBA fusion protein has an amino acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the amino acid sequence of SEQ ID NO. 3.
- the GBA fusion protein has an amino acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the amino acid sequence of SEQ ID NO. 4.
- the transgene encoding the GBA fusion protein has a nucleic acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the nucleic acid sequence of SEQ ID NO. 8.
- the transgene encoding the GBA fusion protein has a nucleic acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the nucleic acid sequence of SEQ ID NO. 9.
- the transgene encoding the GBA fusion protein has a nucleic acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the nucleic acid sequence of SEQ ID NO. 10.
- the GBA fusion protein contains GBA and a glycosylation independent lysosomal targeting (GILT) tag.
- the GILT tag is operably linked to the N-terminus of the GBA.
- the GILT tag is operably linked to the C-terminus of the GBA.
- the GILT tag contains a human IGF-II mutein having an amino acid sequence at least 70% identical to the amino acid sequence of mature human IGF-II (SEQ ID NO. 12).
- the mutein may have diminished binding affinity for the insulin receptor relative to the affinity of naturally-occurring human IGF-II for the insulin receptor, and/or may be resistant to furin cleavage.
- the mutein may bind to the human cation- independent mannose-6-phosphate receptor in a mannose-6-phosphate-independent manner.
- the IGF-II mutein contains a mutation within a region corresponding to amino acids 30-40 of SEQ ID NO. 12, and wherein the mutation abolishes at least one furin protease cleavage site.
- the mutation is an amino acid substitution, deletion, and/or insertion.
- the mutation is a Lys or Ala amino acid substitution at a position corresponding to Arg37 or Arg40 of SEQ ID NO. 12.
- the mutation is a deletion or replacement of amino acid residues corresponding to positions selected form the group consisting of 31 -40, 32-40, 33-40, 34-40, 30- 39, 31 -39, 32-39, 34-37, 33-39, 35-39, 36-39, 37-40, 34-40 of SEQ ID NO. 12, and combinations thereof.
- the GILT tag has an amino acid sequence having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to the amino acid sequence of SEQ NO. 13. In some embodiments, the GILT tag has an amino acid sequence having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to the amino acid sequence of SEQ NO. 14. In some embodiments, the GILT tag has an amino acid sequence having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%,
- the GILT tag has a nucleic acid sequence having at least 85 % sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to the nucleic acid sequence of SEQ ID NO. 17. In some embodiments, the GILT tag has a nucleic acid sequence having at least 85 % sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to the nucleic acid sequence of SEQ ID NO. 1 8.
- the GILT tag has a nucleic acid sequence having at least 85 % sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to the nucleic acid sequence of SEQ ID NO. 1 9.
- the GBA fusion protein contains a low-density lipoprotein receptor family (LDLRf) binding (Rb) domain of apolipoprotein E (ApoE), or a fragment, variant, or oligomer thereof.
- LDLRf low-density lipoprotein receptor family binding
- ApoE apolipoprotein E
- the Rb domain of ApoE, or a fragment, variant, or oligomer thereof is operably linked to the N-terminus of the GBA.
- the Rb domain of ApoE, or a fragment, variant, or oligomer thereof is operably linked to the C-terminus of the GBA.
- the secreted GBA fusion protein contains 1 or more (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) oligomers of the Rb domain of ApoE.
- the Rb domain contains a region of ApoE having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to residues 25-185 of SEQ ID NO. 21 .
- the Rb domain contains a region of ApoE having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to residues 50-180 of SEQ ID NO. 21 .
- the Rb domain contains a region of ApoE having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to residues 50-180 of SEQ ID NO. 21 .
- the Rb domain contains a region of ApoE having at least 70% sequence identity (e.g.,
- the Rb domain contains a region of ApoE having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to residues 100-170 of SEQ ID NO. 21 .
- the Rb domain contains a region of ApoE having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to residues 125-160 of SEQ ID NO. 21 .
- the Rb domain contains a region of ApoE having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to residues 125-160 of SEQ ID NO. 21 .
- the Rb domain contains a region of ApoE having at least 70% sequence identity (e.g.,
- the Rb domain contains a region of ApoE having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to residues 148-173 or a portion thereof containing residues 159-167 of SEQ ID NO.
- the Rb domain contains a region having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to residues 159-167 of SEQ ID NO. 21 ).
- the Rb domain contains a region having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%,
- the transgene encoding GBA further contains a micro RNA (miRNA) targeting sequence (e.g., a miR-126 targeting sequence).
- miRNA micro RNA
- the miRNA targeting sequence e.g., a miR-126 targeting sequence
- the 3’-UTR of the transgene is located within the 3’-UTR of the transgene.
- the secreted GBA penetrates the blood brain barrier (BBB) in the subject.
- BBB blood brain barrier
- the Parkinson’s disease is GBA-associated Parkinson’s disease.
- the pluripotent cells are CD34+ cells.
- the CD34+ cells are embryonic stem cells.
- the CD34+ cells are induced pluripotent stem cells.
- the CD34+ cells are hematopoietic stem cells.
- the CD34+ cells are myeloid progenitor cells.
- a population of endogenous microglia in the subject has been ablated prior to administration of the composition to the subject.
- the method includes ablating a population of endogenous microglia in the subject prior to administering the composition to the subject.
- the microglia are ablated using an agent selected from the group consisting of busulfan, PLX3397, PLX647, PLX5622, treosulfan, and clodronate liposomes, by radiation therapy, or a combination thereof.
- the composition is administered systemically to the subject.
- the composition is administered to the subject by way of intravenous injection.
- the composition is administered directly to the central nervous system of the subject.
- the composition is administered directly to the bone marrow of the subject. In some embodiments, the composition is administered to the subject by way of intraosseous injection.
- the composition is administered to the subject by way of a bone marrow transplant. In some embodiments, the composition is administered to the subject by way of
- the composition is administered to the subject by way of intravenous injection.
- the composition is administered to the subject by direct administration to the central nervous system of the subject and by systemic administration. In some embodiments, the composition is administered to the subject by way of intracerebroventricular injection and intravenous injection.
- the method includes administering to the subject a population of CD34+ cells.
- the population of CD34+ cells is administered to the subject prior to administration of the composition.
- the population of CD34+ cells is administered to the subject following administration of the composition.
- the CD34+ cells are selected from the group consisting of embryonic stem cells, induced pluripotent stem cells, hematopoietic stem cells, and myeloid progenitor cells.
- the CD34+ cells are not modified to express a transgene encoding GBA.
- the CD34+ cells are administered to the subject systemically.
- the CD34+ cells are administered to the subject by way of intravenous injection.
- endogenous GBA is disrupted in the pluripotent cells prior to
- the endogenous GBA is disrupted by contacting the pluripotent cells with a nuclease that catalyzes cleavage of an endogenous GBA nucleic acid in the pluripotent cells.
- the nuclease is a CRISPR-associated protein.
- the CRISPR- associated protein is CRISPR associated protein 9.
- the nuclease is a transcription activator-like effector nuclease, a meganuclease, or a zinc finger nuclease.
- the endogenous GBA is disrupted by contacting the pluripotent cells with an inhibitory RNA molecule, e.g., for a time and in a quantity sufficient to disrupt expression of the endogenous GBA.
- the inhibitory RNA molecule is a short interfering RNA (siRNA), a short hairpin RNA (shRNA), or a micro RNA (miRNA).
- the endogenous GBA is disrupted in the subject prior to administration of the composition to the subject. In some embodiments, the endogenous GBA is disrupted by
- the inhibitory RNA molecule is a siRNA, a shRNA, or a miRNA.
- the endogenous GBA is disrupted in a population of neurons in the subject prior to administration of the composition to the subject.
- the endogenous GBA is disrupted in a population of neurons by contacting the population of neurons with an inhibitory RNA molecule, e.g., for a time and in a quantity sufficient to disrupt expression of the endogenous GBA.
- the inhibitory RNA molecule is a siRNA, a shRNA, or a miRNA.
- the pluripotent cells that express a transgene encoding GBA further express one or more transgenes that each encode an M2-promoting agent. In some embodiments, the pluripotent cells that express a transgene encoding GBA express two transgenes that each encode an M2-promoting agent.
- the one or more transgenes that each encode an M2-promoting agent encodes a cytokine selected from the group including interleukin-25 (IL-25), interleukin-4 (IL-4), interleukin-10 (IL-10), interleukin-13 (IL-13), and transforming growth factor beta (TGF-b). In some embodiments, the one or more transgenes that each encode an M2-promoting agent encodes IL-25.
- the one or more transgenes that each encode an M2-promoting agent encodes an agent selected from the group containing a glucocorticoid receptor, a peroxisome proliferator-activated receptor (PPAR), PPARy, PPARp/d, an estrogen receptor, nuclear receptor subfamily 4 group A member 2 (NR4A2), lysine demethylase 6B (KDM6B), MSH homeobox 3 (MSX3), family with sequence similarity 19 (chemokine (C-C motif)-like), member A3 (FAM19A3), nuclear factor NF-Kappa-B P50 subunit (NF-KB p50), microRNA 124 (miR124), microRNA 21 (miR21 ), and microRNA 181 c (miR181 c), C-X3-C motif chemokine ligand 1 (CX3CL1 ), C-X3-C motif chemokine receptor 1 (CX3CR1 ), CD200 molecule (
- the pluripotent cells are autologous cells. In some embodiments, the pluripotent cells are allogeneic cells.
- the pluripotent cells are transduced ex vivo to express the GBA. In some embodiments, the pluripotent cells are transduced ex vivo to express the GBA and the one or more M2- promoting agents.
- the pluripotent cells are transduced with a viral vector selected from the group including an adeno-associated virus (AAV), an adenovirus, a parvovirus, a coronavirus, a rhabdovirus, a paramyxovirus, a picornavirus, an alphavirus, a herpes virus, a poxvirus, and a
- AAV adeno-associated virus
- the viral vector is a Retroviridae family viral vector. In some embodiments, the viral vector is a Retroviridae family viral vector.
- the Retroviridae family viral vector is a lentiviral vector. In some embodiments, the Retroviridae family viral vector is an alpharetroviral vector. In some embodiments, the Retroviridae family viral vector is a gammaretroviral vector. In some embodiments, the Retroviridae family viral vector includes a central polypurine tract, a woodchuck hepatitis virus post-transcriptional regulatory element, a 5'-LTR, HIV signal sequence, HIV Psi signal 5'-splice site, delta-GAG element, 3'-splice site, and a 3'-self inactivating LTR.
- the viral vector is an AAV selected from the group including AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, and AAVrh74. In some embodiments, the viral vector is a pseudotyped viral vector.
- the viral vector is a pseudotyped AAV, a pseudotyped adenovirus, a pseudotyped parvovirus, a pseudotyped coronavirus, a pseudotyped rhabdovirus, a pseudotyped paramyxovirus, a pseudotyped picornavirus, a pseudotyped alphavirus, a pseudotyped herpes virus, a pseudotyped poxvirus, and a pseudotyped Retroviridae family virus.
- the pluripotent cells are transduced to express the GBA and the one or more M2-promoting agents from separate, monocistronic expression cassettes.
- the pluripotent cells are transduced to express the GBA and the one or more M2-promoting agents from a polycistronic expression cassette.
- the pluripotent cells express a single M2-promoting agent, and the pluripotent cells are transduced to express the GBA and the M2-promoting agent from a bicistronic expression cassette.
- the polycistronic expression cassette includes an internal ribosomal entry site (IRES) positioned between a polynucleotide encoding the GBA and a polynucleotide encoding one of the one or more M2-promoting agents.
- IRS internal ribosomal entry site
- the polycistronic expression cassette includes a foot-and-mouth disease virus 2A (FMDV 2A) polynucleotide positioned between a polynucleotide encoding the GBA and a polynucleotide encoding one of the one or more M2-promoting agents.
- FMDV 2A foot-and-mouth disease virus 2A
- the pluripotent cells express GBA, a first M2-promoting agent, and a second M2-promoting agent from a single polycistronic expression cassette
- the polycistronic expression cassette includes a first FMDV 2A polynucleotide positioned between a polynucleotide encoding the GBA and a polynucleotide encoding the first M2-promoting agent
- the polycistronic expression cassette further includes a second FMDV 2A polynucleotide positioned between the polynucleotide encoding the first M2- promoting agent and a polynucleotide encoding the second M2-promoting agent.
- the pluripotent cells are transfected ex vivo to express the GBA. In some embodiments, the pluripotent cells are transfected ex vivo to express the GBA and the one or more M2- promoting agents.
- the pluripotent cells are transfected using an agent selected from the group including a cationic polymer, diethylaminoethyl-dextran, polyethylenimine, a cationic lipid, a liposome, calcium phosphate, an activated dendrimer, and a magnetic bead; or a technique selected from the group including electroporation, Nucleofection, squeeze-poration, sonoporation, optical transfection, Magnetofection, and impalefection.
- an agent selected from the group including a cationic polymer, diethylaminoethyl-dextran, polyethylenimine, a cationic lipid, a liposome, calcium phosphate, an activated dendrimer, and a magnetic bead or a technique selected from the group including electroporation, Nucleofection, squeeze-poration, sonoporation, optical transfection, Magnetofection, and impalefection.
- the pluripotent cells are transfected ex vivo to express the GBA and the one or more M2-promoting agents from separate, monocistronic expression cassettes.
- the monocistronic expression cassettes are located within two or more separate plasmids. In some embodiments, the monocistronic expression cassettes are located on a single plasmid.
- the pluripotent cells are transfected ex vivo to express the GBA and the one or more M2-promoting agents from a polycistronic expression cassette.
- the pluripotent cells express a single M2-promoting agent, and the pluripotent cells are transfected ex vivo to express the GBA and the M2-promoting agent from a bicistronic expression cassette.
- the polycistronic expression cassette includes an IRES positioned between a
- the polycistronic expression cassette includes an FMDV 2A polynucleotide positioned between a polynucleotide encoding the GBA and a polynucleotide encoding one of the one or more M2-promoting agents.
- the pluripotent cells express GBA, a first M2-promoting agent, and a second M2-promoting agent from a single polycistronic expression cassette
- the polycistronic expression cassette includes a first FMDV 2A polynucleotide positioned between a polynucleotide encoding the GBA and a polynucleotide encoding the first M2- promoting agent
- the polycistronic expression cassette further includes a second FMDV 2A polynucleotide positioned between the polynucleotide encoding the first M2-promoting agent and a polynucleotide encoding the second M2-promoting agent.
- expression of the GBA and/or the one or more M2-promoting agents in the pluripotent cells is driven using a ubiquitous promoter.
- Ubiquitous promoters include the elongation factor 1 -alpha promoter and the phosphoglycerate kinase 1 promoter.
- expression of the GBA and/or the one or more M2-promoting agents in the pluripotent cells is driven using a tissue- specific promoter.
- Tissue-specific promoters include CD68 molecule, C-X3-C motif chemokine receptor 1 , integrin subunit alpha M, allograft inflammatory factor 1 , purinergic receptor P2Y12, transmembrane protein 1 19, and colony stimulating factor 1 receptor.
- the transgene encoding GBA is operably linked to a polynucleotide encoding a protein destabilizing domain.
- the destabilizing domain is an FK506 binding protein 1 A (FKBP12) destabilizing domain.
- the FPBP12 destabilizing domain is an FKBP12 mutant selected from the group including F15S, V24A, H25R, E60G, L106P, M66T, R71 G, D100G, D100N, E102G, and K105I.
- the method includes administering Shield-1 to the subject in a quantity sufficient to induce expression of functional GBA.
- the destabilizing domain is an E. co//dihydrofolate reductase (ecDHFR) destabilizing domain.
- the method includes administering trimethoprim to the subject in a quantity sufficient to induce expression of functional GBA.
- the destabilizing domain is a human estrogen receptor ligand binding domain (ERLBD) destabilizing domain.
- the method includes administering CMP8 or 4-hydroxytamoxifen to the subject in a quantity sufficient to induce expression of functional GBA.
- one or more polynucleotides encoding each of the one or more M2- promoting agents in the pluripotent cells is operably linked to a protein destabilizing domain.
- the destabilizing domain is an FKBP12 destabilizing domain.
- the FPBP12 destabilizing domain is an FKBP12 mutant selected from the group containing F15S, V24A, H25R, E60G, L106P, M66T, R71 G, D100G, D100N, E102G, and K105I.
- the method includes administering Shield-1 to the subject in a quantity sufficient to induce expression of a functional M2-promoting agent.
- the destabilizing domain is an ecDHFR destabilizing domain.
- the method includes administering trimethoprim to the subject in a quantity sufficient to induce expression of a functional M2-promoting agent.
- the destabilizing domain is a human ERLBD destabilizing domain.
- the method includes administering CMP8 or 4-hydroxytamoxifen to the subject in a quantity sufficient to induce expression of a functional M2-promoting agent.
- the composition is administered to the subject in an amount sufficient to increase the quantity of M2 microglia in the brain of the subject relative to the quantity of M1 microglia in the brain of the subject, decrease the level of one or more pro-inflammatory cytokines in the brain of the subject, increase the level of one or more anti-inflammatory cytokines in the brain of the subject, improve the cognitive performance of the subject, improve the motor function of the subject, reduce dopaminergic neuron loss in the subject, and/or reduce a-synuclein levels or aggregation thereof in the subject.
- the subject is a human.
- the invention provides a composition containing a population of pluripotent cells that express (i) a first transgene encoding non-secreted GBA; and (ii) one or more transgenes that each encode an M2-promoting agent.
- the invention provides a composition containing a population of pluripotent cells that express (i) a first transgene encoding secreted GBA; and (ii) one or more transgenes that each encode an M2-promoting agent.
- the pluripotent cells are CD34+ cells.
- the CD34+ cells are embryonic stem cells.
- the CD34+ cells are induced pluripotent stem cells.
- the CD34+ cells are hematopoietic stem cells.
- the CD34+ cells are myeloid progenitor cells.
- at least one of the one or more transgenes that each encode an M2-promoting agent encodes a cytokine selected from the group consisting of IL-25, IL-4, IL-10, IL-13, and TGF-b.
- At least one of the one or more transgenes that each encode an M2-promoting agent encodes IL-25. In some embodiments, at least one of the one or more transgenes that each encode an M2-promoting agent encodes an agent selected from the group consisting of a glucocorticoid receptor, a PPAR, PPARy, PPARp/d, an estrogen receptor, NR4A2, KDM6B, MSX3, FAM19A3, NF-kB p50, miR124, miR21 , and miR181 c, CX3CL1 , CX3CR1 , CD200, CD200R, CFH, CD47, CD55, CD46, ADGRE5, SIRPa, and siglecs.
- the pluripotent cells are transduced ex vivo to express the GBA and the one or more M2-promoting agents. In some embodiments, the pluripotent cells are transfected ex vivo to express the GBA and the one or more M2-promoting agents. In some embodiments, endogenous GBA is disrupted in the pluripotent cells.
- kits containing compositions according to any of the above aspects and embodiments and a package insert In some embodiments, the package insert instructs a user of the kit to perform a method according to any of the above aspects and embodiments.
- FIG. 1 A is a diagram of an exemplary GBA transgene construct containing, in the N-terminal to C-terminal direction, a polypeptide sequence encoding a GBA signal peptide (SP) and a GBA catalytic domain that has been codon optimized for expression in human cells (GBA-co CD).
- SP GBA signal peptide
- GBA-co CD GBA catalytic domain that has been codon optimized for expression in human cells
- FIG. 1 B is a diagram of an exemplary GBA transgene construct containing, in the N-terminal to C-terminal direction, a polypeptide sequence encoding a GBA SP, an Rb domain of ApoE (Rb-ApoE), and codon-optimized GBA (GBA-co).
- FIG. 1C is a diagram of an exemplary GBA transgene construct containing, in the N-terminal to C-terminal direction, a polypeptide sequence encoding a codon-optimized human insulin-like growth factor II secretory signal peptide (IGF-ll-co SSP), a GILT-tag (GILT) containing an R37A mutation, a linker (L), and GBA-co.
- IGF-ll-co SSP codon-optimized human insulin-like growth factor II secretory signal peptide
- GILT GILT-tag
- L linker
- FIG. 1 D is a diagram of an exemplary GBA transgene construct containing, in the N-terminal to C-terminal direction, a polypeptide sequence encoding an IGF-ll-co SSP, a first linker (L), Rb-ApoE, a second linker, GILT containing an R37A mutation, a third linker, and GBA-co.
- FIG. 1 E is a diagram of an exemplary GBA transgene construct containing, in the N-terminal to C- terminal direction, a polypeptide sequence encoding an IGF-ll-co SSP, GILT containing an R37A mutation, a linker, Rb-ApoE, a linker, and GBA-co containing a micro RNA targeting sequence (miRT) in the three prime untranslated region (3’-UTR).
- miRT micro RNA targeting sequence
- FIG. 1 F is a diagram of an exemplary GBA transgene construct containing, in the N-terminal to C- terminal direction, a polypeptide sequence encoding an IGF-ll-co SSP, a first linker (L), GBA-co, a second linker, and GILT containing a R37A mutation.
- FIG. 1G is a diagram of an exemplary GBA transgene construct containing, in the N-terminal to C-terminal direction, a polypeptide sequence encoding an IGF-ll-co SSP, a first linker (L), GBA-co, a second linker, and Rb-ApoE.
- FIGS. 2A-2D are a series of bar plots demonstrating GBA enzymatic activity and protein levels in mammalian cell lines transduced with either green fluorescent protein (GFP) or GBA constructs.
- FIG. 2A and FIG. 2C show GBA enzymatic activity measured from cell lysates of human HEK293T cells and mouse RAW264.7 cells, respectively, following lentiviral transduction with GFP (black bars) or codon- optimized GBA (GBAco) constructs (grey bars).
- GBA enzymatic activity was measured in using a 4- methylumbelliferyl b-D-glucopyranoside (4MUG) substrate, which is enzymatically converted by GBA to produce a fluorescent product, 4-Methylumbelliferone (4MU).
- Tested GBAco constructs included: 1 ) GBAco alone; 2) GBAco, a C-terminal glycosylation independent lysosomal targeting (GILT) tag, and a peptide linker; 3) GBAco and a modified signal peptide sequence; 4) GBAco, a GILT tag, and a rigid peptide linker; or 5) GBAco, a GILT tag, and an XTEN linker.
- FIG. 3 is a Western blot analysis of glycosylated, transgene-derived GBA taken from cell lysates of HEK293T cells.
- Cells were transduced with one of three lentivirally-encoded GBAco constructs selected from the group including: 1 ) GBAco alone; 2) GBAco, a GILT tag, and a rigid peptide linker; or 3) GBAco, a GILT tag, and an XTEN linker.
- Cell lysates were treated with either EndoH or PNGase F glycosidases to assess changes in N-linked glycosylation through increased electrophoretic mobility.
- FIGS. 4A-4B are a series of bar plots demonstrating GBA enzymatic activity in mouse lineage negative (Lin ) cells from wildtype and GBA mutant mice. Lin- cells were isolated from the bone marrow and transduced with lentiviral vectors encoding GFP or GBAco.
- FIG. 1
- FIG. 4A shows a bar plot of GBA enzymatic activity in Lin- cell lysate from wildtype and GBA-deficient transgenic mice (Gba D409V/+ , Gba D409V/+ ; Thy 1 -S/VCA and Gba D409V D409V ) transduced with a vector encoding GFP (black bars) or GBAco (grey bars).
- lentiviral GBAco constructs produce a functional GBA enzyme in hematopoietic stem cells (e.g., mouse Lin- cells) and can rescue GBA activity and expression levels in mouse models of GBA deficiency.
- hematopoietic stem cells e.g., mouse Lin- cells
- “administration” refers to providing or giving a subject a therapeutic agent (e.g., pluripotent cells, such as CD34+ cells, that express a transgene encoding GBA or pluripotent cells that express a transgene encoding GBA.
- a therapeutic agent e.g., pluripotent cells, such as CD34+ cells, that express a transgene encoding GBA or pluripotent cells that express a transgene encoding GBA.
- the pluripotent cells that express a transgene encoding GBA may additionally express one or more transgenes that each encode an M2-promoting agent), by any effective route.
- routes of administration are described herein below (e.g., intracerebroventricular (ICV) injection, intravenous (IV) injection, and stereotactic injection).
- allogeneic means cells, tissue, DNA, or factors taken or derived from a different subject of the same species.
- pluripotent cells derived from cells obtained from a patient that is not the subject are transduced or transfected with a vector that directs the expression of GBA and, optionally, one or more M2-promoting agents and the transduced cells are administered to the subject.
- directs expression refers to the polynucleotide containing a sequence that encodes the molecule to be expressed.
- the polynucleotide may contain additional sequence that enhances expression of the molecule in question.
- autologous refers to cells, tissue, DNA, or factors taken or derived from an individual's own tissues, cells, or DNA.
- pluripotent cells derived from cells obtained from the subject are transduced or transfected with a vector that directs the expression of GBA and, optionally, one or more M2-promoting agents and the transduced cells are administered to the subject.
- ApoE refers to apolipoprotein E, a member of a class of proteins involved in lipid transport.
- Apolipoprotein E is a fat-binding protein (apolipoprotein) that is part of the chylomicron and intermediate-density lipoprotein (IDLs). These are essential for the normal processing (catabolism) of triglyceride-rich lipoproteins. ApoE is encoded by the APOE gene.
- ApoE also refers to variants of the wild-type ApoE protein, such as proteins having at least 85% identity (e.g., 85%, 86% e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identity, or more) to the amino acid sequence of wild-type ApoE, which is set forth in SEQ ID NO. 21 .
- cell type refers to a group of cells sharing a phenotype that is statistically separable based on gene expression data.
- cells of a common cell type may share similar structural and/or functional characteristics, such as similar gene activation patterns and antigen presentation profiles.
- Cells of a common cell type may include those that are isolated from a common tissue (e.g., epithelial tissue, neural tissue, connective tissue, or muscle tissue) and/or those that are isolated from a common organ, tissue system, blood vessel, or other structure and/or region in an organism.
- “codon optimization” refers a process of modifying a nucleic acid sequence in accordance with the principle that the frequency of occurrence of synonymous codons (e.g., codons that code for the same amino acid) in coding DNA is biased in different species. Such codon degeneracy allows an identical polypeptide to be encoded by a variety of nucleotide sequences. Sequences modified in this way are referred to herein as“codon-optimized.” This process may be performed on any of the sequences described in this specification to enhance expression or stability. Codon optimization may be performed in a manner such as that described in, e.g., U.S. Patent Nos.
- condition and“conditioning” refer to processes by which a subject is prepared for receipt of a transplant containing pluripotent stem cells (e.g., CD34+ cells). Such procedures promote the engraftment of a pluripotent stem cell transplant, for example, by selectively depleting endogenous microglia or hematopoietic stem cells, thereby creating a vacancy filled by an exogenous pluripotent stem cell transplant.
- pluripotent stem cells e.g., CD34+ cells
- a subject may be conditioned for pluripotent stem cell transplant therapy by administration to the subject of one or more agents capable of ablating endogenous microglia and/or hematopoietic stem or progenitor cells (e.g., busulfan, treosulfan, PLX3397, PLX647, PLX5622, and clodronate liposomes), radiation therapy, or a combination thereof.
- Conditioning may be myeloablative or non-myeloablative.
- Other cell-ablating agents and methods well known in the art e.g., antibody-drug conjugates may also be used.
- the terms“conservative mutation,”“conservative substitution,” and“conservative amino acid substitution” refer to a substitution of one or more amino acids for one or more different amino acids that exhibit similar physicochemical properties, such as polarity, electrostatic charge, and steric volume. These properties are summarized for each of the twenty naturally-occurring amino acids in table 1 below. Table 1. Representative physicochemical properties of naturally-occurring amino acids
- conservative amino acid families include (i) G, A, V, L and I; (ii) D and E; (iii) C, S and T; (iv) H, K and R; (v) N and Q; and (vi) F, Y and W.
- a conservative mutation or substitution is therefore one that substitutes one amino acid for a member of the same amino acid family (e.g., a substitution of Ser for Thr or Lys for Arg).
- the terms“destabilizing domain” and“destabilization domain” refer to regulatory elements capable of destabilizing the proteins to which they are operably linked. These domains can be stabilized by specific exogenous ligands, such as small molecules.
- Exemplary destabilizing domains include mutants of the human FK506- and rapamycin-binding protein (FKBP12), which confer instability to other proteins fused to these destabilizing domains.
- FKBP12 mutants include N-terminal mutants F15S, V24A, H25R, E60G, and L106P, and C-terminal mutants M66T, R71 G, D100G, D100N, E102G, and K105I, as characterized in Banaszynski et al. , Cell 126:995 (2006), the disclosure of which is incorporated herein by reference as it pertains to FKBP12 destabilizing domains.
- FKBP12 destabilizing domains promote protein degradation.
- the small molecule ligand Shield-1 can be used to stabilize FKBP12 mutant-containing proteins by protecting them from degradation.
- Other destabilizing domains that can be used to regulate expression of GBA or M2-promoting agents include mutants of the E. coli dihydrofolate reductase (ecDHFR) and mutants of the human estrogen receptor ligand binding domain (ERLBD), which confer instability resulting in degradation when fused to a protein of interest and can be stabilized by small molecule ligand trimethoprim (TMP), or by CMP8 or 4-hydroxytamoxifen (40HT), respectively, as described in Iwamoto et al., Chem Biol. 17:981 (2010) and Miyazaki et al., J Am Chem Soc., 134:3942 (2012), the disclosures of each of which are incorporated herein by reference as they pertain to destabilization domain systems.
- TMP small molecule ligand trimethoprim
- 40HT 4-hydroxytamoxifen
- the term“disrupt”, with respect to a gene refers to preventing the formation of a functional gene product.
- a gene product is functional if it fulfills its normal (wild-type) functions.
- Disruption of the gene prevents expression of a functional factor encoded by the gene and contains an insertion, deletion, or substitution of one or more bases in a sequence encoded by the gene and/or a promoter and/or an operator that is necessary for expression of the gene in the animal.
- the disrupted gene may be disrupted by, e.g., removal of at least a portion of the gene from a genome of the animal, alteration of the gene to prevent expression of a functional factor encoded by the gene, an interfering RNA, or expression of a dominant negative factor by an exogenous gene.
- pluripotent stem/progenitor cells e.g., CD34+ cells
- Methods for genetically modifying pluripotent stem/progenitor cells are detailed in US 8,518,701 ; US 2010/0251395; and US 2012/0222143, the disclosures of each of which are incorporated herein by reference in their entirety (in case of conflict, the instant specification is controlling).
- the terms“effective amount,”“therapeutically effective amount,” and a“sufficient amount” of composition, vector construct, viral vector, or cell described herein refer to a quantity sufficient to, when administered to the subject, including a mammal, for example a human, effect beneficial or desired results, including clinical results, and, as such, an“effective amount” or synonym thereto depends upon the context in which it is being applied. For example, in the context of treating Parkinson’s disease, it is an amount of the composition, vector construct, viral vector, or cell sufficient to achieve a treatment response as compared to the response obtained without administration of the composition, vector construct, viral vector or cell.
- a“therapeutically effective amount” of a composition, vector construct, viral vector, or cell of the present disclosure is an amount which results in a beneficial or desired result in a subject as compared to a control.
- a therapeutically effective amount of a composition, vector construct, viral vector, or cell of the present disclosure may be readily determined by one of ordinary skill by routine methods known in the art. Dosage regime may be adjusted to provide the optimum therapeutic response.
- embryonic stem cell and "ES cell” refer to an embryo-derived totipotent or pluripotent stem cell, derived from the inner cell mass of a blastocyst that can be maintained in an in vitro culture under suitable conditions.
- ES cells are capable of differentiating into cells of any of the three vertebrate germ layers, e.g., the endoderm, the ectoderm, or the mesoderm.
- ES cells are also characterized by their ability propagate indefinitely under suitable in vitro culture conditions. See, for example, Thomson et al. , Science 282:1 145 (1998).
- the term“endogenous” describes a molecule (e.g., a polypeptide, nucleic acid, or cofactor) that is found naturally in a particular organism (e.g., a human) or in a particular location within an organism (e.g., an organ, a tissue, or a cell, such as a human cell).
- the term“express” refers to one or more of the following events: (1 ) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5' cap formation, and/or 3' end processing); (3) translation of an RNA into a polypeptide or protein; and (4) post-translational modification of a polypeptide or protein.
- Expression of a gene of interest in a subject can manifest, for example, by detecting: an increase in the quantity or concentration of mRNA encoding a corresponding protein (as assessed, e.g., using RNA detection procedures described herein or known in the art, such as quantitative polymerase chain reaction (qPCR) and RNA seq techniques), an increase in the quantity or concentration of a corresponding protein (as assessed, e.g., using protein detection methods described herein or known in the art, such as enzyme- linked immunosorbent assays (ELISA), among others), and/or an increase in the activity of a RNA detection procedures described herein or known in the art, such as quantitative polymerase chain reaction (qPCR) and RNA seq techniques), an increase in the quantity or concentration of a corresponding protein (as assessed, e.g., using protein detection methods described herein or known in the art, such as enzyme- linked immunosorbent assays (ELISA), among others), and/or an increase in the activity of a RNA detection procedures described here
- corresponding protein in the case of an enzyme, as assessed using an enzymatic activity assay described herein or known in the art
- a sample obtained from the subject e.g., in the case of an enzyme, as assessed using an enzymatic activity assay described herein or known in the art
- exogenous describes a molecule (e.g., a polypeptide, nucleic acid, or cofactor) that is not found naturally in a particular organism (e.g., a human) or in a particular location within an organism (e.g., an organ, a tissue, or a cell, such as a human cell).
- Exogenous materials include those that are provided from an external source to an organism or to cultured matter extracted there from.
- FMDV 2A refers to the 2A nucleic acid sequence of the food-and- mouth disease virus.
- an FMDV 2A sequence is a feature that allows the coordinated expression of multiple proteins in equimolar amounts from a single open reading frame.
- FMDV 2A mediates a cotranslational cleavage event, which separates proteins linked by 2A sequences.
- Multiple 2A sequences may be used in one vector, and coexpression of proteins linked by 2A will work in most eukaryotic cells as cleavage activity depends on eukaryotic ribosomes.
- FMDV 2A to express multiple proteins, see Ryan and Drew, EMBO Journal 13:928 (1994), the disclosure of which is incorporated herein by reference.
- a stem cell such as a fibroblast
- hematopoietic stem cell refers to the functional properties of stem cells which include 1 ) multi-potency (which refers to the ability to differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, platelets), monocytes (e.g., monocytes, macrophages), dendritic cells, microglia, osteoclasts, and lymphocytes (e.g., NK cells, B-cells and T-cells), 2) self-renewal (which refers to the ability of stem cells to give rise to daughter cells that have equivalent potential as the mother cell, and further that this ability can repeatedly occur throughout the lifetime of an individual without exhaustion), and 3) the ability of stem cells
- furin-resistant IGF-II mutein refers to an insulin-like growth factor II (IGF- ll)-based peptide containing an altered amino acid sequence relative to wild-type IGF-II (SEQ ID NO. 12) that abolishes at least one native furin protease cleavage site or changes a sequence close or adjacent to a native furin protease cleavage site such that the furin cleavage is prevented, inhibited, reduced, or slowed down as compared to a wild-type human IGF-II peptide.
- IGF- ll insulin-like growth factor II
- a furin-resistant IGF-II mutein is also referred to as an IGF-II mutein that is resistant to furin.
- exemplary furin-resistant IGF-II muteins contain amino acid substitutions at positions corresponding to Arg37 and/or Arg40 of SEQ ID NO. 12.
- furin protease cleavage site refers to the amino acid sequence of a peptide or protein that serves as a recognition sequence for enzymatic protease cleavage by furin or furin-like proteases.
- a furin protease cleavage site has a consensus sequence Arg-X-X-Arg, where X is any amino acid. The cleavage site is positioned after the carboxy-terminal arginine (Arg) residue in the sequence.
- a furin cleavage site has a consensus sequence Lys/Arg-X-X-X-Lys/Arg- Arg, where X is any amino acid.
- the cleavage site is positioned after the carboxy-terminal arginine (Arg) residue in the sequence.
- furin refers to any protease that can recognize and cleave the furin protease cleavage site as defined herein, including furin or furin-like protease.
- Furin is also known as paired basic amino acid cleaving enzyme (PACE).
- PACE paired basic amino acid cleaving enzyme
- Furin belongs to the subtilisin-like proprotein convertase family.
- the gene encoding furin is known as FUR (FES Upstream Region).
- GILT glycosylation independent lysosomal targeting
- M6P mannose-6-phosphate
- a GILT tag may be used to target a protein (e.g., GBA) expressed as a GILT-tagged fusion protein (e.g., a GBA fusion protein coupled to an IGF-II mutein), to the lysosome.
- Cl- MPR cation-independent mannose-6-phosphate receptor
- M6P/IGF-II receptor CI-MPR/IGF-II receptor
- IGF-II receptor IGF2 Receptor
- patients suffering from“G BA-associated Parkinson’s disease” or“GBA- associated PD” are those patients that have been diagnosed as having Parkinson’s disease and also contain a deleterious mutation in the GBA gene.
- Severely pathogenic mutations include c.84GGIns, IVS2 + 1 G > A, p.V394L, p.D409H, p.L444P and RecTL, which are linked to a 9.92 to 21 .29 odds-ratio of developing PD.
- Mild GBA mutations p.N370S and p.R496H are linked to an odds-ratio of 2.84-4.94 of developing PD.
- the mutation p.E326K has also been identified as a PD risk factor.
- GBA mutations are discussed in in Barkhuizen et al. , Neurochemistry International 93:6 (2016) and Sidransky and Lopez, Lancet Neurol. 1 1 :986 (2012), the disclosures of which are incorporated herein by reference as they pertain to human GBA mutations.
- glucocerebrosidase and“GBA” refer to the lysosomal enzyme responsible for the metabolism of glucocerebroside (also known as glucosylceramide) to glucose and ceramide.
- the gene is located on chromosome 1 q21 and is also known as GBA1 .
- glucocerebrosidase and“GBA” also refer to variants of wild-type glucocerebrosidase enzymes and nucleic acids encoding the same, such as variant proteins having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identity, or more) to the amino acid sequence of a wild-type GBA enzyme (e.g., SEQ ID NO.
- GBA may also refer to a GBA protein in which the natural signal peptide is present.
- “glucocerebrosidase” and“GBA” may also refer to codon-optimized polynucleotides encoding GBA, such as codon-optimized polynucleotides having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identity, or more) to the nucleic acid sequence of SEQ ID NO. 3.
- “GBA” may refer to a GBA protein in which the natural signal peptide has been removed (e.g., the mature protein).
- GBA may also refer to the catalytic domain of GBA, such as a domain containing residues 76-381 and 416-430 of SEQ ID NO. 1 , or a variant having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to such a domain.
- GBA may refer to the lysosomal enzyme or the gene encoding this protein, depending upon the context, as will be appreciated by one of skill in the art.
- hematopoietic stem cells and “HSCs” refer to immature blood cells having the capacity to self-renew and to differentiate into mature blood cells of diverse lineages including but not limited to granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g.,
- CD34+ cells are immature cells that express the CD34 cell surface marker. In humans, CD34+ cells are believed to include a subpopulation of cells with the stem cell properties defined above, whereas in mice, HSCs are CD34-. In addition, HSCs also refer to long term repopulating HSC (LT-HSC) and short-term repopulating HSC (ST-HSC).
- LT-HSC long term repopulating HSC
- ST-HSC short-term repopulating HSC
- LT-HSC and ST-HSC are differentiated, based on functional potential and on cell surface marker expression.
- human HSC are a CD34+, CD38-, CD45RA-, CD90+, CD49F+, and lin- (negative for mature lineage markers including CD2, CD3, CD4, CD7, CD8, CD10, CD1 1 B, CD19, CD20, CD56, CD235A).
- bone marrow LT-HSC are CD34-, SCA-1 +, C-kit+, CD135-, Slamf1/CD150+, CD48-, and lin- (negative for mature lineage markers including Ter1 19, CD1 1 b, Gr1 , CD3, CD4, CD8, B220, IL-7ra), whereas ST-HS Care CD34+, SCA-1 +, C-kit+, CD135-, Slamf1/CD150+, and lin- (negative for mature lineage markers including Ter1 19, CD1 1 b, Gr1 , CD3, CD4, CD8, B220, IL-7ra).
- ST-HSC are less quiescent (i.e.
- LT-HSC have greater self-renewal potential (i.e., they survive throughout adulthood, and can be serially transplanted through successive recipients), whereas ST-HSC have limited self-renewal (i.e., they survive for only a limited period of time, and do not possess serial transplantation potential).
- ST-HSCs are useful because they are highly proliferative and thus, can more quickly give rise to differentiated progeny.
- HLA-matched refers to a donor-recipient pair in which none of the HLA antigens are mismatched between the donor and recipient, such as a donor providing a hematopoietic stem cell graft to a recipient in need of hematopoietic stem cell transplant therapy.
- HLA-matched i.e., where all of the 6 alleles are matched
- donor-recipient pairs have a decreased risk of graft rejection, as endogenous T cells and NK cells are less likely to recognize the incoming graft as foreign, and are thus less likely to mount an immune response against the transplant.
- HLA-mismatched refers to a donor-recipient pair in which at least one HLA antigen, in particular with respect to HLA-A, HLA-B, HLA-C, and HLA-DR, is mismatched between the donor and recipient, such as a donor providing a hematopoietic stem cell graft to a recipient in need of hematopoietic stem cell transplant therapy.
- HLA-mismatched refers to a donor-recipient pair in which at least one HLA antigen, in particular with respect to HLA-A, HLA-B, HLA-C, and HLA-DR, is mismatched between the donor and recipient, such as a donor providing a hematopoietic stem cell graft to a recipient in need of hematopoietic stem cell transplant therapy.
- one haplotype is matched and the other is mismatched.
- HLA-mismatched donor-recipient pairs may have an increased risk of graft rejection relative to HLA-matched donor-recipient pairs, as endogenous T cells and NK cells are more likely to recognize the incoming graft as foreign in the case of an HLA-mismatched donor-recipient pair, and such T cells and NK cells are thus more likely to mount an immune response against the transplant.
- iPS cell As used herein, the terms "induced pluripotent stem cell,” “iPS cell,” and“iPSC” refer to a pluripotent stem cell that can be derived directly from a differentiated somatic cell.
- Human iPS cells can be generated by introducing specific sets of reprogramming factors into a non- pluripotent cell that can include, for example, Oct3/4, Sox family transcription factors (e.g., Sox1 , Sox2, Sox3, Soxl5), Myc family transcription factors (e.g., c-Myc, 1 -Myc, n-Myc), Kruppel-like family (KLF) transcription factors (e.g.,
- Human iPS cells can also be generated, for example, by the use of miRNAs, small molecules that mimic the actions of transcription factors, or lineage specifiers.
- Human iPS cells are characterized by their ability to differentiate into any cell of the three vertebrate germ layers, e.g., the endoderm, the ectoderm, or the mesoderm. Human iPS cells are also characterized by their ability propagate indefinitely under suitable in vitro culture conditions. See, for example, Takahashi and Yamanaka, Cell 126:663 (2006).
- IRES refers to an internal ribosomal entry site.
- an IRES sequence is a feature that allows eukaryotic ribosomes to bind an mRNA transcript and begin translation without binding to a 5' capped end.
- An mRNA containing an IRES sequence produces two translation products, one initiating form the 5’ end of the mRNA and the other from an internal translation mechanism mediated by the IRES.
- M2-promoting agent refers to an agent that affects the polarization of macrophages or microglia by shifting cells toward a more anti-inflammatory state.
- M2-promoting agents include those that can reduce secretion and/or expression of pro-inflammatory cytokines and genes associated with classical activation/M1 by macrophages or microglia, e.g., IL-1 b, tumor necrosis factor (TNF), iNOS, or IL-12.
- M2-promoting agents are substances capable of reducing secretion or expression of pro-inflammatory cytokines and genes associated with classical M1 activation, such as IL-1 b, TNF, iNOS, or IL-12 by 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 200%, 500%, or more, when a population of activated macrophages or microglia is cultured in the presence of the substance, for example, for a period of from about 2 hours to 24 hours (e.g., for a period of about 2 hours, 4 hours, 6 hours, 8 hours, 10 hours, 12 hours, 14 hours,
- M2-promoting agents additionally include those capable of increasing the secretion and/or expression of anti-inflammatory cytokines and genes associated with alternative activation/M2 by macrophages or microglia, e.g., IL-25, IL-10, transforming growth factor beta (TGF-b), CD163, or TREM2, or altering cell morphology or shape, e.g., increasing ramification.
- macrophages or microglia e.g., IL-25, IL-10, transforming growth factor beta (TGF-b), CD163, or TREM2, or altering cell morphology or shape, e.g., increasing ramification.
- M2-promoting agents are substances capable of increasing secretion or expression of anti-inflammatory cytokines and genes associated with alternative M2 activation, such as IL-10, TGF-b, CD163, or TREM2 by 10%, 1 5%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 200%, 500%, or more, when a population of activated macrophages or microglia is cultured in the presence of the substance, for example, for a period of from about 2 hours to 24 hours (e.g., for a period of about 2 hours, 4 hours, 6 hours, 8 hours, 10 hours, 12 hours, 14 hours, 16 hours, 18 hours, 20 hours, 22 hours, or 24 hours).
- Techniques suitable for determining the concentration of a secreted cytokine in a cell culture medium are, for example, enzyme- linked immunosorbent assays (ELISA) known in the art. Additionally, techniques that can be used to quantify the expression of a gene of interest include, without limitation, quantitative reverse-transcriptase polymerase chain reaction (RT-PCR) assays known in the art.
- ELISA enzyme- linked immunosorbent assays
- RT-PCR quantitative reverse-transcriptase polymerase chain reaction
- RNA or DNA construct that contains the coding sequence for a single protein or polypeptide product.
- myeloablative or“myeloablation” refers to a conditioning regiment that substantially impairs or destroys the hematopoietic system, typically by exposure to a cytotoxic agent (e.g., busuifan) or radiation.
- Myeloablation encompasses complete myeloablation brought on by high doses of cytotoxic agent or totai body irradiation that destroys the hematopoietic system.
- non-myeloablative or“myelosuppressive” refers to a conditioning regiment that does not eliminate substantially all hematopoietic cells of host origin.
- polycistronic refers to an RNA or DNA construct that contains the coding sequence for more than one protein or polypeptide product.
- exemplary polycistronic vectors include those described in WO 1993/003143, Ryan and Drew, EMBO Journal 13:928 (1 994), Szymczak and Vignali, Expert Opin Biol Ther. 5:627 (2005), Szymczak et al ., Nat Biotechnol. 22:589 (2004), and Osborn et al., Molecular Therapy 12:569 (2005).
- the term“pluripotent cell” refers to a cell that possesses the ability to develop into more than one differentiated cell type, such as a cell type of the hematopoietic lineage (e.g., granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, platelets), monocytes (e.g., monocytes, macrophages), dendritic cells, microglia, osteoclasts, and lymphocytes (e.g., NK cells, B-cells and T-cells).
- a cell type of the hematopoietic lineage e.g., granulocytes (e.g., promyelocytes, neutrophils, eosinophils,
- pluripotent cells are embryonic stem cells (ES cells) and induced pluripotent stem cells (iPS cells or iPSCs).
- exemplary pluripotent cells are CD34+ cells.
- plasmid refers to a to an extrachromosomal circular double stranded DNA molecule into which additional DNA segments may be ligated.
- a plasmid is a type of vector, a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- Certain plasmids are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial plasmids having a bacterial origin of replication and episomal mammalian plasmids).
- vectors e.g., non-episomal mammalian vectors
- Other vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- Certain plasmids are capable of directing the expression of genes to which they are operably linked.
- promoter refers to a recognition site on DNA that is bound by an RNA polymerase.
- the polymerase drives transcription of the transgene.
- Exemplary promoters suitable for use with the compositions and methods described herein are described, for example, in Sandelin et al. ,
- Percent (%) sequence identity with respect to a reference polynucleotide or polypeptide sequence is defined as the percentage of nucleic acids or amino acids in a candidate sequence that are identical to the nucleic acids or amino acids in the reference polynucleotide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent nucleic acid or amino acid sequence identity can be achieved in various ways that are within the capabilities of one of skill in the art, for example, using publicly available computer software such as BLAST, BLAST-2, or Megalign software.
- percent sequence identity values may be generated using the sequence comparison computer program BLAST.
- percent sequence identity of a given nucleic acid or amino acid sequence, A, to, with, or against a given nucleic acid or amino acid sequence, B, (which can alternatively be phrased as a given nucleic acid or amino acid sequence, A that has a certain percent sequence identity to, with, or against a given nucleic acid or amino acid sequence, B) is calculated as follows:
- X is the number of nucleotides or amino acids scored as identical matches by a sequence alignment program (e.g., BLAST) in that program’s alignment of A and B
- Y is the total number of nucleic acids in B. It will be appreciated that where the length of nucleic acid or amino acid sequence A is not equal to the length of nucleic acid or amino acid sequence B, the percent sequence identity of A to B will not equal the percent sequence identity of B to A.
- the term“pharmaceutically acceptable” refers to those compounds, materials, compositions and/or dosage forms, which are suitable for contact with the tissues of a subject, such as a mammal (e.g., a human) without excessive toxicity, irritation, allergic response and other problem complications commensurate with a reasonable benefit/risk ratio.
- a potent“receptor-binding peptide (Rb) derived from ApoE” has the ability to translocate proteins across the BBB into the brain when engineered as fusion proteins. This method can therefore function to selectively open the BBB for therapeutic agents (e.g., soluble GBA) when engineered as a fusion protein.
- This peptide can be readily attached to diagnostic or therapeutic agents without jeopardizing their biological functions or interfering with the important biological functions of ApoE due to the utilization of the Rb domain of ApoE, rather than the entire ApoE protein.
- This pathway is also an alternative uptake pathway that can facilitate further/secondary distribution within the brain after the agents reach the CNS due to the widespread expression of LDLRf members in brain parenchyma.
- Rb domains can be found in the N-terminus of ApoE.
- Rb domains useful in conjunction with the compositions and methods described herein are polypeptides having the amino acid sequence of residues 1 to 191 of SEQ ID NO. 21 , residues 25 to 185 of SEQ ID NO. 21 , residues 50 to 180 of SEQ ID NO. 21 , residues 75 to 175 of SEQ ID NO. 21 , residues 100 to 170 of SEQ ID NO. 21 , or residues 125 to 165 of SEQ ID NO.
- An exemplary Rb domain is the region of ApoE having the amino acid sequence of residues 159 to 167 of SEQ ID NO. 21 .
- regulatory sequence includes promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
- promoters include promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
- promoters include promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
- promoters include promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
- promoters include promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
- sample refers to a specimen (e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells) isolated from a subject.
- a specimen e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells
- secretory signal peptide refers to a short (usually between 16-60 amino acids) peptide region within the precursor protein that directs secretion of the precursor protein from the cytoplasm of the host into the periplasmic space or into the extracellular space.
- Such secretory signal peptides are generally located at the amino terminus of the precursor protein.
- the secretory signal peptide is linked to the amino terminus and may be heterologous to the protein to which it is linked.
- secretory signal peptides are cleaved during transit through the cellular secretion pathway. Cleavage is not essential as long as the secreted protein retains its desired activity.
- Exemplary secretory signal peptides include those from IGF-II, alpha-1 antitrypsin, and GBA.
- signal peptide refers to a short (usually between 16-60 amino acids) polypeptide present on precursor proteins (typically at the N terminus), which is typically absent from the mature protein.
- the signal peptide directs the transport of the translated protein through the cell membrane.
- Signal peptides may also be called targeting signals, transit peptides, localization signals, or signal sequences.
- the signal sequence may be a co-translational or post-translational signal peptide.
- Exemplary signal peptides include the GBA signal peptide (e.g., a 39-amino acid GBA signal peptide as described in Sorge et al. , Am. J. Hum. Genet. 41 :1016-1024 (1987); incorporated herein by reference).
- stem cell and “undifferentiated cell” refer to a cell in an
- a stem cell is capable of proliferation and giving rise to more such stem cells while maintaining its functional potential.
- Stem cells can divide asymmetrically, which is known as obligatory asymmetrical differentiation, with one daughter cell retaining the functional potential of the parent stem cell and the other daughter cell expressing some distinct other specific function, phenotype and/or developmental potential from the parent cell.
- the daughter cells themselves can be induced to proliferate and produce progeny that subsequently differentiate into one or more mature cell types, while also retaining one or more cells with parental developmental potential.
- a differentiated cell may derive from a multipotent cell, which itself is derived from a multipotent cell, and so on.
- stem cell refers to any subset of cells that have the developmental potential, under particular circumstances, to differentiate to a more specialized or differentiated phenotype, and which retain the capacity, under certain circumstances, to proliferate without substantially differentiating.
- stem cell refers generally to a naturally occurring parent cell whose descendants (progeny cells) specialize, often in different directions, by differentiation, e.g., by acquiring completely individual characters, as occurs in progressive diversification of embryonic cells and tissues.
- Some differentiated cells also have the capacity to give rise to cells of greater developmental potential. Such capacity may be natural or may be induced artificially upon treatment with various factors.
- stem cells that begin as stem cells might proceed toward a differentiated phenotype, but then can be induced to "reverse” and re-express the stem cell phenotype, a term often referred to as “dedifferentiation” or “reprogramming” or
- transfection refers to any of a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g.,
- transgene refers to a recombinant nucleic acid (e.g., DNA or cDNA) encoding a gene product (e.g., GBA).
- the gene product may be an RNA, peptide, or protein.
- the transgene may include or be operably linked to one or more elements to facilitate or enhance expression, such as a promoter, enhancer(s), destabilizing domain(s), response element(s), reporter element(s), insulator element(s), polyadenylation signal(s) and/or other functional elements.
- a promoter, enhancer(s), destabilizing domain(s), response element(s), reporter element(s), insulator element(s), polyadenylation signal(s) and/or other functional elements may utilize any known suitable promoter, enhancer(s), destabilizing domain(s), response element(s), reporter element(s), insulator element(s), polyadenylation signal(s), and/or other functional elements.
- the terms“subject” and“patient” refer to an animal (e.g., a mammal, such as a human).
- a subject to be treated according to the methods described herein may be one who has been diagnosed with Parkinson’s disease or GBA-associated Parkinson’s disease, or one at risk of developing these conditions. Diagnosis may be performed by any method or technique known in the art.
- a subject to be treated according to the present disclosure may have been subjected to standard tests or may have been identified, without examination, as one at risk due to the presence of one or more risk factors associated with the disease or condition.
- transduction and“transduce” refer to a method of introducing a vector construct or a part thereof into a cell.
- the vector construct is contained in a viral vector such as for example a lentiviral vector
- transduction refers to viral infection of the cell, and subsequent transfer and integration of the vector construct or part thereof into the cell genome.
- treatment and“treating” in reference to a disease or condition, refer to an approach for obtaining beneficial or desired results, e.g., clinical results.
- beneficial or desired results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions;
- “Ameliorating” or“palliating” a disease or condition means that the extent and/or undesirable clinical manifestations of the disease, disorder, or condition are lessened and/or time course of the progression is slowed or lengthened, as compared to the extent or time course in the absence of treatment. “Treatment” can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder, as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
- the term“vector” includes a nucleic acid vector, e.g., a DNA vector, such as a plasmid, a RNA vector, virus, or other suitable replicon (e.g., viral vector).
- a DNA vector such as a plasmid, a RNA vector, virus, or other suitable replicon (e.g., viral vector).
- a variety of vectors have been developed for the delivery of polynucleotides encoding exogenous proteins into a prokaryotic or eukaryotic cell. Examples of such expression vectors are disclosed in, e.g., WO 1994/01 1026;
- Expression vectors suitable for use with the compositions and methods described herein contain a polynucleotide sequence as well as, e.g., additional sequence elements used for the expression of proteins and/or the integration of these polynucleotide sequences into the genome of a mammalian cell.
- Certain vectors that can be used for the expression of GBA and M2-promoting agents as described herein include plasmids that contain regulatory sequences, such as promoter and enhancer regions, which direct gene transcription.
- GBA and M2-promoting agents contain polynucleotide sequences that enhance the rate of translation of these genes or improve the stability or nuclear export of the mRNA that results from gene transcription. These sequence elements include, e.g., 5’ and 3’ untranslated regions, an internal ribosomal entry site (IRES), and polyadenylation signal site in order to direct efficient transcription of the gene carried on the expression vector.
- the expression vectors suitable for use with the compositions and methods described herein may also contain a polynucleotide encoding a marker for selection of cells that contain such a vector. Examples of a suitable marker are genes that encode resistance to antibiotics, such as ampicillin, chloramphenicol, kanamycin, nourseothricin, or zeocin.
- compositions and methods for the treatment of Parkinson’s disease in a subject (such as a mammalian subject, for example, a human).
- a subject such as a mammalian subject, for example, a human.
- one can treat Parkinson’s disease e.g., GBA-associated Parkinson’s disease
- a subject e.g., a human subject
- pluripotent cells such as CD34+ cells
- GBA transgene encoding glucocerebrosidase
- compositions containing pluripotent cells that have been modified ex-vivo to express GBA.
- the sections that follow describe the compositions and methods useful for the treatment of Parkinson’s disease in further detail. Parkinson’s disease
- PD is a progressive disorder that affects movement, and it is recognized as the second most common neurodegenerative disease after Alzheimer’s disease.
- Common symptoms of PD include resting tremor, rigidity, and bradykinesia, and non-motor symptoms, such as depression, constipation, pain, sleep disorders, genitourinary problems, cognitive decline, and olfactory dysfunction, are also increasingly being associated with PD.
- a key feature of PD is the death of dopaminergic neurons in the substantia nigra pars compacta, and, for that reason, most current treatments for PD focus on increasing dopamine.
- Another well-known neuropathological hallmark of PD is the presence of Lewy bodies containing a-synuclein in brain regions affected by PD, which are thought to contribute to the disease.
- PD is thought to result from a combination of genetic and environmental risk factors. There is no single gene responsible for all Parkinson’s disease cases, and the vast majority of PD cases seem to be sporadic and not directly inherited. Mutations in the genes encoding parkin, PTEN-induced putative kinase 1 (PINK1 ), leucine-rich repeat kinase 2 (LRRK2), and Parkinsonism -associated deg!ycase (DJ-1 ) have been found to be associated with PD, but they represent only a small subset of the total number of PD cases. Occupational exposure to some pesticides and herbicides has also been proposed as a risk factor for PD. The synthetic neurotoxin MPTP can cause Parkinsonism, but its use is extremely rare. GBA-associated Parkinson’s disease
- Glucocerebrosidase is a lysosomal enzyme responsible for the metabolism of glucocerebroside (also known as glucosylceramide) to glucose and ceramide. It plays an important role in sphingolipid degradation, especially in the macrophage/monocyte cell lineage.
- Reduced GBA activity has been reported in the substantia nigra, cerebellum, and caudate of PD patients, although GBA activity has also been shown to decrease with age (see Alcalay et al. , Brain 138:2648 (2015), incorporated herein by reference as it pertains to GBA activity in PD).
- Severely pathogenic mutations include c.84GGIns, IVS2 + 1 G > A, p.V394L, p.D409H, p.L444P and RecTL, which are linked to a 9.92 to 21 .29 odds-ratio of developing PD.
- Mild GBA mutations p.N370S and p.R496H are linked to an odds-ratio of 2.84-4.94 of developing PD.
- the mutation p.E326K has also been identified as a PD risk factor.
- GBA mutations are discussed in in Barkhuizen et al., Neurochemistry International 93:6 (2016) and Sidransky and Lopez, Lancet Neurol.
- compositions and methods described herein provide the benefit of treating a different biochemical phenomenon that can underlie the development of Parkinson’s disease.
- the compositions and methods described herein target the physiological cause of the disease, representing a potential curative therapy.
- the compositions and methods described herein can be used to treat PD by administering pluripotent cells (e.g., CD34+ cells) that express GBA.
- pluripotent cells e.g., CD34+ cells
- These compositions and methods can be used to treat Parkinson’s disease with any etiology, e.g., genetic mutation, environmental toxin, or sporadic.
- compositions and methods can also be used to treat patients with G BA-associated PD, e.g., PD associated with a mutation in the GBA gene.
- the compositions and methods described herein can be used to treat patients with normal GBA activity, reduced GBA activity, and patients whose GBA mutational status and/or GBA activity level is unknown.
- the compositions and methods described herein may also be administered as a preventative treatment to patients at risk of developing Parkinson’s disease, e.g., patients with a GBA mutation, patients with reduced GBA activity, or patients with a mutation in one or more of the genes encoding parkin, PINK1 , LRRK2, or DJ-1 .
- the cells administered to patients suffering from PD can express one or more M2-promoting agents in addition to GBA.
- GBA-encoding constructs that may be used in conjunction with the compositions and methods described herein include transgenes comprising polynucleotides that encode wild-type GBA (the amino acid sequence of which is shown as SEQ ID NO. 1 , below) or a variant thereof, such as a polynucleotide that encodes a protein having at least 85% sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to the amino acid sequence of SEQ ID NO. 1 .
- transgenes comprising polynucleotides that encode wild-type GBA (the amino acid sequence of which is shown as SEQ ID NO. 1 , below) or a variant thereof, such as a polynucleotide that encodes a protein having at least 85% sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to the amino acid sequence of SEQ ID NO.
- the GBA-encoding constructs include polynucleotides that encode the catalytic domain of GBA, such as a domain containing residues 76-381 and 416-430 of SEQ ID NO. 1 . In some embodiments, the GBA- encoding constructs include polynucleotides having at least 85% sequence identity (e.g., 85%, 90%,
- the GBA-encoding constructs may be codon-optimized polynucleotides having at least 85% sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to the nucleic acid sequence of SEQ ID NO. 3, so to confer resistance against degradation by nucleases and inhibitory RNAs directed to endogenous GBA.
- the transgene encoding GBA encodes a GBA fusion protein.
- the GBA fusion protein has an amino acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%,
- the GBA fusion protein has an amino acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the amino acid sequence of SEQ ID NO. 3.
- the GBA fusion protein has an amino acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the amino acid sequence of SEQ ID NO. 4.
- the transgene encoding the GBA fusion protein has a nucleic acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 1 00% sequence identity) to the nucleic acid sequence of SEQ ID NO. 8.
- the transgene encoding the GBA fusion protein has a nucleic acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 1 00% sequence identity) to the nucleic acid sequence of SEQ ID NO. 9.
- the transgene encoding the GBA fusion protein has a nucleic acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 1 00% sequence identity) to the nucleic acid sequence of SEQ ID NO. 10.
- Wild-type human GBA (GenBank accession number: AAC63056.1 ) has the amino acid sequence of:
- the GBA fusion protein has the amino acid sequence of:
- the GBA fusion protein has the amino acid sequence of:
- PASRVSARSRGIVEECCFRSCDLALLETYCATPAKSE (SEQ ID NO. 3)
- the GBA fusion protein has the amino acid sequence of:
- GBA protein having a modified signal peptide sequence has the amino acid sequence of:
- HPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ (SEQ ID NO. 5)
- Wild-type human GBA (GenBank accession number: M19285.1 ) has the nucleic acid sequence of:
- GCCCAT CCAGGCT AAT CACACGGGCACAGGCCTGCT ACTG ACCCTGCAGCC AG AACAG AAGTT CCA
- the codon-optimized GBA construct has the nucleic acid sequence of:
- the codon-optimized GBA fusion protein construct has the nucleic acid sequence of:
- the codon-optimized human GBA fusion protein has the nucleic acid sequence of:
- the codon-optimized human GBA fusion protein has the nucleic acid sequence of:
- the codon-optimized human GBA having a modified signal peptide sequence has the nucleic acid sequence of:
- the GBA-encoding constructs include polynucleotides that encode wild- type GBA with the natural signal peptide (a 39-amino acid GBA signal peptide as described in Sorge et al., Am. J. Hum. Genet. 41 :1016-1024 (1987)). In some embodiments, the GBA-encoding constructs include polynucleotides that encode wild-type GBA without the natural signal peptide. In some embodiments, the transgene encoding secreted GBA comprises a modified signal peptide.
- the GBA comprising a modified signal peptide has an amino acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the amino acid sequence of SEQ ID NO. 5.
- the transgene encoding secreted GBA comprising a modified signal peptide has a nucleic acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the nucleic acid sequence of SEQ ID NO. 1 1 .
- the modified signal peptide has an amino acid sequence having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the amino acid sequence of SEQ ID NO. 16, as shown below.
- the modified signal peptide is encoded by a polynucleotide having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to the nucleic acid sequence of SEQ ID NO. 20, as shown below.
- a patient can be administered a pluripotent cell (e.g., an HSC, iPSC, CD34+ cell, ES cell, or myeloid progenitor cell) that expresses a polynucleotide encoding the amino acid sequence of SEQ ID NO. 1 , or a polynucleotide encoding a polypeptide having at least 85% sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to the amino acid sequence of SEQ ID NO. 1 , or a polynucleotide encoding a polypeptide that contains one or more conservative amino acid substitutions relative to SEQ ID NO.
- a pluripotent cell e.g., an HSC, iPSC, CD34+ cell, ES cell, or myeloid progenitor cell
- a pluripotent cell e.g., an HSC, iPSC, CD34+ cell,
- GBA analog encoded retains the therapeutic function of wild-type GBA.
- the enzymatic activity of wild-type GBA is important for the metabolism of glycolipids. GBA acts in lysosomes to metabolize the sphingolipid glucocerebroside to glucose and ceramide. Loss of GBA function leads to an accumulation of glucocerebroside in macrophages.
- Cells that may be used in conjunction with the compositions and methods described herein include cells that are capable of undergoing further differentiation.
- one type of cell that can be used in conjunction with the compositions and methods described herein is a pluripotent cell (e.g., a CD34+ cell).
- a pluripotent cell is a cell that possesses the ability to develop into more than one differentiated cell type. Examples of pluripotent cells are embryonic stem cells (ES cells) and induced pluripotent stem cells (iPS cells or iPSCs).
- ES cells and iPS cells have the ability to differentiate into cells of the ectoderm, which gives rise to the skin and nervous system, endoderm, which forms the gastrointestinal and respiratory tracts, endocrine glands, liver, and pancreas, and mesoderm, which forms bone, cartilage, muscles, connective tissue, and most of the circulatory system.
- Cells that may be used in conjunction with the compositions and methods described herein include hematopoietic stem cells and myeloid progenitor cells.
- Hematopoietic stem cells are immature blood cells that have the capacity to self-renew and to differentiate into mature blood cells including diverse lineages including but not limited to granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g.,
- HSCs are CD34+.
- HSCs also refer to long term repopulating HSC (LT-HSC) and short-term repopulating HSC (ST-HSC). Any of these HSCs can be used in conjunction with the compositions and methods described herein.
- HSCs can differentiate into myeloid progenitor cells, which are also CD34+.
- Myeloid progenitors can further differentiate into granulocytes (e.g., promyelocytes, neutrophils, eosinophils, and basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, and platelets), monocytes (e.g., monocytes and macrophages), dendritic cells, and microglia.
- Common myeloid progenitors can be characterized by cell surface molecules and are known to be lin-, SCA1 -, c-kit+, CD34+, and CD16/32 mid .
- HSCs and myeloid progenitors can be obtained from blood products.
- a blood product is a product obtained from the body or an organ of the body containing cells of hematopoietic origin. Such sources include unfractionated bone marrow, umbilical cord, placenta, peripheral blood, or mobilized- peripheral blood. All of the aforementioned crude or unfractionated blood products can be enriched for cells having HSC or myeloid progenitor cell characteristics in a number of ways. For example, the more mature, differentiated cells can be selected against based on cell surface molecules they express.
- the blood product may be fractionated by positively selecting for CD34+ cells, which include a subpopulation of hematopoietic stem cells capable of self-renewal, multi-potency, and that can be re-introduced into a transplant recipient whereupon they home to the hematopoietic stem cell niche and reestablish productive and sustained hematopoiesis.
- Such selection is accomplished using, for example, commercially available magnetic anti-CD34 beads (Dynal, Lake Success, NY).
- Myeloid progenitor cells can also be isolated based on the markers they express. Unfractionated blood products can be obtained directly from a donor or retrieved from cryopreservative storage. HSCs and myeloid progenitor cells can also be obtained from by differentiation of ES cells, iPS cells or other reprogrammed mature cells types.
- Cells that may be used in conjunction with the compositions and methods described herein include allogeneic cells or autologous cells. All of the aforementioned cell types are capable of differentiating into microglia. Cells may also differentiate into microglial progenitors or microglial stem cells. Differentiation may occur ex vivo or in vivo. Methods for ex vivo differentiation of human ES cells and iPS cells are known by those of skill in the art and are described in Muffat et al., Nature Medicine 22:1358-1367 (2016) and Pandya et al., Nature Neuroscience (2017) epub ahead of print, the disclosures of which are incorporated herein by reference as they pertain to methods of differentiating pluripotent cells into microglia. Microglia
- Microglia are myeloid-derived cells that serve as the immune cells, or resident macrophages, of the central nervous system. Microglia are highly similar to macrophages, both genetically and functionally, and share the ability to shift dynamically between pro-inflammatory and anti-inflammatory states.
- the pro-inflammatory state is known as classical activation, or M1
- the anti-inflammatory state is called alternative activation, or M2.
- Microglia can be made to shift between the two states by extracellular signals, e.g., signals from neighboring neurons or astrocytes, cell debris, toxins, infection, ischemia, and traumatic injury, among others.
- M1 microglia are often observed in the diseased brain, particularly in diseases involving neuroinflammation, such as PD.
- Classically activated M1 phenotypes have also been observed in mouse models of PD, such as the parkin null mouse and DJ-1 null mouse. It is unclear whether M1 microglia are a cause or consequence of neuroinflammation, but once microglia are classically activated, they can secrete pro-inflammatory cytokines, e.g., TNF-a, IL-1 b, and IL-6, chemokines, and nitric oxide, which can lead to sustained inflammation, neuronal damage, and further activation of M1 microglia.
- This positive feedback loop can be harmful to brain tissue; therefore, methods of reducing M1 activation and/or increasing M2 activation may help patients with diseases featuring neuroinflammation, e.g., Parkinson’s disease.
- compositions and methods described herein additionally provide cells expressing GBA and one or more M2-promoting agents.
- An M2-promoting agent is an agent that affects the polarization of macrophages or microglia by shifting cells toward a more anti-inflammatory state.
- M2-promoting agents can reduce M1 microglia numbers or the M1 microglia phenotype by reducing secretion or expression of pro-inflammatory cytokines, chemokines, and genes associated with classical activation/M1 , e.g., IL-1 b, tumor necrosis factor, iNOS, IL-6, or IL-12.
- M2-promoting agents may also reduce markers of M1 cells, e.g., MHC II, CD86, CD68, CD1 1 B, and Fey receptors.
- M2-promoting agents may increase the number of M2 microglia or the M2 phenotype by increasing secretion and expression of anti-inflammatory cytokines and genes associated with alternative activation/M2, e.g., IL-25, IL-10, transforming growth factor beta, CD163, TREM2, Arg1 , or CD206. M2-promoting agents may also alter cell morphology or shape, e.g., reducing amoeboid microglia or increasing microglial ramification.
- the M2 agents used in the compositions and methods described herein may make the administered cells display an M2 phenotype, may induce microglia in the brain to shift away from an M1 phenotype or toward an M2 phenotype, or may affect the phenotype of both the administered cells and the endogenous microglia.
- Microglia are rarely observed in a strictly M1 or M2 state and often express a subset of both M1 and M2 markers.
- a shift toward an M2 phenotype may appear as a reduction in one or more M1 -associated cytokines or genes, an increase in one or more M2-associated cytokines and genes, or a change in both M1 - and M2-associated cytokines and genes.
- M2-promoting agents fall into a number of broad categories.
- Agents that promote an M2 phenotype or reduce an M1 phenotype include anti-inflammatory cytokines, e.g., interleukin-25 (IL-25), interleukin-4 (IL-4), interleukin-10 (IL-10), interleukin-13 (IL-13), and transforming growth factor beta (TGF-b).
- cytokine receptors such as IL-4R, IL-17RB, IL-1 OR, TQRbRI , and TQRbR2 can also promote an M2 phenotype by enabling cells to detect anti-inflammatory cytokines.
- IL-25 is an anti inflammatory cytokine shown to inhibit neuroinflammation.
- Th2 Type 2 helper T
- mast cells eosinophils, basophils and alveolar macrophages
- eosinophils eosinophils
- basophils eosinophils
- alveolar macrophages eosinophils
- M2-promoting agents includes agents that reduce expression, synthesis, and secretion of pro-inflammatory mediators, e.g., cytokines, nitrite, and NF-kB activity.
- Agents in this category include glucocorticoid receptors, e.g., GR, peroxisome proliferator-activated receptors (PPARs), e.g., PPARy, PPARp/d, estrogen receptors, e.g., ERa, ERp, and nuclear receptor subfamily 4 group A member 2 (NR4A2).
- glucocorticoid receptors e.g., GR
- PPARs peroxisome proliferator-activated receptors
- PPARs peroxisome proliferator-activated receptors
- ERa ERa
- ERp nuclear receptor subfamily 4 group A member 2
- M2-promoting agents can induce an M2 phenotype by causing epigenetic changes, and agents in this class include lysine demethylase 6B (KDM6B), MSH homeobox 3 (MSX3), family with sequence similarity 19 (chemokine (C-C motif)-like), member A3 (FAM19A3), nuclear factor NF-Kappa- B P50 subunit (NF-kB p50).
- KDM6B lysine demethylase 6B
- MSX3 MSH homeobox 3
- family with sequence similarity 19 chemokine (C-C motif)-like
- member A3 FAM19A3
- NF-kB p50 nuclear factor NF-Kappa- B P50 subunit
- microRNAs including miR124, miR21 , and miR181 c, can also serve as M2- promoting agents.
- agents that can promote an M2 phenotype or reduce an M1 phenotype are agents known as self-associated molecular patterns (SAMPs) that are known from the immune system for helping phagocytes discriminate self from non-self material.
- SAMPs self-associated molecular patterns
- Agents in this class include C-X3-C motif chemokine ligand 1 (CX3CL1 ), C-X3-C motif chemokine receptor 1 (CX3CR1 ), CD200 molecule (CD200), CD200 receptor 1 (CD200R), complement factor H (CFH), leukocyte surface antigen CD47 (CD47), complement decay-accelerating factor (CD55), trophoblast leukocyte common antigen (CD46), adhesion G protein-coupled receptor E5 (ADGRE5), signal regulatory protein alpha (SIRPA), and siglecs, e.g., Siglec-1 , Siglec-2, Siglec-3, Siglec-4, CD33-related Siglecs.
- Glucocerebrosidase activity is reduced in patients with Parkinson’s disease, and PD brains contain classically activated M1 microglia.
- the compositions and methods described herein target these dysfunctions by administering cells expressing a transgene encoding GBA (e.g., non-secreted GBA or secreted GBA) and, optionally, one or more transgenes that each encode an M2-promoting agent.
- GBA e.g., non-secreted GBA or secreted GBA
- these agents can be directed to the interior of the cell, and in particular examples, to particular organelles.
- a wide array of methods has been established for the delivery of such proteins to mammalian cells and for the stable expression of genes encoding such proteins in mammalian cells.
- One platform that can be used to achieve therapeutically effective intracellular concentrations of GBA and M2-promoting agents in mammalian cells is via the stable expression of genes encoding these agents (e.g., by integration into the nuclear or mitochondrial genome of a mammalian cell). These genes are polynucleotides that encode the primary amino acid sequence of the corresponding protein. In order to introduce such exogenous genes into a mammalian cell, these genes can be incorporated into a vector. Vectors can be introduced into a ceil by a variety of methods, including transformation, transfection, direct uptake, projectile bombardment, and by encapsulation of the vector in liposomes.
- transfecting or transforming cells examples include calcium phosphate precipitation, electroporation, microinjection, infection, lipofeclion, and direct uptake. Such methods are described in more detail, for example, in Green et al ., Molecular Cloning: A Laboratory Manual, Fourth Edition (Cold Spring Harbor University Press, New York (2014)); and Ausubel et al., Current Protocols in Molecular Biology (John Wiley & Sons, New York (2015)), the disclosures of each of which are incorporated herein by reference.
- GBA and M2-promoting agents can also be introduced into a mammalian cel! by targeting a vector containing a gene encoding such an agent to ceil membrane phospholipids.
- vectors can be targeted to the phospholipids on the extracellular surface of the ceil membrane by linking the vector molecule to a VSV-G protein, a viral protein with affinity for all cel! membrane phospholipids.
- VSV-G protein a viral protein with affinity for all cel! membrane phospholipids.
- RNA polymerase Recognition and binding of the polynucleotide encoding GBA and/or an M2-promoting agent by mammalian RNA polymerase is important for gene expression. As such, one may include sequence elements within the polynucleotide that exhibit a high affinity for transcription factors that recruit RNA polymerase and promote the assembly of the transcription complex at the transcription initiation site.
- sequence elements include, e.g., a mammalian promoter, the sequence of which can be recognized and bound by specific transcription initiation factors and ultimately RNA polymerase.
- a mammalian promoter the sequence of which can be recognized and bound by specific transcription initiation factors and ultimately RNA polymerase. Examples of mammalian promoters have been described in Smith et al., Mol. Sys. Biol., 3:73, online publication, the disclosure of which is incorporated herein by reference.
- Polynucleotides suitable for use with the compositions and methods described herein also include those that encode GBA and/or an M2-promoting agent downstream of a mammalian promoter.
- Promoters that are useful for the expression of GBA and/or an M2-promoting agent in mammalian cells include, e.g., elongation factor 1 -alpha (EF1 a) promoter, phosphoglycerate kinase 1 (PGK) promoter, CD68 molecule (CD68) promoter (see Dahl et al., Molecular Therapy 23:835 (2015), incorporated herein by reference as it pertains to the use of PGK and CD68 promoters to express GBA), C-X3-C motif chemokine receptor 1 (CX3CR1 ) promoter, integrin subunit alpha M (ITGAM) promoter, allograft inflammatory factor 1 (AIF1 ) promoter, purinergic receptor P2Y12 (P2Y12) promoter, transmembrane protein
- promoters derived from viral genomes can also be used for the stable expression of these agents in mammalian cells.
- functional viral promoters that can be used to promote mammalian expression of these agents are adenovirus late promoter, vaccinia virus 7.5K promoter, simian virus 40 (SV40) promoter, cytomegalovirus promoter, tk promoter of herpes simplex virus (HSV), mouse mammary tumor virus (MMTV) promoter, long terminal repeat (LTR) promoter of human immunodeficiency virus (HIV), promoter of moloney virus, Epstein barr virus (EBV), Rous sarcoma virus (RSV), and the cytomegalovirus (CMV) promoter.
- HSV herpes simplex virus
- MMTV mouse mammary tumor virus
- LTR long terminal repeat
- HMV human immunodeficiency virus
- EBV Epstein barr virus
- RSV Rous sarcoma virus
- CMV cytomegal
- the transcription of this polynucleotide can be induced by methods known in the art.
- expression can be induced by exposing the mammalian cell to an external chemical reagent, such as an agent that modulates the binding of a transcription factor and/or RNA polymerase to the mammalian promoter and thus regulates gene expression.
- the chemical reagent can serve to facilitate the binding of RNA polymerase and/or transcription factors to the mammalian promoter, e.g., by removing a repressor protein that has bound the promoter.
- the chemical reagent can serve to enhance the affinity of the mammalian promoter for RNA polymerase and/or transcription factors such that the rate of transcription of the gene located downstream of the promoter is increased in the presence of the chemical reagent.
- Examples of chemical reagents that potentiate polynucleotide transcription by the above mechanisms are tetracycline and doxycycline. These reagents are commercially available (Life Technologies, Carlsbad, CA) and can be administered to a mammalian cell in order to promote gene expression according to established protocols.
- Enhancers represent another class of regulatory elements that induce a conformational change in the polynucleotide containing the gene of interest such that the DNA adopts a three-dimensional orientation that is favorable for binding of transcription factors and RNA polymerase at the transcription initiation site.
- polynucleotides for use in the compositions and methods described herein include those that encode GBA and/or an M2- promoting agent and additionally include a mammalian enhancer sequence.
- Enhancers for use in the compositions and methods described herein also include those that are derived from the genetic material of a virus capable of infecting a eukaryotic cell. Examples are the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers. Additional enhancer sequences that induce activation of eukaryotic gene transcription are disclosed in Yaniv et al.
- An enhancer may be spliced into a vector containing a polynucleotide encoding a water-forming NADH oxidase, for example, at a position 5’ or 3’ to this gene. In a preferred orientation, the enhancer is positioned at the 5’ side of the promoter, which in turn is located 5’ relative to the polynucleotide encoding GBA and/or an M2-promoting agent.
- Polynucleotides encoding GBA and/or an M2-promoting agent may include regulatory elements capable of turning gene expression on or off. These regulatory elements may include switches or destabilizing domains. Exemplary destabilizing domains are mutants of the human FK506- and rapamycin-binding protein (FKBP12), which confer instability to other proteins fused to these destabilizing domains.
- FKBP12 rapamycin-binding protein
- FKBP12 mutants include N-terminal mutants F15S, V24A, H25R, E60G, and L106P, and C- terminal mutants M66T, R71 G, D100G, D100N, E102G, and K105I, as characterized in Banaszynski et al., Cell 126:995 (2006), the disclosure of which is incorporated herein by reference as it pertains to FKBP12 destabilizing domains.
- FKBP12 destabilizing domains promote protein degradation.
- the small molecule ligand Shield-1 (Shld 1 ) can be used to stabilize FKBP12 mutant-containing proteins by protecting them from degradation.
- Other destabilizing domains that can be used to regulate expression of GBA or M2-promoting agents include mutants of the E.
- ecDHFR co//dihydrofolate reductase
- ERLBD human estrogen receptor ligand binding domain
- TMP small molecule ligand trimethoprim
- CMP8 or 4-hydroxytamoxifen 40HT
- Additional destabilizing peptide/stabilizing ligand systems that can be used in conjunction with the compositions and methods described herein so as to independently modulate the expression of one or more genes, such as a gene encoding GBA and a gene encoding an M2-promoting agent (for example, IL-25) are further described in WO 2014/164828, US 2005/0214738, US 8,173,792, US 2012/0178168, US 2014/0255361 , WO 2014/164828, WO 2015/152813, WO 2014/043189, WO 2014/089158, US 8,106,191 , US 2015/0307850, and US 2014/0220062, the disclosures of which are incorporated herein by reference as they pertain to the use of destabilizing domains and their corresponding ligands.
- RNAi Interfering RNA
- siRNA small interfering RNA
- miRNA target tagged transgenes can be negatively regulated according to the activity of a given miRNA which can be tissue, lineage, activation, or differentiation stage specific.
- miRNA target sequences can be recognized as targets by a specific miRNA thus inducing post- transcriptional gene silencing.
- miRNA target sequences miRNA target sequences
- miR-126 is highly expressed in HSPCs, other progenitor cells, and cells of the erythroid lineage, but absent from those of the myeloid lineage (e.g., macrophages and microglia) (Gentner et al., Science Translational Medicine. 2:58ra34 (2010)).
- a miR-126 targeting sequence for example, incorporated within a transgene would allow for targeted expression of the transgene in cells of the myeloid lineage and repressed expression in HSPCs and other progenitor cells, thus minimizing off-target cytotoxic effects.
- the transgene encoding GBA and/or an M2-promoting agent may include a miR-126 targeting sequence.
- Polynucleotides encoding GBA may include one or more polynucleotides encoding a signal peptide.
- Signal peptides may have amino acid sequence of 5-30 residues in length, and may be located upstream of (e.g., 5’ to) a polynucleotide encoding GBA. These signal peptides allow for recognition of the nascent GBA polypeptides during synthesis by signal recognition particles resulting transport across the membrane of the rough endoplasmic reticulum, as well as glycosylation for transport into lysosomes.
- Exemplary signal peptides for lysosomal transport of GBA are those from GBA.
- Polynucleotides encoding GBA may include one or more polynucleotides encoding a secretory signal peptide.
- Secretory signal peptides may have amino acid sequences of 5-30 residues in length, and may be located upstream of (i.e. , 5’ to) a polynucleotide encoding GBA. These secretory signal peptides allow for the recognition of the nascent polypeptides during synthesis by signal recognition particles resulting in translocation to the ER, packaging into transport vesicles, and finally, secretion.
- Exemplary secretory signal peptides for protein secretion are those from GBA, IGF-II, alpha-1 antitrypsin, IL-2, IL-6, CD5, immunoglobulins, trypsinogen, serum albumin, prolactin, elastin, tissue plasminogen activator signal peptide (tPA-SP), and insulin.
- pluripotent cells e.g., CD34+ cells
- expressing a secreted form of GBA may be utilized as a therapeutic strategy to correct an enzyme deficiency (e.g., GBA) by infusing the missing enzyme into the bloodstream.
- GBA As the blood perfuses patient tissues, GBA is taken up by cells and transported to the lysosome, where the enzyme acts to eliminate glucocerebroside that has accumulated in the lysosomes due to the enzyme deficiency.
- the therapeutic enzyme e.g., GBA
- the therapeutic enzyme must be delivered to lysosomes in the appropriate cells in tissues where the storage defect is manifest.
- lysosomal enzyme replacement therapeutics are delivered using carbohydrates naturally attached to the protein to engage specific receptors on the surface of the target cells.
- One receptor the cation-independent mannose-6-phosphate (M6P) receptor (CI-MPR)
- M6P mannose-6-phosphate
- CI-MPR cation-independent mannose-6-phosphate receptor
- Glycosylation Independent Lysosomal Targeting technology can be utilized to target therapeutic enzymes (e.g., GBA) to lysosomes.
- the GILT technology uses a peptide tag instead of M6P to engage the CI-MPR for lysosomal targeting.
- a GILT tag is a protein, peptide, or other moiety that binds the CI-MPR in a mannose-6-phosphateindependent manner.
- this technology mimics the normal biological mechanism for uptake of lysosomal enzymes, yet does so in a manner independent of mannose-6-phosphate.
- the GBA is secreted as a GBA fusion protein containing GBA and a GILT tag.
- a GILT tag is derived from human insulin-like growth factor II (IGFII).
- Human IGF-II is a high affinity ligand for the CI-MPR; also referred to as IGF-II receptor. Binding of GILT-tagged therapeutic enzymes to the M6P/IGF-II receptor targets the protein to the lysosome via the endocytic pathway.
- IGFII human insulin-like growth factor II
- the IGF-II derived GILT tag may be subjected to proteolytic cleavage by furin during production in mammalian cells.
- Furin protease typically recognizes and cleaves a cleavage site having a consensus sequence Arg-X-X-Arg, where X is any amino acid.
- the cleavage site is positioned after the carboxy- terminal arginine (Arg) residue in the sequence.
- a furin cleavage site has a consensus sequence Lys/Arg-X-X-X-Lys/Arg-Arg, where X is any amino acid.
- the cleavage site is positioned after the carboxy terminal arginine (Arg) residue in the sequence.
- the mature human IGF-II peptide sequence is shown below.
- the mature human IGF-II contains two potential overlapping furin cleavage sites between residues 34-40 (bolded).
- Modified GILT tags that are resistant to cleavage by furin still retain ability to bind to the CI-MPR in a mannose-6-phosphate-independent manner.
- furin-resistant GILT tags can be designed by mutating the amino acid sequence at one or more furin cleavage sites such that the mutation abolishes at least one furin cleavage site.
- a furin-resistant GILT tag is a furin-resistant IGF-II mutein containing a mutation that abolishes at least one furin protease cleavage site or changes a sequence adjacent to the furin protease cleavage site such that the furin cleavage is prevented, inhibited, reduced or slowed down as compared to a wild-type IGF-II peptide (e.g., wild-type human mature IGF-II).
- a suitable mutation does not impact the ability of the furin-resistant GILT tag to bind to the human cation-independent mannose-6-phosphate receptor.
- a furin-resistant IGF-II mutein suitable for use in conjunction with the compositions and methods described herein binds to the human cation-independent mannose-6-phosphate receptor in a mannose-e- phosphate-independent manner with a dissociation constant of 10 -7 M or less (e.g., 10 s , 10 9 , 1 0 -10 , 10 _1 1 , or less) at pH 7.4.
- a furin-resistant IGF-II mutein contains a mutation within a region corresponding to amino acids 30-40 (e.g., 31 -40, 32-40, 33-40, 34-40, 30-39, 31 -39, 32-39, 34-37, 32-39, 33-39, 34-39, 35-39, 36-39, 37-40, 34-40) of SEQ ID NO. 12.
- a suitable mutation abolishes at least one furin protease cleavage site.
- a mutation can be amino acid substitutions, deletions, or insertions.
- any one amino acid within the region corresponding to residues 30- 40 e.g., 31 -40, 32-40, 33-40, 34-40, 30-39, 31 -39, 32-39, 34-37, 32-39, 33-39, 34-39, 35-39, 36-39, 37- 40, 34-40) of SEQ ID NO. 12 can be substituted with any other amino acid or deleted.
- substitutions at position 34 may affect furin recognition of the first cleavage site. Insertion of one or more additional amino acids within each recognition site may abolish one or both furin cleavage sites. Deletion of one or more of the residues in the degenerate positions may also abolish both furin cleavage sites.
- a furin-resistant IGF-II mutein contains amino acid substitutions at positions corresponding to Arg37 or Arg40 of SEQ ID NO. 12. In some embodiments, a furin-resistant IGF-II mutein contains a Lys or Ala substitution at positions Arg37 or Arg40. Other substitutions are possible, including combinations of Lys and/or Ala mutations at both positions 37 and 40, or substitutions of amino acids other than Lys or Ala. In some embodiments, the furin-resistant IGF-II mutein suitable for use in conjunction with the compositions and methods described herein may contain additional mutations. For example, up to 30% or more of the residues of SEQ ID NO.
- 12 may be changed ( e.g., up to 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 1 1 %, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21 %, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30% or more residues may be changed).
- a furin- resistant IGF-II mutein suitable for use in conjunction with the compositions and methods described herein may have an amino acid sequence at least 70%, including at least 70, 71 , 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 , 82, 83, 84, 85, 86, 87, 88, 89, 90, 91 , 92, 93, 94, 95, 96, 97, 98, 99%, identical to SEQ ID NO. 12.
- a furin-resistant IGF-II mutein suitable for use in conjunction with the compositions and methods described herein is targeted specifically to the CI-MPR.
- IGF-II polypeptide that result in a protein that binds the CI-MPR with high affinity (e.g., with a dissociation constant of 10 -7 M or less at pH 7.4) while binding other receptors known to be bound by IGF-II with reduced affinity relative to native IGF-II.
- a furin-resistant IGF-II mutein suitable for use in conjunction with the compositions and methods described herein can be modified to have diminished binding affinity for the IGF-I receptor relative to the affinity of naturally-occurring human IGF-II for the IGF-I receptor. Additional mutational strategies have been utilized and are discussed at length in the U.S. Publication No. 2009043207, which is hereby incorporated by reference.
- the NMR structure of IGF-II shows that Thr 7 is located near residues 48 Phe and 50 Ser, as well as near the 9 Cys-4 7 Cys disulfide bridge. It is thought that interaction of Thr 7 with these residues can stabilize the flexible N-terminal hexapeptide required for IGF-I receptor binding (Terasawa et al., EMBO J. 13(23)5590-7 (1994)). At the same time, this interaction can modulate binding to the IGF-II receptor. Truncation of the C-terminus of IGF-II (residues 62-67) also appears to lower the affinity of IGF-II for the IGF-I receptor by 5 -old (Roth et al., Biochem.
- the binding surfaces for the IGF-I and cation-independent M6P receptors are on separate faces of IGF-II.
- functional cation- independent M6P binding domains can be constructed that are substantially smaller than human IGF-II.
- the amino terminal amino acids e.g., 1 -7 or 2-7) and/or the carboxy terminal residues 62-67 can be deleted or replaced.
- amino acids 29-40 can likely be eliminated or replaced without altering the folding of the remainder of the polypeptide or binding to the cation-independent M6P receptor.
- a targeting moiety including amino acids 8-28 and 41 -61 can be constructed.
- amino acids 8-28 and 41 -61 can be provided on separate polypeptide chains.
- Comparable domains of insulin which are homologous to IGF-II and have a tertiary structure closely related to the structure of IGF-II, have sufficient structural information to permit proper refolding into the appropriate tertiary structure, even when present in separate polypeptide chains (Wang et al., Trends Biochem. Sci. 16(8) :279-281 (1991 )).
- amino acids 8-28, or a conservative substitution variant thereof could be fused to a lysosomal enzyme; the resulting fusion protein could be admixed with amino acids 41 -61 , or a conservative substitution variant thereof, and administered to a patient.
- IGF-II can also be modified to minimize binding to serum IGF-binding proteins (Baxter, Am. J. Physiol Endocrinol Metab. 278(6):967-76(2000)) to avoid sequestration of IGF-II/GILT constructs. A number of studies have localized residues in IGF-II necessary for binding to IGF-binding proteins.
- Constructs with mutations at these residues can be screened for retention of high affinity binding to the M6P/IGF-II receptor and for reduced affinity for IGF binding proteins. For example, replacing Phe 26 of IGF-II with Ser is reported to reduce affinity of IGF-II for IGFBP-1 and -6, with no effect on binding to the M6P/IGF-II receptor (Bach et al., J. Biol. Chem. 268(13):9246-54 (1993)). Other substitutions, such as Lys for Glu 9, can also be advantageous.
- M6P/IGF-II receptor are also desirable lysosomal targeting domains.
- a random library of peptides can be screened for the ability to bind the M6P/IGF-II receptor either via a yeast two hybrid assay, or via a phage display type assay.
- a peptide tag suitable for use in conjunction with the compositions and methods described herein has reduced or diminished binding affinity for the insulin receptor relative to the affinity of naturally occurring human IGF-II for the insulin receptor.
- peptide tags with reduced or diminished binding affinity for the insulin receptor suitable for use in conjunction with the compositions and methods described herein include peptide tags having a binding affinity for the insulin receptor that is more than 1 .5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, I0-fold, 12-fold, 14-fold, 16-fold, 18-fold, 20-fold, 50-fold, 100-fold less than that of the wild- type mature human IGF-II.
- the binding affinity for the insulin receptor can be measured using various in vitro and in vivo assays known in the art.
- the GILT tag has an amino acid sequence having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to the amino acid sequence of SEQ NO. 13, as shown below.
- the GILT tag has an amino acid sequence having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to the amino acid sequence of SEQ NO. 14, as shown below.
- the GILT tag has an amino acid sequence having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to the amino acid sequence of SEQ NO. 15, as shown below.
- the GILT tag is encoded by a nucleic acid sequence having at least 85 % sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to the nucleic acid sequence of SEQ ID NO. 17, as shown below.
- the GILT tag is encoded by a nucleic acid sequence having at least 85 % sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to the nucleic acid sequence of SEQ ID NO. 18, as shown below.
- the GILT tag is encoded by a nucleic acid sequence having at least 85 % sequence identity (e.g., 85%, 90%, 95%, 96%, 97%, 98%, 99%, or greater, sequence identity) to the nucleic acid sequence of SEQ ID NO. 19, as shown below.
- the secreted GBA (e.g., secreted GBA fusion protein) is modified to penetrate the blood-brain barrier (BBB).
- BBB blood-brain barrier
- Modifications for mediating BBB penetrance are well known in the art. Exemplary modifications are the use of tags containing the receptor binding (Rb) domain (amino acid residues 148-173 of SEQ ID NO. 21 ) of apolipoprotein E (ApoE). The complete ApoE peptide sequence is shown below.
- ApoE is an important protein involved in lipid transport, and its cellular internalization is mediated by several members of the low density lipoprotein (LDL) receptor gene family, including the LDL receptor, very low-density lipoprotein receptor (VLDLR), and LDL receptor-related proteins (LRPs, including LRP1 , LRP2, and LRP8).
- LDL low density lipoprotein
- VLDLR very low-density lipoprotein receptor
- LRPs LDL receptor-related proteins
- the LDL receptor is found to be highly expressed in brain capillary endothelial cells (BCECs), with down-regulated expression observed in peripheral vessels. Restricted expressions of LRPs and VLDLR have also been shown prominently in the liver and brain when they have been detected in BCECs, neurons, and glial cells.
- LDLRf low-density lipoprotein receptor family
- receptor-associated protein an antagonist as well as a ligand for both LRP1 and VLDLR
- RAP receptor-associated protein
- LDLRf lipoprotein receptors
- a potent receptor-binding peptide derived from ApoE, has the ability to translocate protein across the BBB into the brain when engineered as fusion proteins.
- This method can therefore function to selectively open the BBB for therapeutic agents (e.g., soluble GBA) when engineered as a fusion protein.
- therapeutic agents e.g., soluble GBA
- This peptide can be readily attached to diagnostic or therapeutic agents without jeopardizing their biological functions or interfering with the important biological functions of ApoE due to the utilization of the Rb domain of ApoE, rather than the entire ApoE protein.
- This pathway is also an alternative uptake pathway that can facilitate further/secondary distribution within the brain after the agents reach the CNS due to the widespread expression of LDLRf members in brain parenchyma.
- the secreted GBA fusion protein has a peptide sequence containing the LDLRf receptor-binding domain (Rb) of SEQ ID NO. 21 , or a fragment, variant, or oligomer thereof.
- Rb LDLRf receptor-binding domain
- An exemplary receptor-binding domain can be found in the N-terminus of ApoE, for example, between amino acid residues 1 to 191 of SEQ ID NO. 21 , between amino acid residues 25 to 185 of SEQ ID NO. 21 , between amino acid residues 50 to 180 of SEQ ID NO. 21 , between amino acid residues 75 to 175 of SEQ ID NO. 21 , between amino acid residues 100 to 1 70 of SEQ ID NO. 21 , or between amino acid residues 125 to 165 of SEQ ID NO. 21 .
- An exemplary receptor binding domain has the amino acid sequence of residues 159 to 167 of SEQ ID NO. 21 .
- the peptide sequence containing the receptor-binding domain of ApoE can include at least one amino acid mutation, deletion, addition, or substitution.
- the amino acid substitutions can be a combination of two or more mutations, deletions, additions, or substitutions.
- the at least one substation is a conservative substitution.
- the at least one amino acid addition includes addition of a selected sequence already found in the Rb domain of ApoE.
- stable expression of an exogenous gene in a mammalian cell can be achieved by integration of the polynucleotide containing the gene into the nuclear genome of the mammalian cell.
- a variety of vectors for the delivery and integration of polynucleotides encoding exogenous proteins into the nuclear DNA of a mammalian cell have been developed. Examples of expression vectors are disclosed in, e.g., WO 1994/01 1026 and are incorporated herein by reference.
- Expression vectors for use in the compositions and methods described herein contain a polynucleotide sequence that encodes GBA and/or an M2-promoting agent, as well as, e.g., additional sequence elements used for the expression of these agents and/or the integration of these polynucleotide sequences into the genome of a mammalian cell.
- Certain vectors that can be used for the expression of GBA and M2-promoting agents include plasmids that contain regulatory sequences, such as promoter and enhancer regions, which direct gene transcription.
- Other useful vectors for expression of GBA and M2-promoting agents contain polynucleotide sequences that enhance the rate of translation of these genes or improve the stability or nuclear export of the mRNA that results from gene transcription.
- sequence elements include, e.g., 5’ and 3’ untranslated regions, an internal ribosomal entry site (IRES), and polyadenylation signal site in order to direct efficient transcription of the gene carried on the expression vector.
- IRES internal ribosomal entry site
- the expression vectors suitable for use with the compositions and methods described herein may also contain a polynucleotide encoding a marker for selection of cells that contain such a vector. Examples of a suitable marker are genes that encode resistance to antibiotics, such as ampicillin, chloramphenicol, kanamycin, nourseothricin.
- Expression vectors for use in the compositions and methods described herein may express GBA and one or more M2-promoting agents from monocistronic or polycistronic expression cassettes.
- a monocistronic expression cassette contains a polynucleotide sequence that encodes a single gene.
- Pluripotent cells (e.g., CD34+ cells) described herein can be transfected with multiple plasmids, for example, each containing a monocistronic expression cassette, or with a single plasmid containing more than one monocistronic expression cassette.
- Polycistronic expression cassettes can be used to simultaneously express two or more proteins from a single transcript.
- Polycistronic expression cassettes include bicistronic expression cassettes, which can be used to generate two proteins from a single transcript and may include IRES sequences to recruit ribosomes to initiate translation from a region of the mRNA other than the 5’ cap.
- Foot-and-mouth disease virus 2A (FMDV 2A) polynucleotides can be utilized to express two or more genes (e.g., 2 genes, 3 genes, 4 genes, 5 genes or more), and can be used in bicistronic or polycistronic expression cassettes to produce equimolar levels of multiple genes from the same transcript.
- FMDV 2A mediates a cotranslational cleavage event, which separates proteins linked by 2A sequences, and multiple 2A sequences may be used in one vector.
- FMDV 2A mediates a cotranslational cleavage event, which separates proteins linked by 2A sequences, and multiple 2A sequences may be used in one vector.
- 2A-like sequences from other viruses can also be used in the compositions and methods described herein, including the 2A-like sequences from equine rhinitis A virus (E2A), porcine teschovirus-1 (P2A), and Thosea asigna virus (T2A), as described in Szymczak and Vignali, Expert Opin Biol Ther. 5:627 (2005), Szymczak et al ., Nat Biotechnol. 22:589 (2004), and Osborn et al. , Molecular Therapy 12:569 (2005), the disclosures of which are incorporated herein by reference as they pertain to the use of 2A-like sequences in gene expression.
- E2A equine rhinitis A virus
- P2A porcine teschovirus-1
- T2A Thosea asigna virus
- Viral genomes provide a rich source of vectors that can be used for the efficient delivery of exogenous genes into a mammalian cell. Viral genomes are particularly useful vectors for gene delivery as the polynucleotides contained within such genomes are typically incorporated into the nuclear genome of a mammalian cell by generalized or specialized transduction. These processes occur as part of the natural viral replication cycle, and do not require added proteins or reagents in order to induce gene integration.
- viral vectors examples include a retrovirus (e.g., Retroviridae family viral vector), adenovirus (e.g., Ad5, Ad26, Ad34, Ad35, and Ad48), parvovirus (e.g., adeno-associated viruses), coronavirus, negative strand RNA viruses such as orthomyxovirus (e.g., influenza virus), rhabdovirus (e.g., rabies and vesicular stomatitis virus), paramyxovirus (e.g.
- RNA viruses such as picornavirus and alphavirus
- double stranded DNA viruses including adenovirus, herpesvirus (e.g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxvirus (e.g., vaccinia, modified vaccinia Ankara (MVA), fowlpox and canarypox).
- herpesvirus e.g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus
- poxvirus e.g., vaccinia, modified vaccinia Ankara (MVA), fowlpox and canarypox
- Other viruses include Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus, human papilloma virus, human foamy virus, and hepatitis virus, for example.
- retroviruses examples include: avian leukosis-sarcoma, avian C-type viruses, mammalian C-type, B-type viruses, D-type viruses, oncoretroviruses, HTLV-BLV group, lentivirus, alpharetrovirus, gammaretrovirus, spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, Virology, Third Edition (Lippincott-Raven, Philadelphia, (1996))).
- murine leukemia viruses murine sarcoma viruses, mouse mammary tumor virus, bovine leukemia virus, feline leukemia virus, feline sarcoma virus, avian leukemia virus, human T-cell leukemia virus, baboon endogenous virus, Gibbon ape leukemia virus, Mason Pfizer monkey virus, simian immunodeficiency virus, simian sarcoma virus, Rous sarcoma virus and lentiviruses.
- vectors are described, for example, in McVey et al., (US 5,801 ,030), the teachings of which are incorporated herein by reference.
- Nucleic acids of the compositions and methods described herein may be incorporated into rAAV vectors and/or virions in order to facilitate their introduction into a cell.
- AAV vectors can be used in the central nervous system, and appropriate promoters and serotypes are discussed in Pignataro et al. , J Neural Transm (2017), epub ahead of print, the disclosure of which is incorporated herein by reference as it pertains to promoters and AAV serotypes useful in CNS gene therapy.
- rAAV vectors useful in the compositions and methods described herein are recombinant nucleic acid constructs that include (1 ) a heterologous sequence to be expressed (e.g., a polynucleotide encoding GBA and/or an M2-promoting agent) and (2) viral sequences that facilitate integration and expression of the heterologous genes.
- the viral sequences may include those sequences of AAV that are required in cis for replication and packaging (e.g., functional ITRs) of the DNA into a virion.
- Such rAAV vectors may also contain marker or reporter genes.
- Useful rAAV vectors have one or more of the AAV WT genes deleted in whole or in part, but retain functional flanking ITR sequences.
- the AAV ITRs may be of any serotype suitable for a particular application. Methods for using rAAV vectors are described, for example, in Tal et al., J.
- the nucleic acids and vectors described herein can be incorporated into a rAAV virion in order to facilitate introduction of the nucleic acid or vector into a cell.
- the capsid proteins of AAV compose the exterior, non-nucleic acid portion of the virion and are encoded by the AAV cap gene.
- the cap gene encodes three viral coat proteins, VP1 , VP2, and VP3, which are required for virion assembly.
- the construction of rAAV virions has been described, for example, in US 5,173,414; US 5,139,941 ; US 5,863,541 ; US 5,869,305; US 6,057,152; and US 6,376,237; as well as in Rabinowitz et al., J. Virol. 76:791 (2002) and Bowles et al., J. Virol. 77:423 (2003), the disclosures of each of which are
- AAV vectors for gene delivery are incorporated herein by reference as they pertain to AAV vectors for gene delivery.
- rAAV virions useful in conjunction with the compositions and methods described herein include those derived from a variety of AAV serotypes including AAV 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 and rh74.
- AAV2 AAV9, and AAV10 may be particularly useful. Construction and use of AAV vectors and AAV proteins of different serotypes are described, for example, in Chao et al., Mol. Ther. 2:619 (2000); Davidson et al., Proc. Natl. Acad. Sci. USA 97:3428 (2000); Xiao et al., J. Virol. 72:2224 (1998); Halbert et al., J.
- pseudotyped rAAV vectors include AAV vectors of a given serotype pseudotyped with a capsid gene derived from a serotype other than the given serotype (e.g., AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, and AAV10, among others).
- AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, and AAV10 among others.
- Techniques involving the construction and use of pseudotyped rAAV virions are known in the art and are described, for example, in Duan et al., J. Virol. 75:7662 (2001 ); Halbert et al., J. Virol. 74:1524 (2000); Zolotukhin et al., Methods, 28:158 (2002); and Auricchio et al., Hum. Molec. Genet. 10:3075 (2001 ).
- AAV virions that have mutations within the virion capsid may be used to infect particular cell types more effectively than non-mutated capsid virions.
- suitable AAV mutants may have ligand insertion mutations for the facilitation of targeting AAV to specific cell types.
- the construction and characterization of AAV capsid mutants including insertion mutants, alanine screening mutants, and epitope tag mutants is described in Wu et al. , J. Virol. 74:8635 (2000).
- Other rAAV virions that can be used in methods described herein include those capsid hybrids that are generated by molecular breeding of viruses as well as by exon shuffling. See, e.g., Soong et al., Nat. Genet., 25:436 (2000) and Kolman and Stemmer, Nat. Biotechnol. 19:423 (2001 ).
- the delivery vector used in the methods and compositions described herein may be a retroviral vector.
- retroviral vector One type of retroviral vector that may be used in the methods and compositions described herein is a lentiviral vector.
- Lentiviral vectors LVs
- LVs Lentiviral vectors
- An overview of optimization strategies for lentiviral vectors is provided in Delenda, The Journal of Gene Medicine 6: S125 (2004), the disclosure of which is incorporated herein by reference.
- lentivirus-based gene transfer techniques relies on the in vitro production of recombinant lentiviral particles carrying a highly deleted viral genome in which the transgene of interest is accommodated.
- the recombinant lentivirus are recovered through the in trans coexpression in a permissive cell line of (1 ) the packaging constructs, i.e. , a vector expressing the Gag-Pol precursors together with Rev (alternatively expressed in trans); (2) a vector expressing an envelope receptor, generally of an heterologous nature; and (3) the transfer vector, consisting in the viral cDNA deprived of all open reading frames, but maintaining the sequences required for replication, incapsidation, and expression, in which the sequences to be expressed are inserted.
- a lentiviral vector used in the methods and compositions described herein may include one or more of a 5'-Long terminal repeat (LTR), HIV signal sequence, HIV Psi signal 5'-splice site (SD), delta- GAG element, Rev Responsive Element (RRE), 3'-splice site (SA), elongation factor (EF) 1 -alpha promoter and 3'-self inactivating LTR (SIN-LTR).
- the lentiviral vector optionally includes a central polypurine tract (cPPT) and a woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), as described in US 6,136,597, the disclosure of which is incorporated herein by reference as it pertains to WPRE.
- the lentiviral vector may further include a pHR' backbone, which may include for example as provided below.
- the Lentigen lentiviral vector described in Lu et al., Journal of Gene Medicine 6:963 (2004) may be used to express the DNA molecules and/or transduce cells.
- a lentiviral vector used in the methods and compositions described herein may a 5'-Long terminal repeat (LTR), HIV signal sequence, HIV Psi signal 5'-splice site (SD), delta-GAG element, Rev
- RRE Responsive Element
- SA 3'-splice site
- EF elongation factor 1 -alpha promoter
- SI-LTR 3'-self inactivating LTR
- the lentiviral vector includes a CMV promoter.
- the promoter may also be EF1 a or PGK promoter.
- the promoter is a microglia-specific promoter, e.g., CD68 promoter, CX3CR1 promoter, ITGAM promoter, AIF1 promoter, P2Y12 promoter, TMEM1 19 promoter, or CSF1 R promoter.
- Enhancer elements can be used to increase expression of modified DNA molecules or increase the lentiviral integration efficiency.
- the lentiviral vector used in the methods and compositions described herein may include a nef sequence.
- the lentiviral vector used in the methods and compositions described herein may include a cPPT sequence which enhances vector integration.
- the cPPT acts as a second origin of the (+)-strand DNA synthesis and introduces a partial strand overlap in the middle of its native HIV genome.
- the introduction of the cPPT sequence in the transfer vector backbone strongly increased the nuclear transport and the total amount of genome integrated into the DNA of target cells.
- the lentiviral vector used in the methods and compositions described herein may include a Woodchuck Posttranscriptional Regulatory Element (WPRE).
- WPRE Woodchuck Posttranscriptional Regulatory Element
- the WPRE acts at the transcriptional level, by promoting nuclear export of transcripts and/or by increasing the efficiency of polyadenylation of the nascent transcript, thus increasing the total amount of mRNA in the cells.
- the addition of the WPRE to lentiviral vector results in a substantial improvement in the level of transgene expression from several different promoters, both in vitro and in vivo.
- the lentiviral vector used in the methods and compositions described herein may include both a cPPT sequence and WPRE sequence.
- the vector may also include an internal ribosome entry site (IRES) sequence that permits the expression of multiple polypeptides from a single promoter.
- IRS internal ribosome entry site
- the vector used in the methods and compositions described herein may include multiple promoters that permit expression more than one polypeptide.
- the vector used in the methods and compositions described herein may include a protein cleavage site that allows expression of more than one polypeptide. Examples of protein cleavage sites that allow expression of more than one polypeptide are described in Klump et al. , Gene Ther.; 8:81 1 (2001 ), Osborn et al. , Molecular Therapy 12:569 (2005), Szymczak and, Vignali,. Expert Opin Biol Ther.
- the vector used in the methods and compositions described herein may, be a clinical grade vector.
- the viral regulatory elements are components of delivery vehicles used to introduce nucleic acid molecules into a host cell.
- the viral regulatory elements are optionally retroviral regulatory elements.
- the viral regulatory elements may be the LTR and gag sequences from HSC1 or MSCV.
- the retroviral regulatory elements may be from lentiviruses or they may be heterologous sequences identified from other genomic regions.
- RNA e.g., codon-optimized DNA or RNA (e.g., mRNA, tRNA, siRNA, miRNA, shRNA, chemically modified RNA)
- electroporation can be used to permeabilize mammalian cells (e.g., human target cells) by the application of an electrostatic potential to the cell of interest.
- mammalian cells e.g., human cells
- Mammalian cells, such as human cells, subjected to an external electric field in this manner are subsequently predisposed to the uptake of exogenous nucleic acids. Electroporation of mammalian cells is described in detail, e.g., in Chu et al.
- NucleofectionTM utilizes an applied electric field in order to stimulate the uptake of exogenous polynucleotides into the nucleus of a eukaryotic cell. NucleofectionTM and protocols useful for performing this technique are described in detail, e.g., in Distler et al., Experimental
- squeeze-poration methodology induces the rapid mechanical deformation of cells in order to stimulate the uptake of exogenous DNA through membranous pores that form in response to the applied stress.
- This technology is advantageous in that a vector is not required for delivery of nucleic acids into a cell, such as a human target cell. Squeeze-poration is described in detail, e.g., in Sharei et al., Journal of Visualized Experiments 81 :e50980 (2013), the disclosure of which is incorporated herein by reference.
- Lipofection represents another technique useful for transfection of target cells. This method involves the loading of nucleic acids into a liposome, which often presents cationic functional groups, such as quaternary or protonated amines, towards the liposome exterior. This promotes electrostatic interactions between the liposome and a cell due to the anionic nature of the cell membrane, which ultimately leads to uptake of the exogenous nucleic acids, for example, by direct fusion of the liposome with the cell membrane or by endocytosis of the complex. Lipofection is described in detail, for example, in US 7,442,386, the disclosure of which is incorporated herein by reference.
- cationic molecules that associate with polynucleotides so as to impart a positive charge favorable for interaction with the cell membrane are activated dendrimers (described, e.g., in Dennig, Topics in Current Chemistry 228:227 (2003), the disclosure of which is incorporated herein by reference) polyethylenimine, and
- laserfection also called optical transfection
- Another useful tool for inducing the uptake of exogenous nucleic acids by target cells is laserfection, also called optical transfection, a technique that involves exposing a cell to electromagnetic radiation of a particular wavelength in order to gently permeabilize the cells and allow polynucleotides to penetrate the cell membrane.
- the bioactivity of this technique is similar to, and in some cases found superior to, electroporation.
- Impalefection is another technique that can be used to deliver genetic material to target cells. It relies on the use of nanomaterials, such as carbon nanofibers, carbon nanotubes, and nanowires.
- Needle-like nanostructures are synthesized perpendicular to the surface of a substrate. DNA containing the gene, intended for intracellular delivery, is attached to the nanostructure surface. A chip with arrays of these needles is then pressed against cells or tissue. Cells that are impaled by nanostructures can express the delivered gene(s).
- An example of this technique is described in Shalek et al., PNAS 107:
- Magnetofection can also be used to deliver nucleic acids to target cells.
- the magnetofection principle is to associate nucleic acids with cationic magnetic nanoparticles.
- the magnetic nanoparticles are made of iron oxide, which is fully biodegradable, and coated with specific cationic proprietary molecules varying upon the applications.
- Their association with the gene vectors (DNA, siRNA, viral vector, etc.) is achieved by salt-induced colloidal aggregation and electrostatic interaction.
- the magnetic particles are then concentrated on the target cells by the influence of an external magnetic field generated by magnets. This technique is described in detail in Scherer et al., Gene Therapy 9:102 (2002), the disclosure of which is incorporated herein by reference.
- sonoporation a technique that involves the use of sound (typically ultrasonic frequencies) for modifying the permeability of the cell plasma membrane permeabilize the cells and allow polynucleotides to penetrate the cell membrane. This technique is described in detail, e.g., in Rhodes et al., Methods in Cell Biology 82:309 (2007), the disclosure of which is incorporated herein by reference.
- Microvesicles represent another potential vehicle that can be used to modify the genome of a target cell according to the methods described herein.
- microvesicles that have been induced by the co-overexpression of the glycoprotein VSV-G with, e.g., a genome-modifying protein, such as a nuclease can be used to efficiently deliver proteins into a cell that subsequently catalyze the site- specific cleavage of an endogenous polynucleotide sequence so as to prepare the genome of the cell for the covalent incorporation of a polynucleotide of interest, such as a gene or regulatory sequence.
- vesicles also referred to as Gesicles
- Gesicles for the genetic modification of eukaryotic cells is described in detail, e.g., in Quinn et al., Genetic Modification of Target Cells by Direct Delivery of Active Protein [abstract].
- Methylation changes in early embryonic genes in cancer in: Proceedings of the 18th Annual Meeting of the American Society of Gene and Cell Therapy; 2015 May 13,
- endogenous GBA is disrupted (e.g., in a subject undergoing treatment, such as in a population of neurons in a subject undergoing treatment, or in the pluripotent cells to be administered to the subject).
- exemplary methods for disrupting endogenous GBA expression are those in which an inhibitory RNA molecule is administered to the subject, or contacted with a population of neurons in the subject or the population of pluripotent cells to be administered to the subject.
- the inhibitory RNA molecule may function to disrupt endogenous GBA expression, for example, act by way of the RNA interference (RNAi) pathway.
- RNAi RNA interference
- An inhibitory RNA molecule can decrease the expression level (e.g., protein level or mRNA level) of endogenous GBA.
- an inhibitory RNA molecule includes a short interfering RNA, short hairpin RNA, and/or a microRNA that targets full-length endogenous GBA.
- a siRNA is a double-stranded RNA molecule that typically has a length of about 19-25 base pairs.
- a shRNA is a RNA molecule including a hairpin turn that decreases expression of target genes via RNAi. shRNAs can be delivered to cells in the form of plasmids, e.g., viral or bacterial vectors, e.g., by transfection, electroporation, or transduction).
- a microRNA is a non-coding RNA molecule that typically has a length of about 22 nucleotides.
- miRNAs bind to target sites on mRNA molecules and silence the mRNA, e.g., by causing cleavage of the mRNA, destabilization of the mRNA, or inhibition of translation of the mRNA.
- An inhibitory RNA molecule can be modified, e.g., to contain modified nucleotides, e.g., 2’-fluoro, 2’-o-methyl, 2’-deoxy, unlocked nucleic acid, 2’-hydroxy, phosphorothioate, 2’- thiouridine, 4’-thiouridine, 2’-deoxyuridine. Without being bound by theory, it is believed that certain modification can increase nuclease resistance and/or serum stability, or decrease immunogenicity.
- the inhibitory RNA molecule decreases the level and/or activity or function of endogenous GBA. In embodiments, the inhibitory RNA molecule inhibits expression of endogenous GBA. In other embodiments, the inhibitor RNA molecule increases degradation of endogenous GBA and/or decreases the stability of endogenous GBA.
- the inhibitory RNA molecule can be chemically synthesized or transcribed in vitro.
- the endogenous GBA is disrupted in the pluripotent stem cells containing the GBA transgene using, for example, the gene editing techniques described herein. In some embodiments, the endogenous GBA is globally disrupted in the subject using, for example, the gene editing techniques described herein. In some embodiments, the endogenous GBA is disrupted in a population of neurons in the subject using, for example, the gene editing techniques described herein. In some embodiments, disruption of endogenous GBA in the subject, neurons, and/or pluripotent cells containing the GBA transgene occurs prior to administration of the pluripotent stem cells to the subject.
- inhibitory therapeutic agents based on non-coding RNA such as ribozymes, RNAse P, siRNAs, and miRNAs are also known in the art, for example, as described in Sioud, RNA Therapeutics: Function, Design, and Delivery (Methods in Molecular Biology). Humana Press 2010.
- CRISPR clustered regularly interspaced short palindromic repeats
- Cas9 Cas9 nuclease
- Polynucleotides containing these foreign sequences and the repeat-spacer elements of the CRISPR locus are in turn transcribed in a host cell to create a guide RNA, which can subsequently anneal to a target sequence and localize the Cas9 nuclease to this site.
- highly site-specific Cas9-mediated DNA cleavage can be engendered in a foreign polynucleotide because the interaction that brings Cas9 within close proximity of the target DNA molecule is governed by RNA: DNA hybridization.
- ZFNs zinc finger nucleases
- TALENs transcription activator-like effector nucleases
- the endogenous GBA may be disrupted in the pluripotent stem cells containing the GBA transgene and/or M2-promoting agents using these gene editing techniques described herein.
- Transposons are polynucleotides that encode transposase enzymes and contain a polynucleotide sequence or gene of interest flanked by 5’ and 3’ excision sites. Once a transposon has been delivered into a cell, expression of the transposase gene commences and results in active enzymes that cleave the gene of interest from the transposon.
- transposase This activity is mediated by the site- specific recognition of transposon excision sites by the transposase.
- these excision sites may be terminal repeats or inverted terminal repeats.
- the gene of interest can be integrated into the genome of a mammalian cell by transposase-catalyzed cleavage of similar excision sites that exist within the nuclear genome of the cell. This allows the gene of interest to be inserted into the cleaved nuclear DNA at the complementary excision sites, and subsequent covalent ligation of the phosphodiester bonds that join the gene of interest to the DNA of the mammalian cell genome completes the incorporation process.
- the transposon may be a
- Transposon systems include the piggybac transposon (described in detail in, e.g., WO 2010/085699) and the sleeping beauty transposon (described in detail in, e.g., US2005/01 12764), the disclosures of each of which are incorporated herein by reference.
- Subjects that may be treated as described herein are subjects having or at risk of developing Parkinson’s disease.
- the type of PD may be GBA-associated PD, sporadic PD, PD caused by an environmental toxin, e.g., herbicides or pesticides, or PD associated with a non-GBA mutation, e.g., a mutation in one or more of the genes encoding parkin, PINK1 , LRRK2, or DJ-1 .
- the compositions and methods described herein can be used to treat patients with normal GBA activity, reduced GBA activity, and patients whose GBA mutational status and/or GBA activity level is unknown.
- compositions and methods described herein may also be administered as a preventative treatment to patients at risk of developing Parkinson’s disease, e.g., patients with a GBA mutation, patients with reduced GBA activity, patients with a mutation in one or more of the genes encoding parkin, PINK1 , LRRK2, or DJ-1 , or patients exposed to an environmental toxin associated with PD.
- Patients at risk for PD may show early symptoms of PD or may not yet be symptomatic when treatment is administered.
- the cells and compositions described herein may be administered to a subject with Parkinson’s disease by a variety of routes, such as intracerebroventricularly, stereotactically, intravenously, intraosseously, or by means of a bone marrow transplant.
- the cells and compositions described herein may be administered to a subject systemically (e.g., intravenously), directly to the central nervous system (CNS) (e.g., intracerebroventricularly or stereotactically), or directly into the bone marrow (e.g., intraosseously).
- the cells and compositions described herein are administered to a subject intracerebroventricularly into the cerebral lateral ventricles (a description of this method can be found in Capotondo et al.
- the cells and compositions described herein are administered to a subject by stereotactic injection into the substantia nigra (a description of this method can be found in Altarche-Xifro et al., EBiomedicine 8:83 (2016), incorporated herein by reference as it pertains to stereotactic injection of hematopoietic stem and progenitor cells into the substantia nigra of PD mouse models).
- administration in any given case will depend on the particular cell or composition administered, the patient, pharmaceutical formulation methods, administration methods (e.g., administration time and administration route), the patient's age, body weight, sex, severity of the diseases being treated, the patient’s diet, and the patient’s excretion rate.
- Multiple routes of administration may be used to treat a single subject, e.g., intracerebroventricular or stereotactic injection and intravenous injection, intracerebroventricular or stereotactic injection and intraosseous injection, or intracerebroventricular or stereotactic injection and bone marrow transplant.
- Multiple routes of administration may be used to treat a single subject at one time, or the subject may receive treatment via one route of administration first, and receive treatment via another route of administration during a second appointment, e.g., 1 week later, 2 weeks later, 1 month later, 6 months later, or 1 year later.
- Cells may be administered to a subject once, or cells may be administered one or more times (e.g., 2-10 times) per week, month, or year to a subject treatment for Parkinson’s disease.
- Microglia and/or hematopoietic stem and progenitor cells can be ablated through the use of chemical agents (e.g., busulfan, treosulfan, PLX3397, PLX647, PLX5622, or clodronate liposomes), irradiation, or a combination thereof.
- the agents used for cell ablation may be BBB penetrating (e.g., busulfan) or may lack the ability to cross the BBB (e.g., treosulfan).
- Exemplary microglia and/or hematopoietic stem and progenitor cells ablating agents are busulfan (Capotondo et al. , PNAS 109:15018 (2012), the disclosure of which is incorporated by reference as it pertains to the use of busulfan to ablate microglia), treosulfan, PLX3397, PLX647, PLX5622, or clodronate liposomes.
- Other agents for the depletion of endogenous microglia and/or hematopoietic stem and progenitor cells include cytotoxins covalently conjugated to antibodies or antigen binding fragments thereof capable of binding antigens expressed by hematopoietic stem cells so as to form an antibody-drug conjugate.
- Cytotoxins suitable for antibody drug conjugates include DNA- intercalating agents, (e.g., anthracyclines), agents capable of disrupting the mitotic spindle apparatus (e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof), RNA polymerase inhibitors (e.g., an amatoxin, such as a-amanitin and derivatives thereof), agents capable of disrupting protein biosynthesis (e.g., agents that exhibit rRNA N-glycosidase activity, such as saporin and ricin A-chain), among others known in the art.
- DNA- intercalating agents e.g., anthracyclines
- agents capable of disrupting the mitotic spindle apparatus e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof
- RNA polymerase inhibitors e.g., an amatoxin, such as a-amanitin and derivatives thereof
- Ablation may eliminate all microglia and/or hematopoietic stem and progenitor cells, or it may reduce microglia and/or hematopoietic stem and progenitor cells numbers by at least 10% (e.g., at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or more).
- One or more agents to ablate microglia and/or hematopoietic stem and progenitor cells may be administered at least one week (e.g., 1 , 2, 3, 4, 5, or 6 weeks or more) before administration of the cells or compositions described herein. Cells administered in the methods described herein may replace the ablated microglia and/or hematopoietic stem and progenitor cells, and may repopulate the brain following
- intracerebroventricular, stereotactic, intravenous, or intraosseous injection, or following bone marrow transplant may cross the blood brain barrier to enter the brain and differentiate into microglia.
- Cells administered to the brain e.g., cells administered intracerebroventricularly or stereotactically, can differentiate into microglia in vivo or can be differentiated into microglia ex vivo.
- the methods described herein may include administering to a subject a population of CD34+ cells (e.g., embryonic stem cells, induced pluripotent stem cells, hematopoietic stem cells, and myeloid progenitor cells). These cells may be CD34+ cells that have not been modified to express the transgene encoding GBA. These cells may have disrupted endogenous GBA.
- the CD34+ cells may be administered systemically (e.g., intravenously), or by bone marrow transplantation to reconstitute the bone marrow compartment following conditioning as described herein.
- these CD34+ cells may migrate to a stem cell niche and increase the quantity of cells of the hematopoietic lineage at such a site by, for example, 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 1 1 %, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21 %, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31 %, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41 %, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%,
- Administration may occur prior to, or following administration of the composition of the described herein.
- the subject is the donor.
- withdrawn hematopoietic stem or progenitor cells may be re-infused into the subject (following modification (e.g., incorporation of the transgene encoding GBA and/or one or more M2-promoting agents, and/or disruption of endogenous GBA), such that the cells may subsequently home to hematopoietic tissue and establish productive hematopoiesis, thereby populating or repopulating a line of cells that is defective or deficient in the subject (e.g., a population of microglia).
- the transplanted hematopoietic stem or progenitor cells are least likely to undergo graft rejection, as the infused cells are derived from the patient and express the same HLA class I and class II antigens as expressed by the patient.
- the subject and the donor may be distinct.
- the subject and the donor are related, and may, for example, be HLA-matched.
- HLA-matched donor-recipient pairs have a decreased risk of graft rejection, as endogenous T cells and NK cells within the transplant recipient are less likely to recognize the incoming hematopoietic stem or progenitor cell graft as foreign, and are thus less likely to mount an immune response against the transplant.
- Exemplary HLA-matched donor-recipient pairs are donors and recipients that are genetically related, such as familial donor-recipient pairs (e.g., sibling donor-recipient pairs).
- the subject and the donor are HLA-mismatched, which occurs when at least one HLA antigen, in particular with respect to HLA-A, HLA-B and HLA-DR, is mismatched between the donor and recipient.
- HLA-mismatched occurs when at least one HLA antigen, in particular with respect to HLA-A, HLA-B and HLA-DR, is mismatched between the donor and recipient.
- one haplotype may be matched between the donor and recipient, and the other may be mismatched.
- the number of cells administered to a subject for the treatment of Parkinson’s disease e.g., a subject for the treatment of Parkinson’s disease.
- G BA-associated Parkinson’s disease as described herein may depend, for example, on the expression level of GBA and, optionally, the expression level of the M2-promoting agent in the cells, the patient, pharmaceutical formulation methods, administration methods (e.g., administration time and administration route), the patient's age, body weight, sex, severity of the disease being treated, and whether or not the patient has been treated with agents to ablate endogenous microglia.
- the number of cells administered may be, for example, 1 x 1 0 6 cells/kg to 1 x 10 12 cells/kg, or more (e.g., 1 x 1 0 7 cells/kg, 1 x 10 8 cells/kg, 1 x 10 9 cells/kg, 1 x 10 10 cells/kg, 1 x 10 1 1 cells/kg, 1 x 10 12 cells/kg, or more).
- Cells may be administered in an undifferentiated state, or after partial or complete differentiation into microglia.
- the number of CD34+ cells may be administered in any suitable dosage following conditioning.
- Non-limiting examples of dosages are about 1 x 1 0 5 CD34+ cells/kg of recipient to about 1 x 10 7 CD34+ cells/kg (e.g., from about 2 x 10 5 CD34+ cells/kg to about 9 x 10 6 CD34+ cells/kg, from about 3 x 1 0 5 CD34+ cells/kg to about 8 x 10 6 CD34+ cells/kg, from about 4 x 10 5 CD34+ cells/kg to about 7 x 10 6 CD34+ cells/kg, from about 5 x 10 5 CD34+ cells/kg to about 6 x 10 ® CD34+ cells/kg, from about 5 x 10 5 CD34+ cells/kg to about 1 x 10 7 CD34+ cells/kg, from about 6 x 10 5 CD34+ cells/kg to about 1 x 10 7 CD34+ cells/kg, from about 7 x 10 5 CD34+ cells/kg to about 1 x 10 7 CD34+ cells/kg, from about 8 x 10 5 CD34+ cells/kg to about 1 x 10
- Additional exemplary dosages are from about 1 x 10 10 CD34+ cells/kg of recipient to about 1 x 10 12 CD34+ cells/kg (e.g., from about 2 x 10 10 CD34+ cells/kg to about 9 x 10 1 1 CD34+ cells/kg, from about 3 x 10 10 CD34+ cells/kg to about 8 x 10 1 1 CD34+ cells/kg, from about 4 x 1 0 10 CD34+ cells/kg to about 7 x 10 11 CD34+ cells/kg, from about 5 x 10 10 CD34+ cells/kg to about 6 x 10 1 1 CD34+ cells/kg, from about 5 x 10 10 CD34+ cells/kg to about 1 x 10 12 CD34+ cells/kg, from about 6 x 1 0 10 CD34+ cells/kg to about 1 x 10 12 CD34+ cells/kg, from about 7 x 10 10 CD34+ cells/kg to about 1 x 10 12 CD34+ cells/kg, from about 8 x 10 10 CD34+ cells/kg to about 1 x
- the cells and compositions described herein can be administered in an amount sufficient to improve one or more pathological features in PD.
- Administration of the cells or compositions described herein may increase the quantity of M2 microglia in the brain of the subject relative to the quantity of M1 microglia in the brain of the subject, decrease the level of proinflammatory cytokines in the brain of the subject, increase the level of anti-inflammatory cytokines in the brain of the subject, improve the cognitive performance of the subject, improve the motor function of the subject, reduce a-synuclein levels or aggregation thereof in the subject, and/or reduce dopaminergic neuron loss in the subject.
- the numbers of M1 and M2 microglia may be assessed using ELISAs to compare the level of cytokines, chemokines, and other pro- and anti-inflammatory mediators in the cerebrospinal fluid (CSF) of subjects before and after treatment, by using PET imaging to view translocator protein (TSPO), a protein highly expressed in classically activated M1 microglia, before and after treatment, e.g., using TSPO radioligand 1 1 C-(R)- PK1 1 1 95, or by analyzing the levels of M1 - and M2-associated genes and proteins in a tissue sample using standard techniques, e.g., western blot analysis, immunohistochemical analyses, or quantitative RT-PCR.
- CSF cerebrospinal fluid
- TSPO translocator protein
- Cognition and motor function can be assessed using standard neurological tests before and after treatment, and monomeric and oligomeric a-synuclein can be detected in plasma and CSF using ELISA.
- Dopaminergic neuron loss can be assessed using F 18 -dopa PET scans or dopamine transporter imaging scans (1231-FP-CIT DaTSCANs).
- M2-promoting agents may reduce one or more pro- inflammatory cytokines, e.g., IL-1 b, tumor necrosis factor, iNOS, IL-6, or IL-12, chemokines, M1 - associated gene and/or protein levels, e.g., MHC II, CD86, CD68, CD1 1 B, or Fey receptors, oligomeric a- synuclein levels, and/or TSPO signal by 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 200%, 500%, or more.
- pro- inflammatory cytokines e.g., IL-1 b, tumor necrosis factor, iNOS, IL-6, or IL-12
- chemokines e.g., MHC II, CD86, CD68, CD1 1 B, or Fey receptors
- M2-promoting agents may increase one or more anti-inflammatory cytokines, e.g., IL-25, IL-10 or TGF-b, chemokines, M2- associated gene and/or protein levels, e.g., CD163, TREM2, Arg1 , or CD206, cognitive function, motor function, and/or F 18 -dopa signal by 10%, 1 5%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 200%, 500%, or more. M2-promoting agents may also slow or prevent a decrease in cognitive function, motor function, and/or F 18 -dopa signal.
- cytokines e.g., IL-25, IL-10 or TGF-b
- chemokines M2- associated gene and/or protein levels
- M2- associated gene and/or protein levels e.g., CD163, TREM2, Arg1 , or CD206
- These effects may occur, for example, within 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 15 weeks, 20 weeks, 25 weeks, or more, following administration of pluripotent cells expressing one or more M2-promoting agents.
- the patient may be evaluated 1 month, 2 months, 3 months, 4 months, 5 months, 6 months or more following administration of the population of pluripotent cells depending on the route of administration used for treatment. Depending on the outcome of the evaluation, the patient may receive additional treatments.
- compositions described herein can be provided in a kit for use in treating Parkinson’s disease.
- Compositions may include host cells described herein (e.g., HSCs, iPSCs, ES cells, CD34+ cells, myeloid progenitor cells) that express GBA and one or more M2-promoting agents, and, optionally, may have disrupted endogenous GBA.
- Cells may be cryopreserved, e.g., in dimethyl sulfoxide (DMSO), glycerol, or another cryoprotectant.
- the kit can include a package insert that instructs a user of the kit, such as a physician, to perform the methods described herein.
- the kit may optionally include a syringe or other device for administering the composition.
- Example 1 Generation of a CD34+ hematopoietic stem cell expressing non-secreted
- glucocerebrosidase GAA
- M2-promoting agent GAA
- pluripotent cells e.g., CD34+ cells
- an M2-promoting agent for use in the compositions and methods described herein is by way of transduction.
- Retroviral vectors e.g., a lentiviral vector, alpharetroviral vector, or
- gammaretroviral vector containing a microglia-specific promoter, such as the CD68 promoter, a signal peptide, such as the GBA signal peptide, and the polynucleotide encoding GBA can be engineered using standard techniques known in the art. If pluripotent cells that express GBA and an M2-promoting agent, such as IL-25, are to be made, a bicistronic expression cassette can be used in which an IRES sequence is placed between the polynucleotide encoding GBA and the polynucleotide encoding IL-25. After the retroviral vector is engineered, the retrovirus can be used to transduce pluripotent cells (e.g., iPS cells,
- ES cells, CD34+ HSCs to generate a population of pluripotent cells that express non-secreted GBA and, optionally, an M2-promoting agent.
- Additional exemplary methods for making pluripotent cells that express non-secreted GBA and, optionally, an M2-promoting agent for use in the compositions and methods described herein is transfection.
- plasmid DNA containing a promoter such as a microglia-specific promoter, (e.g., the CD68 promoter), a signal peptide, such as the GBA signal peptide, and the polynucleotide encoding GBA can be produced.
- a promoter such as a microglia-specific promoter, (e.g., the CD68 promoter)
- a signal peptide such as the GBA signal peptide
- the polynucleotide encoding GBA can be produced.
- the GBA gene may be amplified from a human cell line using PCR-based techniques known in the art, or the gene may be synthesized, for example, using solid-phase polynucleotide synthesis procedures.
- the GBA gene, promoter, and a nucleic acid encoding an M2-promoting agent can then be ligated into a plasmid of interest, for example, using suitable restriction endonuclease-mediated cleavage and ligation protocols. If pluripotent cells that express non-secreted GBA and an M2-promoting agent, such as IL-25, are to be made, a bicistronic expression cassette can be used in which an IRES sequence is placed between the polynucleotide encoding GBA and the polynucleotide encoding IL-25.
- the plasmid can be used to transfect the pluripotent cells (e.g., iPS cells, ES cells, CD34+ HSCs) using, for example, electroporation or another transfection technique described herein to generate a population of pluripotent cells that express non-secreted GBA and, optionally, an M2-promoting agent.
- pluripotent cells e.g., iPS cells, ES cells, CD34+ HSCs
- electroporation or another transfection technique described herein to generate a population of pluripotent cells that express non-secreted GBA and, optionally, an M2-promoting agent.
- the non-secreted GBA may be expressed as a GBA fusion protein.
- the fusion protein may contain non-secreted GBA and a glycosylation independent lysosomal targeting (GILT) tag.
- GILT tags are muteins derived from human insulin-like growth factor II (IGF-II) having an amino acid sequence that is at least 70% identical to the amino acid sequence of mature human IGF-II.
- IGF-II muteins have diminished binding activity for the insulin receptor relative to the affinity of naturally-occurring human IGF-II for the insulin receptor, are resistant to furin cleavage, and bind to the human cation-independent mannose-6-phosphate receptor in a mannose-e- phosphate-independent manner.
- the GILT tag facilitates delivery of the secreted GBA fusion protein to the lysosome.
- FIGS. 1 A-1 G Exemplary constructs encoding GBA for use in conjunction with the compositions and methods described herein are shown in FIGS. 1 A-1 G.
- glucocerebrosidase and optionally, an M2-promoting agent
- Retroviral vectors e.g., a lentiviral vector, alpharetroviral vector, or gammaretroviral vector
- a microglia-specific promoter such as the CD68 promoter
- a secretory signal peptide such as the IGF-II, alpha-1 antitrypsin, or GBA secretory signal peptide
- the polynucleotide encoding GBA can be engineered using standard techniques known in the art.
- pluripotent cells that express secreted GBA and an M2-promoting agent, such as IL-25 are to be made
- a bicistronic expression cassette can be used in which an IRES sequence is placed between the polynucleotide encoding GBA and the polynucleotide encoding IL-25.
- the retrovirus can be used to transduce pluripotent cells (e.g., iPS cells, ES cells, CD34+ HSCs) to generate a population of pluripotent cells that express non-secreted GBA and, optionally, an M2-promoting agent.
- plasmid DNA containing a promoter such as a microglia-specific promoter, (e.g., the CD68 promoter), a secretory signal peptide, such as the IGF-II, alpha-1 antitrypsin, or GBA secretory signal peptide, and the polynucleotide encoding GBA can be produced.
- a promoter such as a microglia-specific promoter, (e.g., the CD68 promoter)
- a secretory signal peptide such as the IGF-II, alpha-1 antitrypsin, or GBA secretory signal peptide
- the polynucleotide encoding GBA can be produced.
- the GBA gene may be amplified from a human cell line using PCR-based techniques known in the art, or the gene may be synthesized, for example, using solid-phase
- the GBA gene, promoter, and a nucleic acid encoding an M2- promoting agent can then be ligated into a plasmid of interest, for example, using suitable restriction endonuclease-mediated cleavage and ligation protocols. If pluripotent cells that express secreted GBA and an M2-promoting agent, such as IL-25, are to be made, a bicistronic expression cassette can be used in which an IRES sequence is placed between the polynucleotide encoding GBA and the polynucleotide encoding IL-25.
- the plasmid can be used to transfect the pluripotent cells (e.g., iPS cells, ES cells, CD34+ HSCs) using, for example, electroporation or another transfection technique described herein to generate a population of pluripotent cells that express non-secreted GBA and, optionally, an M2-promoting agent.
- pluripotent cells e.g., iPS cells, ES cells, CD34+ HSCs
- electroporation or another transfection technique described herein to generate a population of pluripotent cells that express non-secreted GBA and, optionally, an M2-promoting agent.
- the secreted GBA may be expressed as a GBA fusion protein.
- the fusion protein may contain secreted GBA and a glycosylation independent lysosomal targeting (GILT) tag.
- GILT tags are muteins derived from human insulin-like growth factor II (IGF-II) having an amino acid sequence that is at least 70% identical to the amino acid sequence of mature human IGF-II.
- IGF-II muteins have diminished binding activity for the insulin receptor relative to the affinity of naturally-occurring human IGF-II for the insulin receptor, are resistant to furin cleavage, and bind to the human cation-independent mannose-6-phosphate receptor in a mannose-e- phosphate-independent manner.
- the GILT tag facilitates delivery of the secreted GBA fusion protein to the lysosome.
- the secreted GBA fusion protein may additionally contain a peptide sequence containing the LDLRf receptor-binding (Rb) domain apolipoprotein E (ApoE) to allow for the penetrance of the GBA fusion protein across the blood-brain barrier (BBB).
- Example 3 Administration of a population of pluripotent cells expressing GBA to a patient suffering from Parkinson’s disease
- a physician of skill in the art can treat a patient, such as a human patient, so as to reduce or alleviate symptoms of Parkinson’s disease.
- a physician of skill in the art can administer to the human patient a population of pluripotent cells, (e.g., CD34+ cells (such as ES cells, iPS cells, HSCs, or myeloid progenitor cells)) expressing GBA.
- the cells may express an M2-promoting agent, such as IL-25, IL-4, IL-10, IL-13, or TGF-b.
- the cells can be transduced or transfected ex vivo to express GBA and, optionally, an M2-promoting agent using techniques described herein or known in the art.
- the population of pluripotent cells expressing GBA and, optionally, an M2-promoting agent may be administered to the patient, for example, systemically (e.g., intravenously), directly to the central nervous system (CNS) (e.g., intracerebroventricularly or stereotactically), or directly into the bone marrow (e.g., intraosseously), to treat Parkinson’s disease.
- the cells can also be administered to the patient by multiple routes of administration, for example, intravenously and intracerebroventricularly.
- the cells are administered in a therapeutically effective amount, such as from 1 x 10 6 cells/kg to 1 x 10 12 cells/kg or more (e.g., 1 x 1 0 7 cells/kg, 1 x 10 8 cells/kg, 1 x 10 9 cells/kg, 1 x 10 10 cells/kg, 1 x 10 1 1 cells/kg, 1 x 10 12 cells/kg, or more).
- a therapeutically effective amount such as from 1 x 10 6 cells/kg to 1 x 10 12 cells/kg or more (e.g., 1 x 1 0 7 cells/kg, 1 x 10 8 cells/kg, 1 x 10 9 cells/kg, 1 x 10 10 cells/kg, 1 x 10 1 1 cells/kg, 1 x 10 12 cells/kg, or more).
- one or more agents may be administered to the patient to ablate the patient’s endogenous microglia and/or hematopoietic stem and progenitor cells, for example, busulfan, treosulfan, PLX3397, PLX647, PLX5622, and/or clodronate liposomes.
- Other methods of cell ablation well known in the art, such as irradiation, may be used alone or in combination with one or more of the aforementioned agents to ablate the patient’s microglia and/or hematopoietic stem and progenitor cells.
- agents and/or treatments may ablate endogenous microglia and/or hematopoietic stem and progenitor cells by at least 10% (e.g., at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or more), as assessed by PET imaging techniques known in the art. If the population of pluripotent cells expressing GBA and, optionally, an M2-promoting agent is administered to the patient after microglial ablation, the pluripotent cells can repopulate the brain, differentiating into microglia.
- the population of pluripotent cells expressing GBA and, optionally, an M2-promoting agent can be administered to the patient from, for example, 1 week to 1 month (e.g., 1 week, 2 weeks, 3 weeks, 4, weeks) or more after microglial ablation.
- a population of CD34+ cells may be administered to the patient systemically (e.g., intravenously), or by bone marrow transplantation to reconstitute the bone marrow compartment.
- the number of CD34+ cells may be administered in any suitable dosage following conditioning.
- Non-limiting examples of dosages are about 1 x 10 5 CD34+ cells/kg of recipient to about 1 x 1 0 7 CD34+ cells/kg (e.g., from about 2 x 1 0 5 CD34+ cells/kg to about 9 x 10 6 CD34+ cells/kg, from about 3 x 10 5 CD34+ cells/kg to about 8 x 1 0 6 CD34+ cells/kg, from about 4 x 10 5 CD34+ cells/kg to about 7 x 1 0 6 CD34+ cells/kg, from about 5 x 1 0 5 CD34+ cells/kg to about 6 x 10 ® CD34+ cells/kg, from about 5 x 1 0 5 CD34+ cells/kg to about 1 x 1 0 7 CD34+ cells/kg, from about 6 x 10 5 CD34+ cells/kg to about 1 x 1 0 7 CD34+ cells/kg, from about 7 x 1 0 5 CD34+ cells/kg to about 1 x 10 7 CD34+ cells/kg, from about 8 x
- the population of pluripotent cells expressing GBA and, optionally, an M2-promoting agent can be administered to the patient in an amount sufficient to treat one or more of the pathological features of Parkinson’s disease.
- the population of pluripotent cells expressing GBA and, optionally, an M2-promoting agent can be administered in an amount sufficient to increase the quantity of M2 microglia in the brain of the patient relative to the quantity of M1 microglia in the brain of the patient.
- the relative increase can be measured using conventional techniques known in the art, such as by performing an ELISA on patient CSF before and after treatment to assess the level of pro-inflammatory and anti inflammatory cytokines secreted by M1 and M2 microglia at both time points.
- a standard neurological examination can also be performed by the physician before and after treatment to evaluate changes in cognitive performance and motor function.
- the patient may be evaluated, for example, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months or more following administration of the population of pluripotent cells depending on the route of administration used for treatment.
- a finding of reduced pro- inflammatory cytokines, increased anti-inflammatory cytokines, and/or improved cognitive or motor function following administration of a population of pluripotent cells expressing GBA and, optionally, an M2-promoting agent provides an indication that the treatment has successfully treated Parkinson’s disease.
- Example 4 Disruption of endogenous GBA in pluripotent cells prior to administration to a patient suffering from Parkinson’s disease.
- the pluripotent stem cells such as CD34+ cells, (e.g., those expressing a transgene encoding GBA and optionally, one or more M2- promoting agents, or non transgene containing CD34+ cells) may be treated to disrupt the endogenous GBA prior to administration to the patient.
- An exemplary method of disrupting endogenous GBA in pluripotent cells is using a CRISPR/Cas system (e.g., CRISPR/Cas9) with a GBA-specific guide RNA (gRNA) to induce one or more double-strand breaks (DSB).
- CRISPR/Cas system e.g., CRISPR/Cas9
- gRNA GBA-specific guide RNA
- NHEJ non-homologous end joining
- Alternative methods for disruption of endogenous GBA by site-specifically cleaving genomic DNA prior to the incorporation of a GBA transgene in a pluripotent stem cell include the use of zinc finger nucleases (ZFNs) and transcription activator-like effector nucleases (TALENs).
- ZFNs zinc finger nucleases
- TALENs transcription activator-like effector nucleases
- these enzymes do not contain a guiding polynucleotide to localize to a specific target sequence, but instead rely on internal DNA biding domains within the enzymes to mediate target specificity.
- ZFNs zinc finger nucleases
- TALENs transcription activator-like effector nucleases
- the pluripotent cell is manipulated ex vivo by the nuclease to decrease or reduce the expression of endogenous GBA by 10% or more (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or more).
- Example 5 Generation of mammalian cell lines expressing codon-optimized GBA.
- GBAco codon-optimized GBA
- Cells were transduced with one of six engineered constructs selected from the group including: 1 ) green fluorescent protein (GFP); 2) GBAco alone; 3) GBAco, a glycosylation independent lysosomal targeting (GILT) tag, and a peptide linker; 4) GBAco and a modified signal peptide sequence; 5) GBAco, a GILT tag, and a rigid peptide linker; or 6) GBAco, a GILT tag, and an XTEN linker. Protein samples were harvested post-transduction to measure GBA enzymatic activity and to quantify protein levels.
- GBA enzymatic activity was measured in using a 4-methylumbelliferyl b-D-glucopyranoside (4MUG) substrate, which is enzymatically converted by GBA to produce a fluorescent product 4- Methylumbelliferone (4MU).
- engineered GBA proteins were detected at the predicted molecular weights, suggesting that GILT and linker peptides were stably produced (FIG. 3).
- GBA proteins Post-translational glycosylation at the N-terminus of GBA proteins (e.g., N-linked glycosylation) is critical for GBA function.
- engineered GBA proteins were tested for N-linked glycosylation in HEK293T cells in vitro. We assayed the electrophoretic mobility shift of the engineered GBA proteins after enzymatic digestion with either EndoH or PNGase F glycosidases that remove N-linked sugars from glycoproteins.
- FIG. 4A Tukey post-hoc analysis, FIG. 4A.
- GBAco transduction of Lin- cells significantly increased GBA enzymatic activity to similar levels across all tested GBAco constructs relative to GFP control (p ⁇ 0.001 , ANOVA with Tukey post-hoc analysis; FIG 4A).
- GBAco expression led to the detection of GBA activity in conditioned media from the Lin- cells by Western blot (FIG. 4B).
- lentiviral GBAco constructs produce a functional GBA enzyme in hematopoietic stem cells (e.g., mouse Lin- cells) and can rescue GBA activity and expression levels in mouse models of GBA deficiency.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- General Engineering & Computer Science (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Microbiology (AREA)
- Developmental Biology & Embryology (AREA)
- Cell Biology (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Virology (AREA)
- Physics & Mathematics (AREA)
- Toxicology (AREA)
- Psychology (AREA)
- Plant Pathology (AREA)
- Hematology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Dermatology (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/979,378 US20210000929A1 (en) | 2018-03-09 | 2019-03-08 | Compositions and methods for treating parkinson's disease |
| EP19764359.6A EP3762505A4 (en) | 2018-03-09 | 2019-03-08 | COMPOSITIONS AND METHODS OF TREATMENT FOR PARKINSON'S DISEASE |
| JP2020571336A JP2021517168A (ja) | 2018-03-09 | 2019-03-08 | パーキンソン病を処置するための組成物及び方法 |
| AU2019231889A AU2019231889A1 (en) | 2018-03-09 | 2019-03-08 | Compositions and methods for treating Parkinson's disease |
| CA3092961A CA3092961A1 (en) | 2018-03-09 | 2019-03-08 | Compositions and methods for treating parkinson's disease |
| IL277182A IL277182A (en) | 2018-03-09 | 2020-09-07 | Compositions and methods for treating Parkinson's disease |
| JP2024075599A JP2024102250A (ja) | 2018-03-09 | 2024-05-08 | パーキンソン病を処置するための組成物及び方法 |
| AU2025217319A AU2025217319A1 (en) | 2018-03-09 | 2025-08-14 | Compositions and methods for treating Parkinson's disease |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862641012P | 2018-03-09 | 2018-03-09 | |
| US62/641,012 | 2018-03-09 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019173756A1 true WO2019173756A1 (en) | 2019-09-12 |
Family
ID=67847471
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/021422 Ceased WO2019173756A1 (en) | 2018-03-09 | 2019-03-08 | Compositions and methods for treating parkinson's disease |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20210000929A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3762505A4 (cg-RX-API-DMAC7.html) |
| JP (2) | JP2021517168A (cg-RX-API-DMAC7.html) |
| AU (2) | AU2019231889A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3092961A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL277182A (cg-RX-API-DMAC7.html) |
| MA (1) | MA54792A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2019173756A1 (cg-RX-API-DMAC7.html) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021097131A1 (en) * | 2019-11-12 | 2021-05-20 | Orchard Therapeutics (Europe) Limited | Compositions and methods for treating or preventing crohn's disease |
| WO2021199039A1 (en) * | 2020-03-29 | 2021-10-07 | Yeda Research And Development Co. Ltd. | Variants of beta-glucocerebrosidase for use in treating gaucher disease |
| WO2021224633A1 (en) * | 2020-05-06 | 2021-11-11 | Orchard Therapeutics (Europe) Limited | Treatment for neurodegenerative diseases |
| JP2023526773A (ja) * | 2020-05-27 | 2023-06-23 | ウニヴェルジテート・チューリッヒ | 骨髄性細胞およびミクログリアにおいて特異的に治療タンパク質を発現するウイルスベクター |
| JP2023536091A (ja) * | 2020-07-27 | 2023-08-23 | ボイジャー セラピューティクス インコーポレイテッド | グルコシルセラミダーゼベータ欠損に関連する神経障害の治療のための組成物及び方法 |
| WO2024236193A1 (en) * | 2023-05-17 | 2024-11-21 | Ospedale San Raffaele S.R.L. | Vector |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023004366A1 (en) * | 2021-07-21 | 2023-01-26 | Aspen Neuroscience, Inc. | Transposon-based modulation of gba1 and related compositions and uses thereof |
| JP2026506873A (ja) * | 2023-02-02 | 2026-02-27 | エンボールド セラピューティクス, インコーポレイテッド | 操作されたグルコセレブロシダーゼバリアント |
| WO2024238448A2 (en) * | 2023-05-12 | 2024-11-21 | Temple University - Of The Commonwealth System Of Higher Education | Chimeric capsid recombinant adeno-associated virus with bbb penetration and microglia targeting (aav-bm) |
| US12565639B2 (en) | 2023-06-13 | 2026-03-03 | Aspen Neuroscience, Inc. | Methods for differentiating dopaminergic neurons from stem cells |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140112896A1 (en) * | 2012-07-11 | 2014-04-24 | Sangqmo BioSciences, Inc. | Methods and compositions for the provision of proteins deficient in lysosomal storage diseases |
| US20150133496A1 (en) * | 2005-06-08 | 2015-05-14 | Amicus Therapeutics, Inc. | Treatment of CNS Disorders Associated with Mutations in Genes Encoding Lysosomal Enzymes |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2215222T3 (es) * | 1996-12-05 | 2004-10-01 | Crucell Holland B.V. | Modificacion genetica de celulas cepa de repoblacion hematopoyeticas de primates. |
| MY161859A (en) * | 2011-01-03 | 2017-05-15 | Avm Biotechnology Llc | Personalized production of biologics and method for reprogramming somatic cells |
| ES2729997T3 (es) * | 2012-11-27 | 2019-11-07 | Biomarin Pharm Inc | Proteínas de fusión terapéuticas dirigidas de enzima lisosómica y usos de las mismas |
| CA2985235A1 (en) * | 2015-05-07 | 2016-11-10 | Shire Human Genetic Therapies, Inc. | Glucocerebrosidase gene therapy for parkinson's disease |
| US20190085394A1 (en) * | 2015-12-14 | 2019-03-21 | Parkinson's Institute | Refining diagnosis and treatment of complex multi-symptom neurological disorders |
| GB201522243D0 (en) * | 2015-12-16 | 2016-01-27 | Ucl Business Plc | Treatment |
| BR112020008033A2 (pt) * | 2017-10-23 | 2020-10-27 | Prevail Therapeutics, Inc. | terapias gênicas para doença neurodegenerativa |
-
2019
- 2019-03-08 JP JP2020571336A patent/JP2021517168A/ja active Pending
- 2019-03-08 EP EP19764359.6A patent/EP3762505A4/en active Pending
- 2019-03-08 CA CA3092961A patent/CA3092961A1/en active Pending
- 2019-03-08 US US16/979,378 patent/US20210000929A1/en active Pending
- 2019-03-08 AU AU2019231889A patent/AU2019231889A1/en not_active Abandoned
- 2019-03-08 MA MA054792A patent/MA54792A/fr unknown
- 2019-03-08 WO PCT/US2019/021422 patent/WO2019173756A1/en not_active Ceased
-
2020
- 2020-09-07 IL IL277182A patent/IL277182A/en unknown
-
2024
- 2024-05-08 JP JP2024075599A patent/JP2024102250A/ja active Pending
-
2025
- 2025-08-14 AU AU2025217319A patent/AU2025217319A1/en active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20150133496A1 (en) * | 2005-06-08 | 2015-05-14 | Amicus Therapeutics, Inc. | Treatment of CNS Disorders Associated with Mutations in Genes Encoding Lysosomal Enzymes |
| US20140112896A1 (en) * | 2012-07-11 | 2014-04-24 | Sangqmo BioSciences, Inc. | Methods and compositions for the provision of proteins deficient in lysosomal storage diseases |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP3762505A4 * |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021097131A1 (en) * | 2019-11-12 | 2021-05-20 | Orchard Therapeutics (Europe) Limited | Compositions and methods for treating or preventing crohn's disease |
| CN115087455A (zh) * | 2019-11-12 | 2022-09-20 | 奥查德疗法(欧洲)有限公司 | 用于治疗或预防克罗恩病的组合物和方法 |
| WO2021199039A1 (en) * | 2020-03-29 | 2021-10-07 | Yeda Research And Development Co. Ltd. | Variants of beta-glucocerebrosidase for use in treating gaucher disease |
| CN115348884A (zh) * | 2020-03-29 | 2022-11-15 | 耶达研究及发展有限公司 | 用于治疗戈谢病的β-葡糖脑苷脂酶变体 |
| WO2021224633A1 (en) * | 2020-05-06 | 2021-11-11 | Orchard Therapeutics (Europe) Limited | Treatment for neurodegenerative diseases |
| JP2023526773A (ja) * | 2020-05-27 | 2023-06-23 | ウニヴェルジテート・チューリッヒ | 骨髄性細胞およびミクログリアにおいて特異的に治療タンパク質を発現するウイルスベクター |
| JP7820823B2 (ja) | 2020-05-27 | 2026-02-26 | ウニヴェルジテート・チューリッヒ | 骨髄性細胞およびミクログリアにおいて特異的に治療タンパク質を発現するウイルスベクター |
| JP2023536091A (ja) * | 2020-07-27 | 2023-08-23 | ボイジャー セラピューティクス インコーポレイテッド | グルコシルセラミダーゼベータ欠損に関連する神経障害の治療のための組成物及び方法 |
| WO2024236193A1 (en) * | 2023-05-17 | 2024-11-21 | Ospedale San Raffaele S.R.L. | Vector |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3762505A4 (en) | 2021-12-01 |
| IL277182A (en) | 2020-10-29 |
| JP2021517168A (ja) | 2021-07-15 |
| AU2025217319A1 (en) | 2025-09-04 |
| US20210000929A1 (en) | 2021-01-07 |
| EP3762505A1 (en) | 2021-01-13 |
| AU2019231889A1 (en) | 2020-10-01 |
| CA3092961A1 (en) | 2019-09-12 |
| MA54792A (fr) | 2021-12-01 |
| JP2024102250A (ja) | 2024-07-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20210000929A1 (en) | Compositions and methods for treating parkinson's disease | |
| JP2025060943A (ja) | 神経認知障害を処置するための組成物及び方法 | |
| JP2025062601A (ja) | 神経認知障害を処置するための組成物及び方法 | |
| CN106795488A (zh) | 用于造血干细胞中核酸酶介导的基因组工程化和校正的方法和组合物 | |
| WO2016014837A1 (en) | Gene editing for hiv gene therapy | |
| JP2025038075A (ja) | 造血細胞の遺伝子改変のための方法 | |
| US20250136950A1 (en) | Compositions and methods for efficient in vivo delivery | |
| US20230414725A1 (en) | Compositions and methods for treating pompe disease | |
| JP2025032191A (ja) | 神経認知障害を処置するための組成物及び方法 | |
| CA3115902A1 (en) | Selection by means of artificial transactivators | |
| WO2008136670A2 (en) | Improved methods and means for lentiviral gene delivery | |
| US20230322897A1 (en) | Compositions and methods for treating neurocognitive disorders | |
| JP2022545184A (ja) | アンジェルマン症候群の処置のためのube3a | |
| US20240325506A1 (en) | Compositions and methods for treatment of gaucher disease | |
| WO2020165901A1 (en) | Site specific recombinase integrase variants and uses thereof in gene editing in eukaryotic cells | |
| JP2023553701A (ja) | 先天性筋ジストロフィーの処置のための治療用lama2ペイロード | |
| US20240156873A1 (en) | Methods to genetically engineer hematopoietic stem and progenitor cells for red cell specific expression of therapeutic proteins | |
| EP4704813A2 (en) | Cellular delivery of therapeutics using fusogenic vesicles | |
| WO2025219572A1 (en) | Targeting mapk-erk pathway for enhancing nucleic acid delivery | |
| CN121241141A (zh) | 通过编辑突变亨廷顿基因治疗亨廷顿病的组合物及方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19764359 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3092961 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020571336 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2019231889 Country of ref document: AU Date of ref document: 20190308 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2019764359 Country of ref document: EP |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 277182 Country of ref document: IL |