WO2019051424A2 - COMPOSITIONS AND METHODS FOR CONDITIONAL GENE EXPRESSION MEDIATED BY A CHIMERIC LIGAND RECEPTOR (CLR) - Google Patents

COMPOSITIONS AND METHODS FOR CONDITIONAL GENE EXPRESSION MEDIATED BY A CHIMERIC LIGAND RECEPTOR (CLR) Download PDF

Info

Publication number
WO2019051424A2
WO2019051424A2 PCT/US2018/050288 US2018050288W WO2019051424A2 WO 2019051424 A2 WO2019051424 A2 WO 2019051424A2 US 2018050288 W US2018050288 W US 2018050288W WO 2019051424 A2 WO2019051424 A2 WO 2019051424A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
composition
sequence
certain embodiments
piggybac
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/050288
Other languages
English (en)
French (fr)
Other versions
WO2019051424A3 (en
WO2019051424A9 (en
Inventor
Eric OSTERAG
Devon SHEDLOCK
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Poseida Therapeutics Inc
Original Assignee
Poseida Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US16/640,788 priority Critical patent/US12385061B2/en
Priority to EP18800779.3A priority patent/EP3679145A2/en
Priority to CA3072777A priority patent/CA3072777A1/en
Priority to CN201880071587.1A priority patent/CN111727256A/zh
Priority to JP2020513604A priority patent/JP2020532987A/ja
Priority to AU2018329741A priority patent/AU2018329741B2/en
Application filed by Poseida Therapeutics Inc filed Critical Poseida Therapeutics Inc
Publication of WO2019051424A2 publication Critical patent/WO2019051424A2/en
Publication of WO2019051424A3 publication Critical patent/WO2019051424A3/en
Publication of WO2019051424A9 publication Critical patent/WO2019051424A9/en
Anticipated expiration legal-status Critical
Priority to JP2024076622A priority patent/JP2024109657A/ja
Priority to AU2025203769A priority patent/AU2025203769A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4214Receptors for cytokines
    • A61K40/4215Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR], CD30
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/78Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0012Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7)
    • C12N9/0026Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on CH-NH groups of donors (1.5)
    • C12N9/0028Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on CH-NH groups of donors (1.5) with NAD or NADP as acceptor (1.5.1)
    • C12N9/003Dihydrofolate reductase [DHFR] (1.5.1.3)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/64Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
    • C12N9/6421Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
    • C12N9/6424Serine endopeptidases (3.4.21)
    • C12N9/644Coagulation factor IXa (3.4.21.22)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y105/00Oxidoreductases acting on the CH-NH group of donors (1.5)
    • C12Y105/01Oxidoreductases acting on the CH-NH group of donors (1.5) with NAD+ or NADP+ as acceptor (1.5.1)
    • C12Y105/01003Dihydrofolate reductase (1.5.1.3)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y304/00Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/21Serine endopeptidases (3.4.21)
    • C12Y304/21022Coagulation factor IXa (3.4.21.22)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/90Vectors containing a transposable element
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00Vector systems having a special element relevant for transcription
    • C12N2830/001Vector systems having a special element relevant for transcription controllable enhancer/promoter combination
    • C12N2830/002Vector systems having a special element relevant for transcription controllable enhancer/promoter combination inducible enhancer/promoter combination, e.g. hypoxia, iron, transcription factor

Definitions

  • the disclosure is directed to molecular biology, and more, specifically, to compositions and methods for use in a conditional gene expression system responsive to a chimeric ligand receptor (CLR)-mediated signal.
  • CLR chimeric ligand receptor
  • composition comprising (a) an inducible transgene construct, comprising a sequence encoding an inducible promoter and a sequence encoding a transgene, and (b) a receptor construct, comprising a sequence encoding a constitutive promoter and a sequence encoding an exogenous receptor, wherein, upon integration of the construct of (a) and the constmct of (b) into a genomic sequence of a cell, the exogenous reporter is expressed, and wherein the exogenous reporter, upon binding a ligand, transduces an intracellular signal that targets the inducible promoter of (a) to modify gene expression.
  • the composition modifies gene expression by increasing gene expression.
  • the composition modifies gene expression by decreasing gene expression, in certain embodiments, the composition modifies gene expression by transiently modifying gene expression (e.g. for the duration of binding of the ligand to the exogenous receptor). In certain embodiments, the composition modifies gene expression acutely (e.g. the ligand reversibly binds to the exogenous receptor), in certain embodiments, the composition modifies gene expression chronically (e.g. the ligand irreversibly binds to the exogenous receptor).
  • the cell may be a prokaryotic cell.
  • Prokaryotic cells of the disclosure include, but are not limited to, bacteria and archaea.
  • bacteria of the disclosure include, but are not limited to, listeria monocytogenes .
  • the cell may be a eukaryotic cell .
  • Eukaryotic cells of the disclosure include, but are not limited to, yeast, plants, algae, insects, mammals, amphibians, birds, reptiles, marsupials, rodents, and humans.
  • Preferred eukaryotic ceils of the disclosure include, but are not limited to, human cells.
  • Exemplary human cells of the disclosure include but are not limited to, immune celis (e.g. T cells), myeloid cells and bone marrow cells (e.g. hematopoietic stem cells (HSCs)).
  • immune celis e.g. T cells
  • myeloid cells e.g. myeloid cells
  • bone marrow cells e.g. hematopoietic stem cells (HSCs)
  • the exogenous receptor of (b) comprises an endogenous receptor with respect to the genomic sequence of the cell.
  • exemplary receptors include, but are not limited to, intracellular receptors, cell- surface receptors, transmembrane receptors, ligand-gated ion channels, and G-protein coupled receptors.
  • the exogenous receptor of (b) comprises a non-naturally occurring receptor.
  • the non-naturally occurring receptor is a synthetic, modified, recombinant, mutant or chimeric receptor.
  • the non-naturally occurring receptor comprises one or more sequences isolated or derived from a T-cell receptor (TCR).
  • TCR T-cell receptor
  • the non-naturally occurring receptor comprises one or more sequences isolated or derived from a scaffold protein.
  • the non-naturally occurring receptor interacts with a second transmembrane, membrane-b und and/or an intracellular receptor that, following contact with the non-naturally occurring receptor, transduces an intracellular signal.
  • the exogenous receptor of (b) comprises a non-naturally occurring receptor.
  • the non-naturally occurring receptor is a synthetic, modified, recombinant, mutant or chimeric receptor.
  • the non-naturally occurring receptor comprises one or more sequences isolated or derived from a T-cell receptor (TCR).
  • the non-naturally occurring receptor comprises one or more sequences isolated or derived from a scaffold protein. In certain embodiments, the non-naturally occurring receptor comprises a transmembrane domain. In certain embodiments, the non-naturally occurring receptor interacts with an intracellular receptor that transduces an intracellular signal. In certain embodiments, the non-naturally occurring receptor comprises an intracellular signalling domain. In certain embodiments, the non-naturally occurring receptor is a chimeric ligand receptor (CLR). In certain embodiments, the CLR is a chimeric antigen receptor.
  • CLR chimeric ligand receptor
  • the exogenous receptor of (b) comprises a non-naturally occurring receptor.
  • the CLR is a chimeric antigen receptor.
  • the chimeric ligand receptor comprises (a) an ectodomain comprising a ligand recognition region, wherein the ligand recognition region comprises at least scaffold protein; (b) a. transmembrane domain, and (c) an endodomain comprising at least one costimulatory domain.
  • the ectodomain of (a) further comprises a signal peptide.
  • the ectodomain of (a) further comprises a hinge between the ligand recognition region and the
  • the signal peptide comprises a sequence encoding a human CD2, CD35, CD3e, CD3y, ⁇ . ) 3 ⁇ , CD4, CD8a, CD19, CD28, 4-1BB or GM-CSFR signal peptide.
  • the signal peptide comprises a sequence encoding a human CD8a signal peptide.
  • the signal peptide comprises an amino acid sequence comprising MALPVTALLLPLALLLHAARP (SEQ ID NO: 17000).
  • the signal peptide is encoded by a nucleic acid sequence comprising atggcactgccagtcaccgccctgctgctgcctctggctctgctgcacgcagctagacca (SEQ ID NO: 17001).
  • the transmembrane domain comprises a sequence encoding a human CD2, CD38, CD3e, CD3y, ⁇ . ) 3 ⁇ , CD4, CD8a, CD19, CD28, 4- 1BB or GM-CSFR transmembrane domain.
  • the transmembrane domain comprises a sequence encoding a human CD8a transmembrane domain.
  • the transmembrane domain comprises an amino acid sequence comprising IYIWAPLAGTCGVLLLSLVITLYC (SEQ ID NO: 17002). In certain embodiments, the transmembrane domain is encoded by a nucleic acid sequence comprising atctacaittgggcaccactggccgggacctgtggagtgctgclgctgagcctggtcatcacactgtaclgc (SEQ ID NO: 17003). In certain embodiments, the endodomain comprises a human 0 ⁇ 3 ⁇ endodomain.
  • the at least one eostimulatory domain comprises a human 4- IBB, CD28, ⁇ 03 ⁇ , CD40, ICOS, MyD88, OX-40 intracellular segment, or any combination thereof.
  • the at least, one eostimulatory domain comprises a human CD3 ⁇ and or a 4-!BB costimulatorv' domain.
  • the € ⁇ 33 ⁇ eostimulatory domain comprises an amino acid sequence comprising
  • the 0 ⁇ 3 ⁇ eostimulatory domain is encoded by a nucleic acid sequence comprising
  • the 4- IBB costimulatorv' domain comprises an amino acid sequence comprising
  • the 4-lBB eostimulatory domain is encoded by a nucleic acid sequence comprising
  • the 4- IBB eostimulatory domain is located between the transmembrane domain and the €03 ⁇ eostimulatory domain.
  • the hinge comprises a sequence derived from a human CD8a, IgG4, and/or CD4 sequence. In certain embodiments, the hinge comprises a sequence derived from a human CD8a sequence. In certain embodiments, the hinge
  • the hinge is encoded by a nucleic acid sequence comprising actaccacaccagcacctagaccaccaactccagctccaaccatcgcgagtcagcccctgagtctgagacctgaggcctgcaggcc agctgcaggaggagctgtgcacaccaggggcctggacttcgcctgcgac (SEQ ID NO: 17028).
  • the hinge is encoded by a nucleic acid sequence comprising ACCACAACCCCTGCCCCCAGACCTCCCACACCCGCCCCTACCATCGCGAGTCAGC CCCTGAGTCTGAGACCTGAGGCCTGCAGGCCAGCTGCAGGAGGAGCTGTGCACA CCAGGGGCCTGGACTTCGCCTGCGAC (SEQ ID NO: 17009).
  • the at least one protein scaffold specifically binds the gand.
  • the exogenous receptor of (b) comprises a non-naturally occurring receptor.
  • the CLR is a chimeric antigen receptor.
  • the chimeric ligand receptor comprises (a) an eciodomain comprising a ligand recognition region, wherein the ligand recognition region comprises at least scaffold protein; (b) a transmembrane domain, and (c) an endodomain comprising at least one costimulatory domain.
  • the at least one protein scaffold comprises an antibody, an antibody fragment, a single domain antibody, a single chain antibody, an antibody mimetic, or a Centyrin.
  • the ligand recognition region comprises one or more of an antibody, an antibody fragment, a single domain antibody, a single chain antibody, an antibody mimetic, and a Centyrin.
  • the single domain antibody comprises or consists of a VHH.
  • the antibody mimetic comprises or consists of an affibody, an affiilin, an affimer, an affitin, an alphabody, an anticalin, an avimer, a DARPin, a Fynomer, a unitz domain peptide or a monobody.
  • the Centyrin comprises or consists of a consensus sequence of at least one fibronectin type III (FN3) domain.
  • the exogenous receptor of (b) comprises a non-natural ly occurring receptor.
  • the CLR is a chimeric antigen receptor.
  • the chimeric ligand receptor comprises (a) an eciodomain comprising a ligand recognition region, wherein the ligand recognition region comprises at least scaffold protein; (b) a transmembrane domain, and (c) an endodomain comprising at least one costimulatory domain.
  • the Centyrin comprises or consists of a consensus sequence of at least one fibronectin type III (FN3) domain.
  • the at least one fibronectin type III (FN3) domain is derived from a human protein.
  • the human protein is Tenascin-C.
  • the consensus sequence comprises
  • LPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTVPGSERSYDL TGLKPGTEYTVSIYGVKGGHRSNPLSAEFTT (SEQ ID NO: 17010).
  • the consensus sequence comprises LPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTVPGSERSYD LTGLKPGTEYTVSIYGVKGGH SNPLSAEFTT (SEQ ID NO; 1701 1 ).
  • the consensus sequence is modified at one or more positions within (a) a A-B loop comprising or consisting of the amino acid residues TEDS at positions 13-16 of the consensus sequence; (b) a B-C loop comprising or consisting of the amino acid residues TAPDAAF at positions 22-28 of the consensus sequence; (c) a C-D loop comprising or consisting of the amino acid residues SEKVGE at positions 38-43 of the consensus sequence; (d) a D-E loop comprising or consisting of the amino acid residues GSER at positions 51-54 of the consensus sequence; (e) a E-F loop comprising or consisting of the amino acid residues GLKPG at positions 60-64 of the consensus sequence; (f) a F-G loop comprising or consisting of the amino acid residues KGGHRSN at positions 75-81 of the consensus sequence; or (g) any combination of (a)-(f).
  • the Centyrin comprises a consensus sequence of at least 5 fibronectin type III (
  • the Centyrin comprises a consensus sequence of at least 10 fibronectin type III (FN3) domains. In certain embodiments, the Centyrin comprises a consensus sequence of at least 15 fibronectin type III (FN3) domains.
  • the scaffold binds an antigen with at least one affinity selected from a KD of less than or equal to l(T y M, less than or equal to 10 iG M, less than or equal to 10 ! 1 M, less than or equal to 10 12 M, less than or equal to 10 ⁇ 13 M, less than or equal to 10 "14 M, and less than or equal to 10 "15 M.
  • the KD is determined by surface plasmon resonance.
  • the exogenous receptor of (b) comprises a non-naturally occurring receptor.
  • the CLR is a chimeric antigen receptor.
  • the chimeric ligand receptor comprises (a) an ectodomain comprising a ligand recognition region, wherein the ligand recognition region comprises at least a VHH antibody; (b) a transmembrane domain, and (c) an endodomain comprising at least one costimuiatory domain.
  • the VHH is camelid.
  • the VHH i humanized.
  • the sequence comprises two heavy chain variable regions of an antibody, wherein the complementarity-determining regions (CDRs) of the VHH are human sequences.
  • the sequence encoding the constitutive promoter of (b) comprises a sequence encoding an EF l a promoter.
  • the sequence encoding the constitutive promoter of (b) comprises a sequence encoding a CMV promoter, a U6 promoter, a SV40 promoter, a PGKl promoter, a Ubc promoter, a human beta actin promoter, a C AG promoter, or an EF la promoter,
  • the sequence encoding the inducible promoter of (a) comprises a sequence encoding an NFKB promoter. In certain embodiments of the compositions of the disclosure, the sequence encoding the inducible promoter of (a) comprises a sequence encoding an interferon (IFN) promoter or a sequence encoding an interleukin-2 promoter. In certain embodiments of the composi tions of the disclosure, the sequence encoding the inducible promoter of (a) comprises a sequence encoding a nuclear receptor subfamily 4 group A member 1 (NR4A 1 ; also known as NIJR77) promoter or a sequence encoding a NR4Al promoter.
  • NR4A 1 nuclear receptor subfamily 4 group A member 1
  • the sequence encoding the inducible promoter of (a) comprises a sequence encoding a T-cell surface glycoprotein CDS (CDS) promoter or a sequence encoding a CDS promoter.
  • the interferon (IFN) promoter is an IFNy promoter, in certain embodiments of the compositions of the disclosure, the inducible promoter is isolated or derived from the promoter of a cytokine or a chemokine.
  • the cytokine or chemokine comprises IL2, IL3, IL4, IL5, IL6, IL K), I I 1 2. I I . 1 .1 ⁇ . ⁇ 7 ⁇ F.
  • TL21 S S .22 IL23, transfonning growth factor beta ( ⁇ ), colony stimulating factor 2 (GM-CSF), interferon gamma (IFNy), Tumor necrosis factor (TNFa), LTa, perforin, Granz me C (Gzmc), Granzyme B (Gzmb), C-C motif chemokine ligand 5 (CCLS), C-C motif chemokine ligand 4 (CCL4), C-C motif chemokine ligand 3 (CCL3), X-C motif chemokine ligand 1 (XCL1) and LIF inter! eukin 6 family cytokine ( I i f).
  • colony stimulating factor 2
  • IFNy interferon gamma
  • TNFa Tumor necrosis factor
  • LTa perforin
  • Granz me C Gzmc
  • Granzyme B Gzmb
  • C-C motif chemokine ligand 5 C-C motif chemok
  • compositions of the disclosure including those wherein the sequence encoding the inducible promoter of (a) comprises a sequence encoding a NR4A1 promoter or a sequence encoding a NR4A ! promoter, the NR4A 1 promoter is activated by T-cell Receptor (TCR) stimulation in T cells and by B-cell Receptor (BCR) stimulation in B cells, therefore, inducing expression of any sequence under control of the NR4A 1 promoter upon activation of a T-cell or B-cell of the disclosure through a TCR or BCR, respectively.
  • TCR T-cell Receptor
  • BCR B-cell Receptor
  • compositions of the disclosure including those wherein the sequence encoding the inducible promoter of (a) comprises a sequence encoding a CDS promoter or a sequence encoding a CDS promoter, the CDS promoter is activated by T-ceil Receptor (TCR) stimulation in T cells, therefore, inducing expression of any sequence under control of the CDS promoter upon activation of a T-cell of the disclosure through a TCR.
  • TCR T-ceil Receptor
  • the inducible promoter is isolated or derived from the promoter of a gene comprising a surface protein involved in cell differention, activation, exhaustion and function.
  • the gene comprises CD69, CD7 I , CTLA4, PD-1, TIGIT, LAGS, ⁇ -3, GITR, MHCII, COX-2, FASL and 4-1BB.
  • the inducible promoter is isolated or derived from the promoter of a gene involved in CD metabolism and differentiation. In certain embodiments of the compositions of the disclosure, the inducible promoter is isolated or derived from the promoter of Nr4al, r4a3, Tnfrsf9 (4-1 BB), Sema7a, Zfp36I2, Gadd45b, DuspS, Dusp6 and Neto2.
  • the transgene comprises a sequence that is endogenous with respect to the genomic sequence of the cell [021] In certain embodiments of the compositions of the disclosure, the transgene comprises a sequence that is exogenous with respect to the genomic sequence of the cell. In certain embodiments, the exogenous sequence is a sequence variant of an endogenous sequence within the genome of the cell. In certain embodiments, the exogenous sequence is a wild type sequence of gene that is entirely or partially absent in the cell, and wherein the gene is entirely present m the genome of a healthy cell .
  • the exogenous sequence is a synthetic, modified, recombinant, chimeric or non-naturally occurring sequence with respect to the genome of the cell.
  • the transgene encodes a secreted protein.
  • the secreted protein is produced and/or secreted from the cell at a level that is therapeutically effective to treat a disease or disorder in a subject in need thereof
  • a first transposon comprises the inducible transgene construct of (a) and a second transposon comprises the receptor constmct of (b).
  • a first vector comprises the first transposon and a second vector comprises the second transposon.
  • a vector comprises the first transposon and the second transposon.
  • the first transposon and the second transposon are oriented in the same direction.
  • the first transposon and the second transposon are oriented in opposite directions.
  • the vector is a plasmid. in certain embodiments, the vector is a nanoplasmid.
  • the vector is a viral vector.
  • Viral vectors of the disclosure may comprise a sequence isolated or derived from a retrovirus, a lentivirus, an adenovirus, an adeno-associated virus or any combination thereof
  • the viral vector may comprise a sequence isolated or derived from an adeno-associated virus (AAV).
  • the viral vector may comprise a recombinant AAV (rAAV).
  • Exemplary adeno- associated viruses and recombinant adeno-associated viruses of the disclosure comprise two or more inverted terminal repeat (ITR) sequences located in cis next to a sequence encoding a construct of the disclosure.
  • ITR inverted terminal repeat
  • Exemplar)' adeno-associaled viruses and recombinant adeno- associated viruses of the disclosure include, but are not limited to all serotypes (e.g. AAV l, AAV2, AAV3, AAV4, AAV 5, AAV6, AAV7, AA 8, and AAV9).
  • Exemplary adeno- associated viruses and recombinant adeno-associated viruses of the disclosure include, but are not limited to, self-complementary AAV (scAAV) and AAV hybrids containing the genome of one serotype and the capsid of another serotype (e.g. AAV2/5, AAV-DJ and AAV-DJ8).
  • Exemplaiy adeno-associated viruses and recombinant adeno-associated viruses of the disclosure include, but are not limited to, rAAV-LK03 and AAVs with the NP-59 and NP-84 capsid variants.
  • the vector is a nanoparticle.
  • Exemplary nanoparticle vectors of the disclosure include, but are not limited to, nucleic acids (e.g. R A, DNA, synthetic nucleotides, modified nucleotides or any combination thereof ), ammo acids (L-amino acids, D-amino acids, synthetic amino acids, modified amino acids, or any combination thereof), polymers (e.g. polymersomes), micelles, lipids (e.g. liposomes), organic molecules (e.g. carbon atoms, sheets, fibers, tubes), inorganic molecules (e.g. calcium phosphate or gold) or any combination thereof.
  • a nanoparticle vector may be passively or actively transported across a cell membrane.
  • first transposon or the second transposon is a piggyBac transposon.
  • the first transposon and the second transposon is a piggyBac transposon.
  • the composition further comprises a plasmid or a nanoplasmid comprising a sequence encoding a transposase enzyme, in certain embodiments, the sequence encoding a transposase enzyme is an tiRNA sequence, in certain embodiments, the transposase is a piggyBac transposase.
  • the piggyBac transposase comprises an ammo acid sequence comprising SEQ ID NO: 1.
  • the piggyBac transposase is a hyperactive variant and wherein the hyperactive variant comprises an amino acid substitution at one or more of positions 30, 165, 282 and 538 of SEQ ID NO: 1.
  • the amino acid substitution at position 30 of SEQ ID NO: 1 is a substitirtion of a valine (V) for an isoieucine (I) (I30V).
  • the amino acid substitution at position 1 5 of SEQ ID NO: 1 is a substitution of a serine (S) for a glycine (G) (Gl 65S).
  • the amino acid substitution at position 282 of SEQ ID NO: 1 is a substitution of a valine (V) for a methionine (M) (M282V).
  • the amino acid substitution at position 538 of SEQ ID NO: 1 is a substitution of a lysine (K) for an asparagine (N) (N538 ).
  • the transposase is a Super piggyBac (SPB) transposase.
  • the Super piggyBac (SPB) transposase comprises an amino acid sequence comprising SEQ ID NO: 2.
  • the transposase enzyme is a piggyBacTM (PB) transposase enzyme.
  • PB piggyBac
  • the piggyBac (PB) transposase enzyme may comprise or consist of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:
  • the transposase enzyme is a piggyBac "1 (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substution at one or more of positions 30, 165, 282, or 538 of the sequence:
  • PB piggyBac "1
  • the transposase enzyme is a pigg BacTM (PB) transposase nz me that comprises or consists of an amino acid sequence having an amino acid substution at two or more of positions 30, 165, 282, or 538 of the sequence of SEQ ID NO: 1.
  • the transposase enzyme is a piggyBacTM (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substution at three or more of positions 30, 1 65, 282, or 538 of the sequence of SEQ ID NO: 1.
  • the transposase enzyme is a piggyBacTM (PB) transposase enzyme that comprises or consists of an ammo acid sequence having an ammo acid substution at each of the following positions 30, 165, 282, and 538 of the sequence of SEQ ID NO: I.
  • the amino acid substution at position 30 of the sequence of SEQ ID NO: 1 is a substitution of a valine (V) for an isoleucine (1).
  • the amino acid substution at position 165 of the sequence of SEQ ID NO: 1 is a substitution of a serine (S) for a glycine (G).
  • the amino acid substution at position 282 of the sequence of SEQ ID NO; 1 is a substitution of a valine (V) for a methionine (M).
  • the amino acid substution at position 538 of the sequence of SEQ ID NO: 1 is a substitution of a lysine ( ) for an asparagine (N).
  • the transposase enzy me is a Super piggyBacTM (SPB) transposase enzyme.
  • the Super piggyBacTM (SPB) transposase enzymes of the disclosure may comprise or consist of the amino acid sequence of the sequence of SEQ ID NO; 1 wherein the amino acid substution at position 30 is a substitution of a valine (V) for an isoleucine (I), the amino acid substution at position 165 is a substitution of a serine (S) for a glycine (G), the amino acid substution at position 282 is a substitution of a valine (V) for a methionine (M), and the amino acid substution at position 538 is a substitution of a lysine (K) for an asparagine (N).
  • the Super piggyBacTM (SPB) transposase enzyme may comprise or consist of an amino acid sequence of the sequence of SEQ ID NO; 1 wherein the amino acid sub
  • the piggyBacTM or Super piggyBacTM transposase enzyme may further comprise an amino acid substitution at one or more of positions 3, 46, 82, 103, 1 19, 125, 177, 180, 185, 187, 200, 207, 209, 226, 235, 240, 241, 243, 258, 296, 298, 31 1 , 315, 319, 327, 328, 340, 421, 436, 456, 470, 486, 503. 552, 570 and 591 of the sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
  • the piggyBacTM or Super piggyBacTM transposase enzyme may further comprise an amino acid substitution at one or more of positions 46, 119, 125, 177, 180, 185, 187, 200, 207, 209, 226. 235, 240, 241, 243, 296, 298, 311, 315, 319, 327, 328, 340, 421, 436, 456, 470, 485, 503, 552 and 570.
  • the amino acid substitution at position 3 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of an asparagine (N) for a serine (S).
  • the amino acid substitution at position 46 of SEQ ID NO: I or SEQ ID NO: 2 is a substitution of a serine (S) for an alanine (A).
  • the amino acid substitution at position 46 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a threonine (T ) for an alanine (A).
  • the amino acid substitution at position 82 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a tryptophan (W) for an isoleucine (I).
  • the ammo acid substitution at position 103 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a proline (P) for a serine (S).
  • the amino acid substitution at position 119 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a proline (P) for an arginine (R).
  • the amino acid substitution at position 125 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of an alanine (A) a cysteine (C), In certain embodiments, the amino acid substitution at position 125 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a leucine (L) for a cysteine (C). In certain embodiments, the amino acid substitution at position 177 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a lysine (K) for a tyrosine (Y).
  • the amino acid substitution at position 177 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a histidine (H) for a tyrosine (Y).
  • the amino acid substitution at position 1 80 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a leucine (L) for a phenylalanine (F).
  • the amino acid substitution at position 180 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of an isoleucine (I) for a phenylalanine (F).
  • SEQ ID NO: 2 is a substitution of a valine (V) for a phenylalanine (F),
  • the amino acid substitution at position 185 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a leucine (L) for a methionine (M).
  • the amino acid substitution at position 187 of SEQ ID NO: I or SEQ ID NO: 2 is a substitution of a glycine (G) for an alanine (A).
  • the amino acid substitution at position 200 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a tryptophan (W) for a phenylalanine (F).
  • the amino acid substitution at position 207 of SEQ ID NO: i or SEQ ID NO: 2 is a substitution of a proline (P) for a valine (V).
  • the amino acid substitution at position 209 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a phenylalanine (F) for a valine (V).
  • the amino acid substitution at position 226 of SEQ ID NO: I or SEQ ID NO: 2 is a substitution of a phenylalanine (F) for a methionine (M).
  • the ammo acid substitution at position 235 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of an arginine (R) for a leucine (L).
  • the amino acid substitution at position 240 of SEQ ID NO: 1 or SEQ ID NO: I is a substitution of a lysine ( ) for a valine (V).
  • the amino acid substitution at position 241 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a leucine (L) for a phenylalanine (F).
  • the amino acid substitution at position 243 of SEQ ID NO: I or SEQ ID NO: 2 is a substitution of a lysine (K) for a proline (P)
  • the amino acid substitution at position 258 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a serine (S) for an asparagine (N).
  • the amino acid substitution at position 296 of SEQ it) NO: 1 or SEQ ID NO: 2 is a substitution of a tryptophan (W) for a leucine (L). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a tyrosine (Y) for a leucine (L). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a phenylalanine (F) for a leucine (L).
  • the amino acid substitution at position 298 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a leucine (L) for a methionine (M), In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of an alanine (A) for a methionine (M). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: lor SEQ ID NO: 2 is a substitution of a valine (V) for a methionine (M).
  • the ammo acid substitution at position 311 of SEQ ID NO: I or SEQ ID NO: 2 is a substitution of an isoleucine (I) for a proline (P).
  • the amino acid substitution at position 31 1 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a valine for a proline (P)
  • the amino acid substitution at position 315 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a lysine (K) for an arginine (R).
  • the amino acid substitution at position 319 of SEQ ID NO: 1 or SEQ ID NO: 2 is a.
  • the ammo acid substitution at position 327 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of an arginine (R) for a tyrosine (Y).
  • the amino acid substitution ai position 328 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a valine (V) for a tyrosine (Y).
  • the amino acid substitution at position 340 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a glycine (G) for a cysteine (C).
  • the amino acid substitution at position 340 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a leucine (L) for a cysteine (C).
  • the amino acid substitution at position 421 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a histidme (H) for the aspartic acid (D).
  • the amino acid substitution at position 436 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of an isoleucine (I) for a valine (V).
  • the amino acid substitution at position 456 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a tyrosine (Y) for a methionine (M).
  • the amino acid substitution at position 470 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a phenylalanine (F) for a leucine (L).
  • the amino acid substitution at position 485 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a lysine ( ) for a serine (S).
  • the amino acid substitution at position 503 of SEQ) ID NO: 1 or SEQ ID NO: 2 is a substitution of a leucine (L) for a methionine (M).
  • the amino acid substitution at position 503 of SEQ ID NO: I or SEQ ID NO: 2 is a substitution of an isoleucme (I) for a methionine (M).
  • the amino acid substitution at position 552 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a lysine (K) for a valine (V).
  • the amino acid substitution at position 570 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a threonine (T) for an alanine (A).
  • the amino acid substitution at position 591 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a proline (P) for a glutamine (Q).
  • the amino acid substitution at position 591 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of an arginine (R) for a glutamine (Q).
  • the piggyBacTM transposase enzyme may comprise or the Super piggyBacTM transposase enzyme may further comprise an amino aci d substitution at one or more of positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
  • the piggyBacTM transposase enzyme may comprise or the Super piggyBacTM transposase enzyme may further comprise an amino acid substitution at two, three, four, five, six or more of positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
  • the piggyBacTM transposase enzyme may comprise or the Super piggyBacTM transposase enzyme may further comprise an amino acid substitution at positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
  • the amino acid substitution at position 103 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a proline (P) for a serine (S).
  • the amino acid substitution at position 194 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a valine (V) for a methionine (M).
  • the amino acid substitution at position 372 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of an alanine (A) for an arginine (R).
  • the amino acid substitution at position 375 of SEQ ID NO: I or SEQ ID NO: 2 is a substitution of an alanine (A) for a lysine (K).
  • the amino acid substitution at position 450 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of an asparagme (N) for an aspartic acid (D).
  • the ammo acid substitution at position 509 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a glycine (G) for a serine (S).
  • the amino acid substitution at position 570 of SEQ ID NO: 1 or SEQ ID NO: 2 is a substitution of a serine (S) for an asparagine (N).
  • the piggyBacTM transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 1 .
  • the piggyBacTM transposase enzyme may further comprise an amino acid substitution at positions 372, 375 and 450 of the sequence of SEQ ID NO: 1 or SEQ ID NO: 2, In certain
  • the piggyBacTM transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: I , a substitution of an alanine (A) for an arginine (R) at position 372 of SEQ ID NO: 1 , and a substitution of an alanine (A) for a lysine (K) at position 375 of SEQ ID NO: 1.
  • the piggyBacTM transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 1 , a substitution of an alanine (A) for an arginine (R) at position 372 of SEQ ID NO: 1 , a substitution of an alanine (A) for a l sine (K) at position 375 of SEQ ID NO: 1 and a substitution of an asparagine (N) for an aspartic acid (D) at position 450 of SEQ ID NO: 1.
  • the transposase enzyme is a Sleeping Beauty transposase enzyme (see, for example, US Patent No. 9,228, 180, the contents of which are incorporated herein in their entirety).
  • the Sleeping Beauty transposase is a hyperactive Sleeping Beauty (SB100X) transposase.
  • the Sleeping Beauty transposase enzyme comprises an amino acid sequence at least 75% identi cal to:
  • the Sleeping Beauty transposase is a hyperactive Sleeping Beauty (SB100X) transposase
  • the Sleeping Beauty transposase enzyme comprises an amino acid sequence at least 75% identical to:
  • ATKY (SEQ ID NO: 17032)
  • the first transposon and ' or the second transposon further comprises a selection gene
  • the selection gene comprises neo, DHFR (Dihydrofolate Reductase), TYMS (Thy midy late Synthetase), MGMT (0(6)-methylguanine-DNA methyltransferase), multidrug resistance gene (MDR1), ALDHl (Aldehyde dehydrogenase 1 family, member Al), FRANCE, RAD51C (RAD51 Paralog C), GCS (glucosylceramide synthase), NKX2.2 (NK2 Homeobox 2) or any combination thereof
  • the selection gene comprises DHFR.
  • the first transposon and or the second transposon comprises an inducible caspase polypeptide comprising (a) a ligand binding region, (b) a linker, and (c) a truncated caspase 9 polypeptide, wherein the inducible caspase polypeptide does not comprise a non-human sequence.
  • the non-human sequence is a restriction site.
  • the ligand binding region inducible caspase polypeptide comprises a FK506 binding protein 12 (FKBP 12) polypeptide.
  • the amino acid sequence of the FK506 binding protein 12 (FKBP12) polypeptide comprises a modification at position 36 of the sequence.
  • the modification is a substitution of valine (V) for phenylalanine (F) at position 36 (F36V).
  • the FKBP12 polypeptide is encoded by an amino acid sequence comprising
  • the FKBP12 polypeptide is encoded by a nucleic acid sequence comprising
  • the linker region of the inducible proapoptotic polypeptide is encoded by an amino acid comprising GGGGS (SEQ ID NO: 17014). In certain embodiments, the linker region of the inducible proapoptotic polypeptide is encoded by a nucleic acid sequence comprising GGAGGAGGAGGATCC (SEQ ID NO: 17015).
  • the truncated caspase 9 polypeptide of the inducible proapoptotic polypeptide is encoded by an amino acid sequence that does not comprise an arginine (R) at position 87 of the sequence. In certain embodiments, the truncated caspase 9 polypeptide of the inducible proapoptotic polypeptide is encoded by an amino acid sequence that does not comprise an alanine (A) at position 282 the sequence. In certain embodiments, the truncated caspase 9 polypeptide of the inducible proapoptotic polypeptide is encoded by an amino acid comprising
  • the truncated caspase 9 polypeptide of the inducible proapoptotic polypeptide is encoded by a nucleic acid sequence comprising
  • AAAGAAACTGTTCTTTAAGACTTCC (SEQ ID NO: 17017).
  • the inducible proapoptotic polypeptide is encoded by an amino acid sequence comprising
  • the inducible proapoptotic polypeptide is encoded by a nucleic acid sequence comprising
  • the first transposon and/or the second transposon comprises at least one self-cleaving peptide.
  • the at least one self-cleaving peptide comprises a T2A peptide, a GSG-T2A peptide, an E2A peptide, a GSG-E2A peptide, an F2A peptide, a GSG-F2A peptide, a P2A peptide, or a GSG-P2A peptide.
  • the at least one self-cleaving peptide comprises a T2A peptide.
  • theT2A peptide comprises an amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 17020).
  • the GSG-T2A peptide comprises an amino acid sequence comprising
  • the E2.A peptide comprises an amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 17022).
  • the GSG-E2A peptide comprises an amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 17023).
  • the F2A peptide comprises an amino acid sequence comprising VKQTLNFDLLKLAGD VESNPGP (SEQ ID NO: 17024).
  • theGSG- F2A peptide comprises an ammo acid sequence comprising
  • the P2A peptide comprises an amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 17026). In certain embodiments, theGSG-P2A peptide comprises an amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 17027).
  • the at least one self-cleaving peptide is positioned between (a) the selection gene and the inducible transgene construct or (b) the inducible transgene construct and the inducible caspase polypeptide. In certain embodiments, the at least one self-cleaving peptide is positioned between (a) the selection gene and the reporter construct or (b) the reporter construct and the inducible caspase polypeptide.
  • the disclosure provides a cell comprising the composition of the disclosure.
  • the disclosure provides a method of inducing conditional gene expression in a cell comprising (a) contacting the cell with a composition of the disclosure, under conditions suitable to allow for integration of the inducibl e transgene construct into the genome of the cell and for the expression of the exogenous reporter and (b) contacting the exogenous receptor and a ligand that specifically binds thereto, to transduce an intracellular signal that targets the inducible promoter, thereby modifying gene expression.
  • the ceil is in vivo, ex vivo, in vitro or in situ.
  • the cell is an immune cell.
  • the immune cell is a T-cell, a Natural Killer (NK) cell, a Natural Killer (NK)-like cell, a hematopoeitic progenitor ceil a peripheral blood (PB) derived T cell or an umbilical cord blood (UCB) derived T-cell.
  • the immune cell is a T-cell, In certain embodiments, the cell is autologous.
  • the ceil is allogeneic.
  • the disclosure provides a method of treating a disease or disorder in a subject in need thereof, comprising administering to the subject a composition of the disclosure, under conditions suitable to allow for integration of the inducible transgene construct into the genome of the cell and for the expression of the exogenous reporter, and administering a ligand to which the exogenous receptor selectively binds, wherein the binding of the ligand to the exogenous receptor transduces an intracellular signal to target the inducible promoter co trolling the transgene, wherein the transgene is expressed, and wherein the product of the transgene is therapeutically -effective for treating the disease or disorder.
  • the product of the transgene is a secreted protei
  • the secreted protein is a clotting factor.
  • the clotting factor is factor IX.
  • the disease or disorder is a clotting disorder.
  • conditions suitable to allow for integration of the inducible transgene construct into the genome of the cell and for the expression of the exogenous reporter comprise in vivo conditions.
  • conditions suitable to allow for integration of the inducible iransgene construct into the genome of the cell and for the expression of the exogenous reporter comprise a temperature substantially similar to an internal temperature of a human body, a CO2 level substantially similar to an internal CO2 levels of a human body, an O2 level substantially similar to an internal O2 levels of a human body, an aqueous or saline environment with a level of electrolytes substantially similar to a level of electrolytes of an interior of a human body.
  • the ligand to which the exogenous receptor specifically binds is non-naturally occurring.
  • the hgand is a nucleic acid, an ammo acid, a polymer, an organic small molecule, an inorganic small molecule, or a combination thereof.
  • Exemplary ligands include, but are not limited to, synthetic, modified, recombinant, mutant, chimeric, endogenous or non-naturally occurring, proteins (soluble or membrane-bound), steroid hormones, gas particles, nucleic acids, growth factors, neurotransmitters, vitamins, and minerals.
  • composition comprising (a) an inducible transgene construct, comprising a sequence encoding an inducible promoter and a sequence encoding a transgene, and (b) a ligand construct, comprising a sequence encoding a constitutive promoter and a sequence encoding an exogenous ligand, wherein, upon integration of the construct of (a) and the construct of (b) into a genomic sequence of a cell, the exogenous ligand is expressed, and wherein the exogenous ligand, upon binding a receptor, transduces an intracellular signal that targets the inducible promoter of (a) to modify gene expression.
  • the ligand comprises a non-natural or synethetic sequence.
  • the ligand comprises a fusion protein. In certain embodiments, the ligand is bound to the surface of the cell. In certain embodiments, the ligand comprises an intracellular domain. In certain embodiments, the intracellular domain transduces a signal in the cell expressing the ligand. In certain embodiments, the staicture of the ligand is substantially similar to the structure of the receptor of the compositions of the disclosure, in certain embodiments, the signal transduced by the ligand and the signal transduced by the receptor comprise a bi-directional signal.
  • FIG. 1 A-B is a pair of schematic diagrams depicting NF-KB inducible vectors for expression in T-cells.
  • Two T cell activation NF-KB inducible vectors were developed; one with the gene expression system (GES) in the forward orientation (A) and the other in the complementary direction (B), both preceding the constitutive EF I a promoter.
  • These vectors also direct expression of a CAR molecule and a DHFR selection gene, separated by a T2A sequence.
  • Both the conditional NF-KB inducible system and the EF l a directed genes are a part of a piggy Bac transposon which can be permanently integrated into T cells using electroporation (EP).
  • E electroporation
  • FIG. 2 is a pair of graphs depicting NF-KB inducible expression of GFP in activated T cells.
  • T cells were nucleofected with a piggyBac vector expressing an anti- BCMA CAR and a DHFR mutein gene under control of an EFla promoter along with the absence (No GES control) or presence of an NF -KB inducible expression system driving GFP expression in either the forward (pNFKB-GFP forward) or reverse orientation (pNFKB- GFP reverse).
  • Cells were cultured in the presence of methotrexate selection until the cells were almost completely resting (Day 19) and GFP expression was assessed at Day 5 and Day 19.
  • FIG. 3 is a series of graphs depicting anti-BCMA CAR-mediated activation of NFKB inducible expression of GFP in presence of BCMA+ tumor cells.
  • T cells were either unmodified (Mock T ceils) or nucleofected with a piggyBac vector expressing an anti-BCMA CAR and a DHFR mutein gene under control of an EFla promoter along with the absence (No GES control) or presence of an NF-KB inducible expression system driving GFP expression in either the forward (pNFKB-GFP forward) or reverse orientation (pNFKB-GFP reverse). All cells were cultured for 22 da s, either with or without methotrexate selection (Mock T ceils), until the cells were almost completely resting.
  • Figure 4 is a series of graphs demonstrating that the Expression lev el of inducible gene can be regulated by number of response elements preceding the promoter T cells w ere nucleofected with a piggyBac vector encoding an anti-BCMA CARTynn followed by a selection gene, both under control of a human EF 1 a promoter. Further, vectors either additionally encoded the conditional NF-KB inducible gene expression system driving expression of a truncated CD !
  • FIG. 5 is a schematic diagram showing the human coagulation pathway leading to blood clotting.
  • Contact activation for example by damaging an endothelium, activates an intrinsic clotting pathway.
  • Tissue factors activate an extrinsic clotting pathway, for example following trauma. Both pathwa s converge onto the conversion of Prothrombin into
  • Thrombin which catalyzes the conversion of fibrinogen into fibrin. Polymerized fibrin together with platelets forms a clot. In the absence of Factor IX (circled), clotting is defective. Factor VIll (FVIII) deficiency leads to development of Hemophilia A. Factor IX (FIX) deficiency leads to development of Hemophilia B.
  • the standard treatment for hemophilia B involved an infusion of recombinant FIX every 2 to 3 days, at a expense of approximately $250,000 per year. In sharp contrast to this standard treatment option, T cells of the disclosure are maintained in humans for several decades.
  • FIG. 6 is a seri es of Fluorescence- Activated Cell Sorting (FACS plots) depicting FlX-secreting T cells.
  • T cells encoding a human Factor IX transgene showed a T-cell phenotype in approximately 80% of cells.
  • the 6 panels are described in order from left to right.
  • FSC Fluorescence- Activated Cell Sorting
  • SSC side scatter
  • the x- axis is from 0 to 250 thousand (abbreviated k) in increments of 50k
  • the y-axis is for 0 to 250k, in increments of 50k.
  • the x-axis is labeled from 0 to 250k in increments of 50k.
  • the y-axis reads, from lop to bottom, -10 3 , 0, 10 3 , 10 4 , 10 s .
  • (3) On the x-axis is shown anti-CD56- APC conjugated to a Cy7 dye (CDC56-APC ⁇ Cy7), units from 0 to 10 s incrementing in powers of 10.
  • On the y-axis is shown anti-CD3 conjugated to phycoerythrin (PE), units from 0 to 10 5 incrementing in powers of 10.
  • anti-CD8 conjugated to fluorescein isoihiocyanate FITC
  • anti-CD4 conjugated to Brilliant Violet 650 dye BV650
  • anti CD62L antibody conjugated to a Brilliant Violet 421 dye BV421
  • anti-CD45RA antibody conjugated to PE and Cy7 units from 0 to ICr incrementing in powers of 10. This panel is boxed.
  • Figure 7 A is a graph showing human Factor IX secretion during production of modified T cells of the disclosure. On the y-axis. Factor IX concentration in nanograms (ng) per milliliter (mL) from 0 to 80 in increments of 20. On the x-axis are shown 9 day and 12 day T cells.
  • Figure 7B is a graph showing the clotting activity of the secreted Factor IX produced by the T cells. On the y-axis is shown percent Factor IX activity relative to human plasma, from 0 to 8 in increments of 2. On the x-axis are 9 and 12 day T cells.
  • Figure 8 is a series of graphs demonstrating that the expression level of inducible gene can be regulated by number of response elements preceding the promoter in CD4 positive cells.
  • Truncated CD19 (dCD19) expressing CAR-T cells were stimulated by BCMA+ H929 multiple myeloma cells at 2: 1 CAR-T: H929 ratio.
  • the expression of dCD19 was dri ven by the minimal promoter that enhanced by 0, 1, 2, 3, 4 or 5 repeats of the NF-kB response element.
  • the expression of BCMA CAR was driven by human elongation factor- 1 a (EF-la) promoter, a constitutive promoter that is commonly used for gene expression in human T cells.
  • EF-la human elongation factor- 1 a
  • CAR and dCD19 were both at basal levels compared to mock T cell control.
  • the expression levels of CAR and dCDI 9 were both upregulated upon tumor stimulation (day 3) and then subsequently downregulated (day 9, 14) and eventually reached their respective basal levels when the cells resume a fully rested status again (day 20).
  • CAR surface expression was equivalently up- or down-regulated in all the CAR-T cell samples during cell activation and resting process, while the expression levels of dCD19 were directly proportional to the number of NF-KB response elements (day 3, 9, 14).
  • Data are shown as FACS histograms and MFI of target protein staining.
  • surface dCD19 expression was directly proportional with the number of REs encoded in the GES. No dCD19 was detected on the surface of T cells that did not harbor the GES: No GES and Mock controls.
  • Figure 9 is a series of graphs demonstrating that the expression level of inducible gene can be regulated by number of response elements preceding the promoter in CDS positive cells.
  • Truncated CD19 (dCD19) expressing CAR-T cells were stimulated by BCMA+ H929 multiple myeloma cells at 2: 1 CAR-T: FI929 ratio.
  • the expression of dCDl 9 was driven by the minimal promoter that enhanced by 0, i , 2, 3, 4 or 5 repeats of the NF-kB response element.
  • the expression of BCMA CAR was driven by human elongation factor- 1 a (EF-1 a) promoter, a constitutive promoter that is commonly used for gene expression in human T cells.
  • EF-1 a human elongation factor- 1 a
  • CAR and dCD19 were both at basal levels compared to mock T cell control.
  • the expression levels of CAR and dCD19 were both upregulated upon tumor stimulation (day 3) and then subsequently downregulated (day 9, 14) and eventually reached their respective basal levels when the cells resume a fully rested status again (day 20).
  • CAR surface expression was equivalent! ⁇ ' up- or down-regulated in all the CAR-T cell samples during cell activation and resting process, while the expression levels of dCD!9 were directly proportional to the number of NF-KB response elements (day 3, 9, 14).
  • Data are shown as FACS histograms and MFI of target protein staining.
  • surface dCD19 expression was directly proportional with the number of REs encoded in the GES. No dCD19 was detected on the surface of T cells that did not harbor the GES: No GES and Mock controls.
  • Figure 10 is a bar graph depicting the knock out efficiency of targeting various checkpoint signaling proteins that could be used to armor T-cells.
  • Cas-CLOVER was used to knockout the checkpoint receptors, PD-1 , TGFBR2, LAG-3, TIM-3 and CTLA-4 in resting primary human pan T cells. Percent knock-out is shown on the y-axis. Gene editing resulted in 30-70% loss of protein expression at the ceil surface as measured by flow cytometry.
  • Figure 1 1 is a series of schematic diagrams of wildtype, null and switch receptors and their effects on intracellular signaling, either inhibitory or stimulatory, in primary T-cells. Binding of the wildtype inhibitory receptor expressed endogenously on a T-cell with its endogenous ligand results in transmission of an inhibitory signal which, in part, reduces T- cell effector function. However, mutation (Mutated null) or deletion (Truncated null) of the intracellular domain (ICD) of a checkpoint receptor protein, such as PD1 (top panel) or TGFBRII (bottom panel), reduces or eliminates its signaling capability when cognate ligand(s) is bound.
  • a checkpoint receptor protein such as PD1 (top panel) or TGFBRII (bottom panel
  • any binding by a mutated or null receptor sequesters the endogenous ligand(s) from binding the wiidtype receptor and results in dilution of the overall level of checkpoint signaling effectively delivered to the modified T-cell, thereby reducing or blocking checkpoint inhibition and functional exhaustion of the modified T cells.
  • a switch receptor is created by replacement of the wiidtype ICD with an ICD from either a co-stimulatory molecule (such as ( ' 01/ ( 1)2! ⁇ ! 4-1BB) or a different inhibitory moiecuie (such as CTLA4, PD1 , Lag3).
  • a co-stimulatory molecule such as ( ' 01/ ( 1)2! ⁇ ! 4-1BB) or a different inhibitory moiecuie (such as CTLA4, PD1 , Lag3).
  • a co-stimulatory molecule such as ( ' 01/ ( 1)2! ⁇ ! 4-1BB) or a different inhibitory moiecuie (such as CTLA4, PD1 , Lag3).
  • the signal peptide (purple arrow), extracellular domain (ECD) (bright green), transmembrane domain (yellow), intracellular signaling domain (ICD)(orange), and replacement ICD (green) are displayed in the receptor diagrams.
  • ECD extracellular domain
  • ICD intracellular signaling domain
  • replacement ICD green
  • Figure 12 is a schematic diagram showing an example of the design of null receptors with specific alterations that may help to increase expression of the receptor on the surface of modified T cells. Examples are shown for PD1 and TGFBRII null receptors and the signal peptide domain (SP), transmembrane domain (TM) and extracellular domain (ECD) of truncated null receptors for PD1 (top panel) and TGFBRII (bottom panel) are displayed. The first of the top four molecules is the wiidtype PD-1 receptor, which encodes the wiidtype PD- 1 SP and TM.
  • SP signal peptide domain
  • TM transmembrane domain
  • ECD extracellular domain
  • Figure 13 is a series of histograms depicting the expression of the PDi and TGFBRII null Receptors on the surface of modified primary human T cells as determined by flow cytometry. Each of the six truncated null constructs from Figure 12 were expressed on the surface of primary human T cells. T cells were stained with either anti-PDl (top; blue histograms) or anti-TGFpRII (bottom; blue histograms), or isoiype control or secondary only (gray histograms). Cells staining positive for PD-1 or ⁇ ⁇ expression were gated (frequency shown above gate) and mean fluorescence intensity (MFI) value is displayed above each positive histogram.
  • MFI mean fluorescence intensity
  • null receptor constructs The names of the null receptor constructs are depicted above each plot. Both null receptor gene strategies, replacement of the wildtype SP with the alternative CD8a were successfully expressed. 02.8aSP-PD-I and 02.8aSP-TGFpRII resulted in the highest level of expression at the T-cell surface. 02.8aSP-PD-l null receptor exhibited an MFI of 43,680, which is 177-fold higher than endogenous T cell PD-1 expression and 2.8- fold higher than the wildtype PD-1 null receptor.
  • 02.8aSP-TGFpRII null receptor exhibited an MFI of 13,809, which is 102-fold higher than endogenous T cell TGFf3RII expression and 1.8-fold higher than the wildtype ⁇ null receptor.
  • Replacement of wildtype SP with the alternative CD8a SP for both PDI and TGRBR11 results in enhanced surface expression of the null or Switch receptor, which may help to maximize reduction or blockage of checkpoint inhibition upon binding and sequestration of the endogenous ligand(s).
  • Figure 14 is a schematic depiction of the Csy4-T2A-Clo051 -G4Slinker-dCas9 construct map (Embodiment 2).
  • Figure 15 is a schematic depiction of the pRTl-C3o051 -dCas9 Double NLS construct map (Embodiment 1 ).
  • Figure 16 is a pair of graphs comparing the efficacy of knocking out expression of either B2M on the surface of Pan T-celis (left) or the a-chain of the T-cell Receptor on the surface of Jurkat cells (right) for either Embodiment 1 (pRTl -Clo051 -dCas9 Double NLS, as shown in Figure 15) or Embodiment 2 (Csy4-T2A-Clo051-G4SHnker-dCas9, as shown in Figure 14) of a Cas-Clover fusion protein of the disclosure.
  • the fusion protein is provided at either 10 ug or 20 , as indicated.
  • Figure 17 is a photograph of a gel electrophoresis analysis of mR A encoding each of Embodiment 1 (Lane 2; pRTl-Clo05.1 -dCas9 Double NLS, as shown in Figure 15) or Embodiment 2 (Lane 3; Cs 4-T2A-Clo051 -G4Slinker-dCas9, as shown in Figure 14).
  • a previous preparation (“old version") of mRNA encoding Embodiment 2 is included (Lane 4) for comparison.
  • ail mRNA samples encoding the two different embodiments migrate as distinct bands within the gel, are of high quality, and are similar in size, as expected.
  • composition comprising (a) an inducible transgene construct, comprising a sequence encoding an inducible promoter and a sequence encoding a transgene, and (b) a receptor construct, comprising a sequence encoding a constitutive promoter and a. sequence encoding an exogenous receptor, wherein, upon integration of the construct of (a) and the construct of (b) into a genomic sequence of a cell, the exogenous reporter is expressed, and wherein the exogenous reporter, upon binding a ligand, transduces an intracellular signal that targets the inducible promoter of (a) to modify gene expression.
  • exogenous Receptors comprising a sequence encoding an inducible promoter and a sequence encoding a transgene
  • a receptor construct comprising a sequence encoding a constitutive promoter and a. sequence encoding an exogenous receptor, wherein, upon integration of the construct of (a) and the construct of (b) into a genomic sequence of a cell
  • Exogenous receptors of the disclosure may comprise a non-naturally occurring receptor.
  • the non-naturally occurring receptor is a synthetic, modified, recombinant, mutant or chimeric receptor.
  • the non-naturally occurring receptor comprises one or more sequences isolated or deri ved from a T- cell receptor (TCR).
  • TCR T- cell receptor
  • the non-naturally occurring receptor comprises one or more sequences isolated or derived from a scaffold protein.
  • the non-naturally occurring receptor comprises a transmembrane domain.
  • the non-naturally occurring receptor interacts with an intracellular receptor that transduces an intracellular signal.
  • the non-naturally occurring receptor comprises an intracellular signaling domain.
  • the non- naturally occurring receptor is a chimeric ligand receptor (CLR).
  • the CLR is a chimeric antigen receptor.
  • the exogenous receptor of (b) comprises a non-naturally occurring receptor.
  • the CLR is a chimeric antigen receptor, in certain embodiments, the chimeric ligand receptor comprises (a) an ectodomain comprising a ligand recognition region, wherein the ligand recognition region comprises at least scaffold protein; (b) a transmembrane domain, and (c) an endodomain comprising at least one costimulator domain.
  • the disclosure provides chimeric receptors comprising at least one Centyrin.
  • Chimeric ligand/antigen receptors (CLRs/CARs) of the disclosure may comprise more than one Centyrin, referred to herein as a CARTyrin.
  • the disclosure provides chimeric receptors comprising at least one VHH.
  • Chimeric ligand/antigen receptors (CLRs/CARs) of the disclosure may comprise more than one VHH, referred to herein as a VCAR.
  • Chimeric receptors of the disclosure may comprise a signal peptide of human CD2, CD35, CD3e, CD3v, CD3 CD4, CD8 , CD 19, CD28, 4-lBBor GM-CSFR.
  • a hinge/spacer domain of the disclosure may comprise a hinge/spacer/ stalk of human CD8a, IgG4, and/or CD4.
  • An intracellular domain or endodomain of the disclosure may comprise an intracellular signaling domain of human ⁇ 3 ⁇ and may further comprise human 4-1 BB, CD28, CD40, ICOS, MyD88, OX-40 intracellular segment, or any combination thereof.
  • transmembrane domains include, but are not limited to a human CD2, CD35, CD3e, CD3y, CD3C, CD4, CD80L CD 1 9, CD28, 4-l BBor GM-CSFR transmembrane domain.
  • the disclosure provides genetically modified cells, such as T cells, NK cells, hematopoietic progenitor cells, peripheral blood (PB) derived T cells (including T cells from G-CSF-mobilized peripheral blood), umbilical cord blood (UCB) derived T cells rendered specific for one or more ligands or antigens by introducing to these cells a CLR/CAR, CARTyrin and/or V CAR of the disclosure.
  • PB peripheral blood
  • URB umbilical cord blood
  • Cells of the disclosure may be modifi ed by electrotransfer of a transposon of the disclosure and a plasmid or a nanoplasmid comprising a sequence encoding a transposase of the disclosure (preferably, the sequence encoding a transposase of the disclosure is an mRNA sequence).
  • the armored T-cell comprises a composition comprising (a) an inducible transgene construct, comprising a sequence encoding an inducible promoter and a sequence encoding a transgene, and (b) a receptor construct, comprising a sequence encodmg a constitutive promoter and a sequence encodmg an exogenous receptor, such as a CLR or CAR, wherein, upon integration of the construct of (a) and the construct of (b) mto a genomic sequence of a cell, the exogenous receptor is expressed, and wherein the exogenous receptor, upon binding a ligand or antigen, transduces an intracellular signal that targets directly or indirectly the inducible promoter regulating expression of the inducible transgene (a) to modify gene expression.
  • Chimeric Receptors comprising (a) an inducible transgene construct, comprising a sequence encoding an inducible promoter and a sequence encoding a transgene
  • a receptor construct
  • Chimeric antigen receptors (CARs) and/or chimeric ligand receptors (CLRs) of the disclosure may comprise (a) an ectodomain comprising an antigen/1 igand recognition region, (b) a transmembrane domain, and (c) an endodomain comprising at least one costimulatory domain.
  • the ectodomain may further comprise a signal peptide.
  • the ectodomain may further comprise a hinge between the antigen/1 igand recognition regi on and the transmembrane domain.
  • the signal peptide may comprise a sequence encoding a human CD2, CD38, CD3e, CD3y, €03 ⁇ , CD4, CD8a, CD 19, CD28, 4- 1BB or GM-CSFR signal peptide.
  • the signal peptide may comprise a sequence encoding a human CD8a signal peptide.
  • the transmembrane domain may comprise a sequence encoding a human CD2, CD38, CD.3 ⁇ 4, CD3y, CD3 CD4, CD8a, CD 19, CD28, 4- IBB or GM-CSFR transmembrane domain.
  • the transmembrane domain may comprise a sequence encoding a human CD8a transmembrane domain.
  • the endodomain may comprise a human CD3 endodomain,
  • the at least one costimulatory domain may comprise a human 4- IBB, CD28, CD40, ICOS, M D88, OX-40 intracellular segment, or any combination thereof.
  • the at least one costimulatory domain may comprise a CD28 and/or a 4- IBB costimulatory domain.
  • the hinge may comprise a sequence derived from a human CD8a, IgG4, and or CD4 sequence.
  • the hinge may comprise a sequence derived from a human CD8a sequence.
  • the CD28 costimulatory domain may comprise an amino acid sequence comprising RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQ EGLYNELQKD AEAY SElGMKGERRJflGKGHDGLY QGLSTATI DTYDALHMQALP
  • PR SEQ ID NO: 17004 or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising
  • the CD28 costimulatory domain may be encoded by the nucleic acid sequence comprising
  • the 4- IBB costimulator domain may comprise an amino acid sequence comprising KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 17006) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising
  • the 4-1BB costimulatory domain may be encoded by the nucleic acid sequence comprising aagagaggcaggaagaaactgctgtatattttcaaacagcccttcatgcgccccgtgcagactacccaggaggaagacgggtgctcc tgtcgattccctgaggaagaggaaggcgggtgtgagctg (SEQ ID NO: 17007),
  • the 4- IBB costimulatory domain may be located between the transmembrane domain and the CD28 costimulatory domain.
  • the hinge may comprise a sequence derived from a human CD8a, IgG4, and/or CD4 sequence. In certain embodiments of the CARs/CLRs of the disclosure, the hinge may comprise a sequence derived from a human CD8a sequence.
  • the hinge may comprise a human CD8a amino acid sequence comprising TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 17008) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising
  • Hie human CD8a hinge amino acid sequence may be encoded by the nucleic acid sequence comprising
  • the disclosure provides single chain variable fragment (scFv) compositions and methods for use of these compositions to recognize and bind to a specific target protein.
  • ScFv compositions comprise a heavy chain variable region and a light chain variabl e region of an antibody.
  • ScFv compositions may be incorporated into an antigen/ligand recognition region of a CAR or CLR of the disclosure.
  • An antigen/ligand recognition region of a CAR or CLR of the disclosure may comprise an ScFv or an ScFv composition of the disclosure.
  • ScFvs comprise fusion proteins of the variable regions of the heavy (VH) and light (VL) chains of an immunoglobulin, wherein the VH and VL domains are connected with a linker.
  • ScFvs retain the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of the linker.
  • An exemplary linker comprises a sequence of GGGGSGGGGSGGGGS (SEQ ID NO: 17033).
  • Centyrins of the disclosure specifically bind to an antigen or a ligand of the disclosure.
  • CARs and/or CLRs of the disclosure comprising one or more Centyrins that specifically bind an antigen may be used to direct the specificity of a cell, (e.g. a cytotoxic immune cell) towards a cell expressing the specific antigen.
  • CLRs of the disclosure comprising a Centynn that specifically binds a ligand antigen may transduce a signal intraceulliilarly to induce expression of a sequence under the control of an inducible promoter.
  • Centyrins of the disclosure may comprise a protein scaffold, wherein the scaffold is capable of specifically binding an antigen or a ligand.
  • Centyrins of the disclosure may comprise a protein scaffold comprising a consensus sequence of at least one fibronectin type III (FN3) domain, wherein the scaffold is capable of specifically binding an antigen or a ligand.
  • the at least one fibronectin type III (FN3) domain may be derived from a human protein.
  • Hie human protein may be Tenascin-C.
  • the consensus sequence may comprise LPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTVPGSERSYDL TGLKPGTEYTVSIYGVKGGHRSNPLSAEFTT (SEQ ID NO: 17010) or
  • a Centynn may comprise an ammo sequence having at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% or any percentage in between of identity to the sequence of
  • a Centynn may comprise an ammo sequence having at least 74% identity to the sequence of LPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTVPGSERSYDL
  • the consensus sequence may encoded by a nucleic acid sequence comprising atgctgcctgcaccaaagaacctggiggtgtctcatgtgacagaggatagtgccagactgtcaiggactgctcccgacgcagccltcg atagtttatcatcgtgtaccgggagaacatcgaaaccggcgaggccattgtcctgacagtgccagggtccgaacgcicttatgacctg acagatctgaagcccggaactgagtactatgtgcagatcgccggcgtcaaaggaggcaatatcagcttcctctg ccgcaatcttg c caca CSEQ ID NO: 1 7034).
  • the consensus sequence may be modified at one or more positions within (a) a A-B loop comprising or consisting of the amino acid residues TEDS (SEQ ID NO: 17035) at positions 13- 16 of the consensus sequence; (b) a B-C loop comprising or consisting of the amino acid residues TAPDAAF (SEQ ID NO: 17036) at positions 22-28 of the consensus sequence; (c) a C-D loop comprising or consisting of the amino acid resi dues SEKVGE (SEQ ID NO: 17037) at positions 38-43 of the consensus sequence; (d) a D-E loop comprising or consisting of the amino acid residues GSER (SEQ ID NO: 17038) at positions 51 -54 of the consensus sequence; (e) a E-F loop comprising or consisting of the amino acid residues GLKPG (SEQ ID NO: 17039) at positions 60-64 of the consensus sequence; (f) a F-G loop comprising or consisting of the amino acid residues KGGHR
  • the Centryrin may bind an antigen or a hgand with at least one affinity selected from a D of less than or equal to 10 9 M, less than or equal to 10 I0 M, less than or equal to
  • the KD may be determined by surface plasmon resonance.
  • antibody mimetic is intended to describe an organic compound that specifically binds a target sequence and has a structure distinct from a naturally-occurring antibody.
  • Antibody mimetics may comprise a protein, a nucleic acid, or a small molecule.
  • the target sequence to which an antibody mimetic of the disclosure specifically binds may be an antigen.
  • Antibody mimetics may provide superior properties over antibodies including, but not limited to, superior solubility, tissue penetration, stability towards heat and enzymes (e.g. resistance to enzymatic degradation), and lower production costs.
  • Exemplary antibody mimetics include, but are not limited to, an affibody, an afflilin, an affimer, an affitin, an alphabody, an anticalin, and avimer (also known as avidity multimer), a DARPin (Designed Ankyrin Repeat Protein), a Fynomer, a Kunitz domain peptide, and a monobody.
  • Affibody molecules of the disclosure comprise a protein scaffold comprising or consisting of one or more alpha helix without any disulfide bridges.
  • affibody molecules of the disclosure comprise or consist of three alpha helices.
  • an affibody molecule of the disclosure may comprise an immunoglobulin binding domain.
  • An affibody molecule of the disclosure may comprise the Z domain of protein A.
  • Affilin molecules of the disclosure comprise a protein scaffold produced by modification of exposed amino acids of, for example, either gamma-B crystallin or ubiquitin. Affilin molecules functionally mimic an antibody's affinity to antigen, but do not structurally mimic an antibody. In any protein scaffold used to make an affilin, those amino acids that are accessible to solvent or possible binding partners in a properly -folded protein molecule are considered exposed amino acids. Any one or more of these exposed amino acids may be modified to specifically bind to a target sequence or antigen.
  • Affimer molecules of the disclosure comprise a protein scaffold comprising a highly stable protein engineered to display peptide loops that provide a high affinity binding site for a specific target sequence.
  • Exemplar ⁇ ' affimer molecules of the disclosure comprise a protein scaffold based upon a cy statin protein or tertiary structure thereof.
  • Exemplary affimer molecules of the disclosure may share a common tertiary structure of comprising an alpha- helix lying on top of an anti-parallel beta-sheet.
  • Affitin molecules of the disclosure comprise an artificial protein scaffold, the structure of which may be derived, for example, from a DNA binding protein (e.g. the DNA binding protein Sac7d).
  • Affitins of the disclosure selectively bind a target sequence, which may be the entirety or part of an antigen.
  • Exemplary affitins of the discl osure are manufactured by randomizing one or more amino acid sequences on the binding surface of a DNA binding protein and subjecting the resultant protein to ribosome display and selection.
  • Target sequences of affitins of the disclosure may be found, for example, in the genome or on the surface of a peptide, protein, virus, or bacteria.
  • an affitin molecule may be used as a specific inhibitor of an enzyme.
  • Affitin molecules of the disclosure may include heat-resistant proteins or derivatives thereof.
  • Alphabody molecules of the disclosure may also be referred to as Cell-Penetrating Alphabodies (CPAB).
  • CPAB Cell-Penetrating Alphabodies
  • Alphabody molecules of the disclosure comprise small proteins (typically of less than 10 kDa) that bind to a variety of target sequences (including antigens).
  • Alphabody molecules are capable of reaching and binding to intracellular target sequences.
  • alphabody mol ecules of the disclosure comprise an artificial sequence forming single chain alpha helix (similar to naturally occurring coiled-coil structures).
  • Alphabody molecules of the disclosure may comprise a protein scaffold comprising one or more amino acids that are modified to specifically bind target proteins. Regardless of the binding specificity of the molecule, alphabody molecules of the disclosure maintain correct folding and thermostability.
  • Anticalm molecules of the disclosure comprise artificial proteins that bind to target sequences or sites in either proteins or small molecules.
  • Anticalin molecules of the disclosure may comprise an artificial protein derived from a human lipocalin.
  • Anticalin molecules of the disclosure may be used in place of for example, monoclonal antibodies or fragments thereof.
  • Anticalin molecules may demonstrate superior tissue penetration and thermostability than monoclonal antibodies or fragments thereof.
  • Exemplary anticalin molecules of the disclosure may comprise about 180 amino acids, having a mass of approximately 20 kDa.
  • anticalm molecules of the disclosure comprise a barrel structure comprising antiparallel beta-strands pairwise connected by loops and an attached alpha helix
  • anticalin molecules of the disclosure comprise a barrel structure comprising eight antiparallel beta-strands pairwise connected by loops and an attached alpha helix.
  • Avimer molecules of the disclosure comprise an artificial protein that specifically binds to a target sequence (which may also be an antigen). Avimers of the disclosure may recognize multiple binding sites within the same target or within distinct targets. When an avimer of the disclosure recognize more than one target, the avimer mimics functi on of a bi- specific antibody.
  • the artificial protein avimer may comprise two or more peptide sequences of approximately 30-35 amino acids each. These peptides may be connected via one or more linker peptides. Amino acid sequences of one or more of the peptides of the avimer may be derived from an A domain of a membrane receptor.
  • Avimers have a rigid structure that may optionally comprise disulfide bonds and/or calcium. Avimers of the disclosure may demonstrate greater heat stability compared to an antibody.
  • DARPins Designed Ankyrin Repeat Proteins
  • DARPins of the disclosure comprise genetically -engineered, recombinant, or chimeric proteins having high specificity and high affinity for a target sequence
  • DARPins of the disclosure are derived from ankyrin proteins and, optionally, comprise at least three repeat motifs (also referred to as repetitive structural units) of the ankyrin protein.
  • Ankyrin proteins mediate high-affinity protein-protein interactions.
  • DARPins of the disclosure comprise a large target interaction surface.
  • Fynomers of the disclosure comprise small binding proteins (about 7 kDa derived from the human Fyn SH3 domain and engineered to bind to target sequences and molecules with equal affinity and equal specificity as an antibody.
  • unitz domain peptides of the disclosure comprise a protein scaffol d comprising a Kunitz domain.
  • Kunitz domains comprise an active site for inhibiting protease activity.
  • Kunitz domains of the disclosure comprise a disulfide-rich alpha+beta fold. This structure is exemplified by the bovine pancreatic trypsin inhibitor.
  • Kunitz domain peptides recognize specific protein structures and serve as competitive protease inhibitors.
  • Kunitz domains of the disclosure may comprise Ecallantide (derived from a human lipoprotein- associated coagulation inhibitor (LAO)).
  • LAO human lipoprotein- associated coagulation inhibitor
  • Monobodies of the disclosure are small proteins (comprising about 94 ammo acids and having a mass of about 10 kDa) comparable in size to a single chain antibody. These genetically engineered proteins specifically bind target sequences including antigens.
  • Monobodies of the disclosure may specifically target one or more distinct proteins or target sequences.
  • monobodies of the disclosure comprise a protein scaffold mimicking the structure of human fibronectin, and more preferably, mimicking the structure of the tenth extracellular type HI domain of fibronectin.
  • the tenth exiraceliular type ⁇ domain of fibronectin, as well as a monobody mimetic thereof, contains seven beta sheets forming a barrel and three exposed loops on each side corresponding to the three complementarity determining regions (CDRs) of an antibody.
  • CDRs complementarity determining regions
  • a monobody lacks any binding site tor metal ions as well as a central disulfide bond.
  • Multispecific monobodies may be optimized by modifying the loops BC and FG.
  • Monobodies of the disclosure may compri se an adnectin.
  • a CAR or a CLR comprises a single domain antibody (SdAb).
  • the SdAb is a VHH.
  • the disclosure provides a CAR or a CLR comprising an antigen or ligand recognition region, respectively, that comprises at least one VHH (to produce a "VCAR” or "VCLR").
  • CARs and CLRs of the disclosure may comprise more than one VHH.
  • a bi-specific VCAR or VCLR may comprise two VHHs.
  • each VHH specifically binds a distinct antigen.
  • VHH proteins of the disclosure specifically bind an antigen or a ligand.
  • CARs of the disclosure comprising one or more VHHs that specifically bind an antigen may be used to direct the specificity of a cell, (e.g. a cytotoxic immune cell) towards a target cell expressing the specific antigen.
  • CLRs of the disclosure comprising one or more VHHs that specifically bind an antigen may transduce an intracellular signal upon binding a ligand of either VHH to activate expression of a sequence under the control of an inducible promoter,
  • Sequences encoding a VHH of the disclosure can be altered, added and/or deleted to reduce immunogeniciiy or reduce, enhance or modify binding, affinity, on-rate, off-rate, avidity, specificity, half-life, stability, solubility or any other suitable characteristic, as known in the art.
  • VHH proteins can be engineered with retention of high affinity for the antigen or ligand and other favorable biological properties.
  • the VHH proteins can be optionally prepared by a process of analysis of the parental sequences and various conceptual engineered products using three-dimensional models of the parental and engineered sequences. Three-dimensional models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate sequences and can measure possible immunogeniciiy (e.g., Immunofilter program of Xencor, Inc. of Monrovia, Calif.).
  • a CAR or a CLR comprises a single domain antibody (SdAb).
  • the SdAb is a VH.
  • the disclosure provides CARs/CLRs comprising a single domain antibody ( to produce a "VCAR” or a " Y ⁇ I .R " . respectively).
  • the single domain antibody comprises a VH.
  • the VH is isolated or derived from a human sequence.
  • VH comprises a human CDR sequence and/or a human framework sequence and a on-human or humanized sequence (e.g. a rat Fc domain).
  • the VH is a fully humanized VH.
  • the VH s neither a naturally occurring antibody nor a fragment of a naturally occurring antibody.
  • the VH is not a fragment of a monoclonal antibody.
  • the VH is a UniDabTM antibody (TeneoBio).
  • the VH is fully engineered using the UniRatTM (TeneoBio) system and "NGS-based Discovery" to produce the VH.
  • the specific VH are not naturally-occurring and are generated using fully engineered systems.
  • the VH are not derived from naturally -occurring monoclonal antibodies (mAbs) that were either isolated directly from the host (for example, a mouse, rat or human) or directly from a single clone of cells or cell line (hyhridoma). These VHs were not subsequently cloned from said cell lines.
  • VH sequences are fully-engineered using the UniRatTM system as transgenes that comprise human variable regions (VH domains) with a rat Fc domain, and are thus human/rat chimeras without a light chain and are unlike the standard mAb format.
  • the native rat genes are knocked out and ihe only antibodies expressed in the rat are from transgenes with VH domains linked to a Rat Fc (Uni Abs). These are the exclusive Abs expressed in the UniRat.
  • Next generation sequencing (NGS) and bioinformatics are used to identify the full antigen-specific repertoire of the heavy -chain antibodies generated by UniRatTM after immunization.
  • fully humanized VH are generated by fusing the human VH domains with human Fes in vitro (to generate a non-naturally occurring recombinant VH antibody).
  • the VH are fully humanized, but they are expressed in vivo as human rat chimera (human VH, rat Fc) without a light chain.
  • Fully humanized VHs are expressed in vivo as human/rat chimera (human VH, rat Fc) without a light chain are about 80kDa (vs 150 kDa).
  • VCARs/VCLRs of the disclosure may comprise at least one VH of the disclosure.
  • the VH of the disclosure may be modified to remove an Fc domain or a portion thereof.
  • a framework sequence of the VH of the disclosure may be modified to, for example, improve expression, decrease immunogenic! ty or to improve function,
  • transposon/transposase systems of the disclosure include, but are not limited to, piggyBac transposons and transposases. Sleeping Beauty transposons and transposases, Helraiser transposons and transposases and ⁇ 12 transposons and transposases.
  • the piggyBac transposase recognizes transposon-specific inverted terminal repeat sequences (ITRs) on the ends of the transposon, and moves the contents between the ITRs into TTAA chromosomal sites.
  • the piggyBac transposon system has no payload limit for the genes of interest that can be included between the ITRs.
  • the transposase is a piggyBacTM or a Super piggyBacTM (SPB) transposase.
  • the sequence encoding the transposase is an rriRNA sequence.
  • the transposase enzyme is a piggyBacTM (PB) transposase enzyme.
  • PB piggyBac
  • the piggyBac (PB) transposase enzyme may comprise or consist of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:
  • the transposase enzyme is a piggyBacTM (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at one or more of positions 30, 165, 282, or 538 of the sequence:
  • PB piggyBacTM
  • the transposase enzyme is a piggyBacTM (PB) transposase enzyme that comprises or consists of an ammo acid sequence having an amino acid substitution at two or more of positions 30, 165, 282, or 538 of the sequence of SEQ ID NO: 14487.
  • the transposase enzyme is a piggyBacTM (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at three or more of positions 30, 165, 282, or 538 of the sequence of SEQ ID NO: 14487.
  • the transposase enzyme is a piggyBacTM (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at each of the following positions 30, 1 5, 282, and 538 of the sequence of SEQ ID NO: 14487.
  • the amino acid substitution at position 30 of the sequence of SEQ ID NO: 14487 is a substitution of a valine (V) for an isoleucine (I).
  • the amino acid substitution at position 165 of the sequence of SEQ ID NO: 14487 is a substitution of a serine (S) for a glycine (G).
  • the amino acid substitution at position 282 of the sequence of SEQ ID NO: 14487 is a substitution of a valine (V) for a methionine (M).
  • the amino acid substitution at position 538 of the sequence of SEQ ID NO: 14487 is a substitution of a lysine (K) for an asparagine (N).
  • the transposase enzyme is a Super piggyBacTM (SPB) transposase enzyme
  • the Super piggyBacTM (SPB) transposase enzymes of the di sclosure may comprise or consist of the amino acid sequence of the sequence of SEQ ID NO: 14487 wherein the amino acid substitution at position 30 is a substitution of a valine (V) for an isoleucine (I), the amino acid substitution at position 165 is a substitution of a serine (S) for a glycine (G), the amino acid substitution at position 282 is a substitution of a valine (V) for a methionine (M), and the amino acid substitution at position 538 is a substitution of a lysine (K) for an asparagine (N).
  • the Super piggy BacTM (SPB) transposase enzyme may comprise or consist of an amino acid sequence at least 75%, 80%
  • the piggyBacTM or Super piggy BacTM transposase enzyme may further comprise an amino acid substitution at one or more of positions 3, 46, 82, 103, 1 19, 125, 177, 180, 185, 187, 200, 207, 209, 226, 235, 240, 241 , 243, 258, 296, 298, 31 1, 315, 319, 327, 328, 340, 421, 436, 456, 470, 486, 503, 552, 570 and 591 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484.
  • the piggyBacTM or Super piggyBacTM transposase enzyme may further comprise an amino acid substitution at one or more of positions 46, 119, 125, 177, 180, 185, 187, 200, 207, 209, 226, 235, 240, 241 , 243, 296, 298, 31 1 , 315, 319, 327, 328, 340, 421, 436, 456, 470, 485, 503, 552 and 570.
  • the amino acid substitution at position 3 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an asparagine (N) for a serine (S).
  • the amino acid substitution at position 46 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a serine (S) for an alanine (A).
  • the amino acid substitution at position 46 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a threonine (T) for an alanine (A).
  • the amino acid substitution at position 82 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for an isoleucine (I).
  • the amino acid substitution at position 103 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a serine (S).
  • the amino acid substitution at position 1 19 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for an arginine (R).
  • the amino acid substitution at position 125 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) a cysteine (C).
  • the amino acid substitution at position 125 of SEQ) ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a cysteine (C).
  • the amino acid substitution at position 177 of SEQ ID O: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a tyrosine (Y).
  • the amino acid substitution at position 177 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a histidine (H) for a tyrosine (Y).
  • the amino acid substitution at position 180 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a phenylalanine (F).
  • the amino acid substitution at position 180 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a phenylalanine (F).
  • the amino acid substitution at position 180 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a
  • the amino acid substitution at position 185 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a methionine (M).
  • the amino acid substitution at position 187 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a gl cine (G) for an alanine (A).
  • the amino acid substitution at position 200 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for a phenylalanine (F).
  • the amino acid substitution at position 207 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a valine (V).
  • the amino acid substitution at position 209 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a valine (V).
  • the ammo acid substitution at position 226 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a methionine (M).
  • the amino acid substitution at position 235 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an arginine (R) for a leucine (L).
  • the amino acid substitution at position 240 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a valine (V).
  • the amino acid substitution at position 241 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a phenylalanine (F).
  • the amino acid substitution at position 243 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a proline (P).
  • the amino acid substitution at position 258 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a serine (S) for an asparagine (N).
  • the amino acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for a leucine (L). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tyrosine (Y) for a leucine (L). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a leucine (L).
  • the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a methionine (M). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) for a methionine (M). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a methionine (M).
  • the amino acid substitution at position 311 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a proline (P).
  • the amino acid substitution at position 31 1 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine for a proline (P).
  • the ammo acid substitution at position 315 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for an arginine (R).
  • the amino acid substitution at position 3 19 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for a threonine (T).
  • the amino acid substitution at position 327 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an arginine (R) for a tyrosine (Y).
  • the amino acid substitution at position 328 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a tyrosine (Y).
  • the ammo acid substitution at position 340 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for a cysteine (C).
  • the amino acid substitution at position 340 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a cysteine (C).
  • the amino acid substitution at position 421 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a histidine (H) for the aspartic acid (D).
  • the amino acid substitution at position 436 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a valine (V).
  • the amino acid substitution at position 456 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a ty rosine (Y) for a methionine (M).
  • the amino acid substitution at position 470 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a leucine (L).
  • the ammo acid substitution at position 485 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine ( ) for a serine (S).
  • the amino acid substitution at position 503 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (I.) for a methionine (M).
  • the amino acid substitution at position 503 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a methionine (M).
  • the amino acid substitution at position 552 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a valine (V).
  • the amino acid substitution at position 570 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a threonine (T) for an alanine (A).
  • the amino acid substitution at position 591 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a glutamine (Q). In certain embodiments, the amino acid substitution at position 591 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an arginine (R) for a glutamine (Q),
  • the piggyBacTM transposase enzyme may comprise or the Super piggyBacTM transposase enzyme may further comprise an amino acid substitution at one or more of positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484.
  • the piggyBacTM transposase enzyme may comprise or the Super piggyBacTM transposase enzyme may further comprise an amino acid substitution at two, three, four, five, six or more of positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484.
  • the piggyBacTM transposase enzyme may comprise or the Super piggyBacTM transposase enzyme may further comprise an amino acid substitution at positions 103, 194, 372. 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484.
  • the amino acid substitution at position 103 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a serine (S).
  • the amino acid substitution at position 194 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a methionine (M).
  • the amino acid substitution at position 372 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) for an arginine (R).
  • the amino acid substitution at position 375 of SEQ) ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) for a lysine (K).
  • the amino acid substitution at position 450 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an asparagine (N) for an aspartic acid (D).
  • the amino acid substitution at position 509 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a
  • the amino acid substitution at position 570 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitutio of a serine (S) for an asparagine (N).
  • the piggyBacTM transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487.
  • the piggyBacTM transposase enzyme may further comprise an amino acid substitution at positions 372, 375 and 450 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484.
  • the piggyBacTM transposase enzyme may comprise a subsiituiion of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: !
  • the piggyBacTM transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487, a substitution of an alanine (A) for an arginine (R) at position 372 of SEQ ID NO: 14487, a substitution of an alanine (A) for a lysine (&) at position 375 of SEQ ID NO: 14487 and a substitution of an asparagine (N) for an aspartic acid (D) at position 450 of SEQ ID NO: 14487,
  • the sleeping beauty transposon is transposed into the target genome by the Sleeping Beauty transposase that recognizes ITRs, and moves the contents between the ITRs into TA chromosomal sites.
  • SB transposon-mediated gene transfer, or gene transfer using any of a number of similar transposons may be used in the compositions and methods of th e disclosure.
  • the transposase is a Sleeping Beauty transposase or a hyperactive Sleeping Beauty transposase (SBIOOX).
  • the Sleeping Beauty transposase enzyme comprises an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:
  • the hyperactive Sleeping Beauty (SBIOOX) transposase enzyme comprises an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 9 % or any percentage in between identical to:
  • the Helraiser transposon is transposed by the Helitron transposase.
  • Helitron transposases mobilize the Helraiser transposon, an ancient element from the bat genome that was active about 30 to 36 million years ago.
  • An exemplary Helraiser transposon of the disclosure includes Helibatl , which comprises a nucleic acid sequence comprising:
  • the Helitron transposase does not contain an RNase-H 1 catalytic domain, but instead comprises a RepHel motif made up of a replication initiator domain (Rep) and a DNA helicase domain.
  • the Rep domain is a nuclease domain of the HUH superfamily of nucleases.
  • An exemplary Helitron transposase of the di sclosure comprises an ammo aci d sequence comprising:
  • a hairpin close to the 3 ' end of the transposon functions as a terminator.
  • this hairpin can be bypassed by the transposase, resulting in the transduction of flanking sequences.
  • Helraiser transposition generates covendingiy closed circular intermediates.
  • Helitron transpositions can lack target site duplications, in the Helraiser sequence, the transposase is flanked by left and right terminal sequences termed LTS and RTS. These sequences terminate with a conserved 5'-TC/CTAG- 3' motif
  • a 19 bp palindromic sequence with the potential to form the hairpin termination structure is located 11 nucleotides upstream of the RTS and consists of the sequence
  • Tol2 transposons may be isolated or derived from the genome of the medaka fish, and may be similar to transposons of the hAT family.
  • Exemplary To32 transposons of the disclosure are encoded by a sequence comprising about 4.7 kilobases and contain a gene encoding the Tol2 iransposase, which contains four exons.
  • a exemplaiy Tol2 transposase of the disclosure comprises an ammo acid sequence comprising the following:
  • An exemplar ⁇ ' Tol2 transposon of the disclosure including inverted repeats, subterminal sequences and the Tol2 transposase, is encoded by a nucleic acid sequence comprising the following:
  • 354 1 AAGATCCTGA GAT CAT AG CA GCTGCCATCC TTCTCCCTAA ATTTCGGACC TCTTGGACAA
  • Exemplar ⁇ ' transposon/transposase systems of the discl osure include, hut are not limited to, piggyBac and piggy Bac-like transposons and transposases.
  • PiggyBac and piggyBac-like transposases recognizes transposon-specific inverted terminal repeat sequences (ITRs) on the ends of the transposon, and moves the contents between the ITRs into TTAA or TTAT chromosomal sites.
  • ITRs inverted terminal repeat sequences
  • the piggyBac or piggyBac-like transposon system has no pa load limit for the genes of interest mat can be included between the ITRs.
  • the transposase is a piggyBacTM, Super piggyBacTM (SPB) transposase.
  • the sequence encoding the transposase is an mRNA sequence.
  • the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme.
  • the transposase enz e is a piggyBac or a piggyBac-like transposase enzyme.
  • the piggyBac (PB) or piggy Bac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:
  • the transposase enzyme is a piggyBac or piggy Bac-like transposase enzyme that composes or consists of an ammo acid sequence having an amino acid substitution at one or more of positions 30, 165, 282, or 538 of the sequence:
  • the transposase enzy me is a piggyBac or piggyBac-like transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at two or more of positions 30, 165, 282, or 538 of the sequence of SEQ ID NO: 14487
  • the transposase enzyme is a piggy Bac or piggy Bac-like transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at three or more of positions 30, 165, 282, or 538 of the sequence of SEQ ID NO: 14487.
  • the transposase enzyme is a piggyBac or piggy Bac-like transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at each of the following positions 30, 165, 282, and 538 of the sequence of SEQ ID NO: 14487,
  • the amino acid substitution at position 30 of the sequence of SEQ ID NO: 14487 is a substitution of a valine (V) for an isoleucine (T).
  • the amino acid substitution at position 165 of the sequence of SEQ ID NO: 14487 is a substitution of a serine (S) for a glycine (G), In certain embodiments, the amino acid substitution at position 282 of the sequence of SEQ ID NO: 14487 is a substitution of a valine (V) for a methionine (M). In certain embodiments, the amino acid substitution at position 538 of the sequence of SEQ ID NO: 14487 is a substitution of a lysine (K) for an asparagine (N),
  • the transposase enzyme is a Super piggyBacTM (SPB) or piggyBac-like transposase enzyme.
  • the Super piggyBacTM (SPB) or piggy Bac-iike transposase enzyme of the disclosure may comprise or consist of the amino acid sequence of the sequence of SEQ ID NO: 14487 wherein the amino acid substitution at position 30 is a substitution of a valine (V) for an isoleucine (I), the ammo acid substitution at position 165 is a substitution of a serine (S) for a glycine (G), the amino acid substitution at position 282 is a substitution of a valine (V) for a methionine (M), and the amino acid substitution at position 538 is a substitution of a l sine (K) for an asparagine (N).
  • piggy Bac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:
  • the piggy BacTM, Super piggyBacTM or piggyBac-like transposase enzyme may further comprise an amino acid substitution at one or more of positions 3, 46, 82, 103, 119, 125, 177, 180, 185, 187, 200, 207, 209, 226, 235, 240, 241, 243, 258, 296, 298, 311, 315, 319, 327, 328, 340, 421, 436, 456, 470, 486, 503, 552, 570 and 591 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484.
  • the piggyBacTM, Super piggyBacTM or piggyBac-like transposase enzyme may further comprise an amino acid substitution at one or more of positions 46, 119, 125, 177, 180, 185, 187, 200, 207, 209, 226, 235, 240, 241 , 243, 296, 298, 31 1 , 315, 319, 327, 328, 340, 421 , 436, 456, 470, 485, 503, 552 and 570.
  • the ammo acid substitution at position 3 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an asparagine (N) for a serine (S).
  • the amino acid substitution at position 46 of SEQ ID NO: ! 4487 or SEQ ID NO: 14484 is a substitution of a serine (S) for an alanine (A).
  • the amino acid substitution at position 46 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a threonine (T) for an alanine (A).
  • the amino acid substitution at position 82 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for an isoleucine (I), in certain embodiments, the amino acid substitution at position 103 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a serine (S). In certain embodiments, the amino acid substitution at position 119 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for an argimne (R).
  • the amino acid substitution at position 125 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) a cysteine (C).
  • the amino acid substitution at position 125 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a cysteine (C).
  • the amino acid substitution at position 177 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine ( ) for a tyrosine (Y).
  • the amino acid substitution at position 177 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a histidme (H) for a tyrosine (Y).
  • the amino acid substitution at position 1 80 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a phenylalanine (F).
  • the amino acid substitution at position 180 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (T) for a phenylalanine (F).
  • the amino acid substitution at position 180 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a phenylalanine (F).
  • the amino acid substitution at position 185 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a methionine (M).
  • the amino acid substitution at position 187 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for an alanine (A).
  • the amino acid substitution at position 200 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for a phenylalanine (F).
  • the amino acid substitution at position 207 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a valine (V).
  • the amino acid substitution at position 209 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a valine (V).
  • the amino acid substitution at position 226 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a methionine (M).
  • the ammo acid substitution at position 235 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an argimne (R) for a leucine (L).
  • the ammo acid substitution at position 240 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a valine (V).
  • the ammo acid substitution at position 241 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a phenylalanine (F).
  • the amino acid substitution at position 243 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a proline (P).
  • the amino acid substitution at position 258 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a serine (S) for an asparagine (N).
  • the ammo acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tryptophan (W) for a leucine (L).
  • the amino acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tyrosine (Y) for a leucine (L).
  • the ammo acid substitution at position 296 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a phenylalanine (F) for a leucine (L).
  • the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a methionine (M). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) for a methionine (M). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a methionine (M).
  • the amino acid substitution at position 311 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a proline (P), In certain embodiments, the amino acid substitution at position 311 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine for a proline (P). In certain embodiments, the amino acid substitution at position 315 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a
  • the amino acid substitution at position 319 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for a threonine (T).
  • the amino acid substitution at position 327 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an arginine (R) for a tyrosine (Y).
  • the amino acid substitution at position 328 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a tyrosine (Y).
  • the amino acid substitution at position 340 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for a cysteine (C), In certain embodiments, the amino acid substitution at position 340 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a leucine (L) for a cysteine (C). In certain embodiments, the ammo acid substitution at position 421 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a histidine (H) for the aspartic acid (D).
  • the ammo acid substitution at position 436 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a valine (V).
  • the amino acid substitution at position 456 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a tyrosine (Y) for a methionine (M).
  • the amino acid substitution at position 470 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a
  • the amino acid substitution at position 485 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a serine (S).
  • the amino acid substitution at position 503 of SEQ ID NO: 14487 or SEQ ID NO: ! 4484 is a substitution of a leucine (L) for a methionine (M).
  • the ammo acid substitution at position 503 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an isoleucine (I) for a methionine (M).
  • the amino acid substitution at position 552 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a lysine (K) for a valine (V).
  • the amino acid substitution at position 570 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a threonine (T) for an aianine (A).
  • the amino acid substitution at position 591 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a glutamine (Q).
  • the amino acid substitution at position 591 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an arginine (R) for a glutamine (Q).
  • the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538
  • the piggyBacTM or piggy Bae-iike transposase enzyme or may comprise or the Super piggyBacTM transposase enzyme may further comprise an amino acid substitution at one or more of positions 103, 1 4, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484.
  • the piggyBacTM or piggyBac-like transposase enzyme may comprise or the Super piggyBacTM transposase enzyme may further comprise an amino acid substitution at two, three, four, five, six or more of positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484.
  • the piggyBacTM or piggyBac-like transposase enzyme may comprise or the Super piggyBacTM transposase enzyme may further comprise an amino acid substitution at positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484,
  • the amino acid substitution at position 103 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a proline (P) for a serine (S).
  • the amino acid substitution at position 194 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a valine (V) for a methionine (M).
  • the ammo acid substitution at position 372 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an alanine (A) for an arginine (R).
  • the amino acid substitution at position 375 of SEQ ID NO: 14487 or SEQ ID NO; 14484 is a substitution of an alanine (A) for a lysine (K).
  • the ammo acid substitution at position 450 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of an asparagme (N) for an aspartic acid (D).
  • the amino acid substitution at position 509 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a glycine (G) for a serine (S).
  • the amino acid substitution at position 570 of SEQ ID NO: 14487 or SEQ ID NO: 14484 is a substitution of a serine (S) for an asparagine (N).
  • the piggy BacTM or piggyBac-like transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487, in certain embodiments, including those embodiments wherein the piggy BacTM or piggyBac-like transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487, the piggy BacTM or piggyBac-like transposase enzyme may further comprise an amino acid substitution at positions 372, 375 and 450 of the sequence of SEQ ID NO: 14487 or SEQ ID NO: 14484.
  • the piggyBaeTM or piggyBac-like transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487, a substitution of an alanine (A) for an arginine (R) at position 372 of SEQ ID NO: 14487, and a substitution of an alanine (A) for a lysine (K) at position 375 of SEQ ID NO: 14487.
  • the piggyBaeTM or piggyBac- like transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 14487, a substitution of an alanine (A) for an arginine (R) at position 372 of SEQ ID NO: 14487, a substitution of an alanine (A) for a lysine (K) at position 375 of SEQ ID NO: 14487 and a substitution of an asparagme (N) for an aspartic acid (D) at position 450 of SEQ ID NO: 14487.
  • the piggyBae or piggyBac-like transposase enzyme is isolated or derived from an insect.
  • the insect is Trichoplusia ni (GenBank Accession No. AAA87375; SEQ ID NO: 17083), Argyrogramma agnaia
  • XP_001948139 SEQ ID NO: 17091), ⁇ rafts ipsilon (GenBank Accession No. GU477714; SEQ ID NO: 17092, SEQ ID NO: 17093), Bombyx rnori (GenBank Accession No. BAD11135; SEQ ID NO: 1 7094), Chilo suppressalis (GenBank Accession No. JX294476; SEQ ID NO: 17095, SEQ ID NO: 17096), Drosophila melanogaster (GenBank Accession No, AAL39784; SEQ ID NO: 17097), Hehcoverpa armigera (GenBank Accession No.
  • the piggyBac or piggyBac-like transposase enzyme is isolated or derived from an insect, in certain embodiments, the insect is Tnchoplusia ni (AAA87375),
  • the piggyBac or piggyBac-like transposase enzyme is isolated or derived from an insect.
  • the insect is Bombyx mori (BAD 11 135).
  • the piggyBac or piggyBac-like transposase enzyme is isolated or derived from a cmstaceaii.
  • the crustacean is Daphnia memeic na (AAM76342, SEQ ID NO: 17105).
  • the piggyBac or piggyBac-like transposase enzyme is isolated or derived from a vertebrate.
  • the vertebrate is Xenopus tropicahs (GenBank Accession No. BAF82026; SEQ ID NO: 17106), Homo sapiens (GenBank Accession No. NP_689808; SEQ ID NO: i 7 ! 07), Mus mus cuius (GenBank Accession No. NP_741958; SEQ ID NO: 17108), Macaca fasciadaris (GenBank Accession No. AB179012; SEQ ID NO: 17108, SEQ ID NO: 17109), Rattus norvegicus (GenBank Accession No. XP 220453: SEQ ID NO: 171 10) or Myoiis lucifugus.
  • the piggyBac or piggyBac-like transposase enzyme is isolated or derived from a urochordate.
  • the urochordate is Ciona intestinalis (GenBank Accession No. XP_ 002123602; SEQ ID NO: 17111).
  • the piggyBac or piggyBac-like transposase inserts a transposon at the sequence 5'- ⁇ -3' within a chromosomal site (a TTAT target sequence).
  • the piggyBac or piggyBac-like transposase inserts a transposon at the sequence 5'-TTAA-3' within a chromosomal site (a TTAA target sequence).
  • the target sequence of the piggyBac or piggyBac-like transposon comprises or consists of 5'-CTAA-3 ⁇ 5'-TTAG-3', 5'-ATAA-3 ⁇ 5'-TCAA-3 ⁇ 5'AGTT-3', 5'- ⁇ -3', 5'-GTTA-3', 5'-TTGA-3', 5'-TTTA-3', 5'-TTAC-3', 5'-ACTA- 3', 5'-AGGG-3 ⁇ 5'-CTAG-3', 5'-TGAA-3', 5'-AGGT-3', 5'-ATCA-3', 5'-CTCC-3', 5'- TAAA-3', 5'-TCTC-3', 5 GAA-3', 5'-AAAT ⁇ 3', 5 '-AATC-3 " , 5'-ACAA-3', 5'-ACAT-3', 5'-ACTC-3', 5'-AGTG-3', 5 * -ATAG-3', 5 * -CAAA
  • the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme.
  • the piggyBac or piggy Bac-like transposase enzyme is isolated or deri ved from Romhyx mori.
  • the piggyBac or piggy Bac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:
  • the piggyBac (PB) or piggy Bac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%. 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:
  • the piggyBac or piggyBac-like transposase is fused to a nuclear localization signal.
  • the amino acid sequence of the piggyBac or piggyBac-like transposase fused to a nuclear localization signal is encoded by a polynucleotide sequence comprising: 1 atggcaccca aaaagaaacg taaagcgatg gacattgaaa.
  • agegggecag cgcttcgaga 01 c.aagtgtcag gtcca tcta cacttcgaag gacggcacta agtggtacaa gaattgccag 61 cgacctaacg tcagactccg ctccgagaat atcgtgaccg aacagqetea ggt caagaat
  • the piggy Bac or pigg Bac-like transposase is hyperactive.
  • a hyperactive piggyBac or piggyBac-like transposase is a transposase that is more active than the naturally occurring variant from which it is derived.
  • the hyperactive piggyBac or piggyBac-ltke transposase enzyme is isolated or derived from Bombyx mori.
  • the piggyBac or piggy Bac-like transposase is a hyperactive variant of SEQ ID NO: 14505.
  • the hyperactive piggyBac or piggy Bac-like transposase comprises a sequence that is at least 90% identical to: i MDIERQEERI RAMLEEELSD YSDESSSEDE TDHCSEHEVN YDTEEERIDS VDVPSNSROE
  • the hyperactive piggyBac or piggyBac-like transposase comprises SEQ ID NO; 14576. In certain embodiments, the hyperactive piggyBac or piggy Bac-like transposase comprises a sequence of:
  • the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:
  • the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:
  • the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:
  • the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:
  • the hyperactive piggyBac or piggyBac-like transposase is more active than the transposase of SEQ ID NO: 14505. In certain embodiments, the hyperactive piggyBac or piggyBac-like transposase is at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% or any percentage in between identical to SEQ ID NO: 14505.
  • the hyperactive piggyBac or piggyBac-like transposase comprises an amino acid substitution at a position selected from 92, 93, 96, 97, 165, 178, 189, 196, 200, 201 , 21 i . 215, 235, 238, 246, 253, 258, 261 , 263, 27L 303, 321, 324, 330, 373, 389, 399, 402, 403, 404, 448, 473, 484, 507,5 23, 527, 528, 543, 549, 550, 557,6 01, 605, 607, 609, 610 or a combination thereof (relative to SEQ ID NO: 14505).
  • the hyperactive piggyBac or piggyBac-like transposase comprises an ammo acid substitution of Q92A, V93L, V93M, P96G, F97H, F97C, H165E, H165W, E178S, E178H, C189P, A196G, L200I, A201 Q, L211A, W215Y, G219S, Q235Y, Q235G, Q238L, 246I, K253V, M258V, F26IL, S263 , C271 S, N303R, F321W, F321D, V324 , V324H, A330V, L373C, L373V, V389L, S399N, R402K, T403L, D404Q, D404S, D404M, N441R, G448W, E449A, V469T, C473Q, R484K T507C, G523A, I
  • the hyperactive piggyBac or piggyBac-like transposase comprises an amino acid substitution of Q92A, V93L, V93M, P96G, F97H, F97C, H165E, H165W, E178S, E178H, C189P, A196G, 1.2001.
  • the hyperactive piggyBac or piggyBac-like transposase comprises one or more substitutions of an amino acid that is not wild type, wherein the one or more substitutions a for wild type amino acid comprises a substitution of E4X, A12X, M13X,L14X, E15X, D20X, E24X, S25X, S26X, S27X, D32X, H33X, E36X, E44X, E45X, E46X, I48X, D49X, R58X, A62X, N63X, A64X, I65X, I66X, N68X, E69X, D71 X, S72X, D76X, P79X, R84X, Q85X, ⁇ 7. ⁇ .
  • the piggyBac or piggyBac-like transposase is integration deficient
  • an integration deficient piggyBac or piggyBac-like transposase is a transposase that can excise its corresponding transposon, but that integrates the excised transposon at a lower frequency than a corresponding wild type transposase.
  • the piggyBac or piggyBac-like transposase is an integration deficient variant of SEQ ID NO: 14505,
  • the excision competent, integration deficient piggyBac or piggyBac-like transposase comprises one or more substitutions of an amino acid that is not wild type, wherein the one or more substitutions a for wild type amino acid comprises a substitution of R9X, A12X, M13X, D20X, Y21K, D23X, E24X, S25X, S26X, S27X, E28X, E30X, D32X, H33X, E36X, H37X, A39X, Y41X, D42X, T43X, E44X, E45X, E46X, R47X, D49X, S50X, S55X, A62X, N63X, A64X, I66X, A67X, N68X, E69X, D70X, D71X, S72X, D73X, P74X, D75X, D76X, D77XJ78X, S81 X,V83X, R84
  • the integration deficient pigg Bac or piggyBac-like transposase comprises a sequence of:
  • the integration deficient piggyBac or piggyBac-iike transposase comprises a sequence of:
  • the piggyBac or piggyBac -like transposase that is is integration deficient comprises a sequence of:
  • the integration deficient transposase comprises a sequence that is at least 90% identical to SEQ ID NO: 14608.
  • the piggyBac or piggyBac-like transposon is isolated or derived from Bombyx mori.
  • the piggyBac or piggyBac -like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBacTM (PB) or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a left sequence corresponding to SEQ ID NO: 14506 and a right sequence corresponding to SEQ ID NO: 14507.
  • one piggyBac or piggyBac-like transposon end is at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identical or any percentage in between identical to SEQ ID NO: 14506 and the other piggyBac or piggyBac-like transposon end is at least 85%, at least 90%, at least 95%, at least 98%. at least 99% or any percentage in between identical to SEQ ID NO: 14507.
  • the piggyBac or piggyBac- like transposon comprises SEQ ID NO: 14506 and SEQ ID NO: 14507 or SEQ ID NO: 14509
  • the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14508 and SEQ ID NO: 14507 or SEQ ID NO: 14509.
  • the left and right transposon ends share a 16 bp repeat sequence at their ends of C C C GGC GAGC ATGAGG (SEQ ID NO: 14510) immediately adjacent to the 5'-TTAT-3 target insertion site, which is inverted in the orientation in the two ends.
  • left transposon end begins with a sequence comprising 5'- TTATCCC GGC GAGC ATGAGG-3 (SEQ ID NO: 14511), and the right transposon ends with a sequence comprising the reverse complement of this sequence: 5'- CCTCATGCTCGCCGGGTTAT-3' (SEQ ID NO: 14512).
  • the piggy Bac or piggyBac-iike transposon comprises one end comprising at least 14, 16, 18, 20, 30 or 40 contiguous nucleotides of SEQ ID NO: 14506 or SEQ ID NO: 14508. In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end comprising at least 14, 16, 1 8, 20, 30 or 40 contiguous nucleotides of SEQ ID NO: 14507 or SEQ ID NO: 14509. In certain embodiments, the piggyBac or piggyBac- Iike transposon comprises one end with at least 90% identity to SEQ ID NO: 14506 or SEQ ID NO: 14508. In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end with at least 90% identity to SEQ ID NO: 14507 or SEQ ID NO: 14509.
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a sequence of CCCGGCGAGCATGAGG (SEQ ID NO: 14510). In certain embodiments, the piggyBac or piggyBac-like transposon compnses an ITR sequence of SEQ ID NO: 14510. In certain embodiments, the piggyBac or piggy Bac-like transposon comprises a sequence of TTATCCCGGCGAGCATGAGG (SEQ ID NO: 14511 ). In certain embodiments, the piggyBac or piggyBac-like transposon comprises at least 16 contiguous nucleotides from SEQ ID NO: 1451 1.
  • the piggyBac or piggyBac-like transposon comprises a sequence of CCTC ATGCTCGCCGGGTTAT (SEQ ID NO: 14512). In certain embodiments, the piggyBac or piggyBac-like transposon comprises at least 16 contiguous nucleotides from SEQ ID NO: 14512. In certain embodiments, the piggyBac or piggyBac- like transposon comprises one end comprising at least 16 contiguous nucleotides from SEQ ID NO; 14511 and one end comprising at least 16 contiguous nucleotides from SEQ ID NO: 14512.
  • the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 1451 1 and SEQ ID NO: 14512.
  • the piggy Bac or piggyBac- like transposon comprises a sequence of TTAACCCGGCGAGCATGAGG (SEQ ID NO: 14513).
  • the piggyBac or piggyBac-like transposon comprises a sequence of CCTCATGCTCGCCGGGTTAA (SEQ ID NO: 14514).
  • the piggyBac or piggyBac-like transposon may have ends comprising SEQ ID NO: 14506 and SEQ ID NO: 14507, or a variant of either or both of these having at least 90% sequence identity to SEQ ID NO: 14506 or SEQ ID NO: 14507
  • the piggyBac or piggyBac-like transposase has the sequence of SEQ ID NO: 14504 or SEQ ID NO: 14505, or a sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identity to SEQ ID NO: 14504 or SEQ ID NO: 14505.
  • the piggyBac or piggyBac-like transposon comprises a heterologous polynucleotide inserted between a pair of inverted repeats, where the transposon is capable of transposition by a piggyBac or piggyBac-like transposase having at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identity to SEQ ID NO: 14504 or SEQ ID NO; 14505.
  • the transposon comprises two transposon ends, each of which comprises SEQ ID NO: 14510 in inverted orientations in the two transposon ends.
  • each inverted terminal repeat (ITR) is at least 90% identical to SEQ ID NO: 14510.
  • the piggyBac or piggyBac-like transposon is capable of insertion by a piggyBac or piggyBac-like transposase at the sequence 5'-TTAT-3 within a target nucleic acid.
  • one end of the piggy Bac or piggyBac-like transposon comprises at least 16 contiguous nucleotides from SEQ ID NO: 14506 and the other transposon end comprises at least 16 contiguous nucleotides from SEQ ID NO: 14507.
  • one end of the piggy Bac or piggy Bac-like transposon comprises at least 17, at least 18, at least 19, at least 20, at least 22, at least 25, at least 30 contiguous nucleotides from SEQ ID NO: 14506 and the other transposon end comprises at least 17, at least 18, at least 19, at least 20. at least 22, at least 25, at least 30 contiguous nucleotides from SEQ ID NO: 14507.
  • the piggyBac or piggyBac-like transposon comprises transposon ends (each end comprising an 1TR) corresponding to SEQ ID NO: 14506 and SEQ ID NO: 14507, and has a target sequence corresponding to 5'-TTAT3'.
  • the piggyBac or piggyBac-like transposon also comprises a sequence encoding a transposase (e.g. SEQ ID NO: 14505).
  • the piggyBac or piggyBac- like transposon comprises one transposon end corresponding to SEQ ID NO: 14506 and a second transposon end corresponding to SEQ ID NO: 14516.
  • SEQ ID NO: 14516 is very similar to SEQ ID NO: 14507, but has a large insertion shortly before the ITR.
  • the ITR sequences for the two transposon ends are identical (they are both identical to SEQ ID NO: 14510), they have different target sequences: the second transposon has a target sequence corresponding to 5'-TTAA-3 ! , providing evidence that no change in IT sequence is necessary to modify the target sequence specificity.
  • the piggyBac or piggyBac-like transposase (SEQ ID NO: 14504), which is associated with the 5 -TTAA-3' target site differs from the 5'-TTAT-3'-associated transposase (SEQ ID NO: 14505) by only 4 amino acid changes (D322Y, S473C, A5G7T, H582R).
  • the piggyBac or piggyBac-like transposase (SEQ ID NO: 14504), which is associated with the 5'-TTAA-3 " target site is less active than the S' ⁇ TTAT ⁇ 3' ⁇ associated piggyBac or piggyBac-like transposase (SEQ ID NO: 14505) on the transposon with 5'-TTAT-3' ends.
  • piggyBac or piggyBac-like transposons with 5'-TTAA-3' target sites can be converted to piggyBac or piggyBac-like transposases with 5'-TTAT-3 target sites by replacing 5 ! -TTAA-3' target sites with 5'-TTAT-3'.
  • transposons can be used either with a piggyBac or piggyBac-like transposase such as SEQ ID NO: 14504 which recognizes the 5'-TTAT-3' target sequence, or with a variant of a transposase originally associated with the 5'-TTAA-3' transposon.
  • the high similarity between the 5'-TTAA-3' and 5'- ⁇ -3' piggyBac or piggyBac-like transposases demonstrates that very few changes to the amino acid sequence of a piggyBac or piggyBac-like transposase alter target sequence specificity, in certain embodiments, modification of any piggy Bac or piggy Bac-like transposon-transposase gene transfer system, in which 5'-TTAA-3' target sequences are replaced with 5'-TTAT-3'-target sequences, the ITRs remain the same, and the transposase is the original piggyBac or piggyBac-like transposase or a variant thereof resulting from using a low-level mutagenesis to introduce mutations into the transposase.
  • piggyBac or piggy Bac-like transposon transposase transfer systems can be formed by the modification of a 5'-TTAT-3'-active piggyBac or piggyBac-like transposon-transposase gene transfer systems in which 5 ! -TTAT-3' target sequences are replaced with 5'-TTAA-3'-target sequences, the ITRs remain the same, and the piggyBac or piggyBac-like transposase is the original transposase or a variant thereof,
  • the piggyBac or piggyBac-like transposon is isolated or derived from Bombyx mori. in certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggy Bac-like transposon compri ses a sequence of:
  • the transposori comprises at least 16 contiguous bases from SEQ ID NO: 14577 and at least 16 contiguous bases from SEQ ID NO: 14578, and inverted terminal repeats that are at least 87% identical to CCCGGCGAGCATGAGG (SEQ ID NO: 14510).
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14595 and SEQ ID NO: 14596, and is transposed by the piggyBac or piggy Bac-like iTansposase of SEQ ID NO: 14505.
  • the ITRs of SEQ ID NO: 14595 and SEQ ID: 14596 are not flanked by a 5 " -TTAA-3 ' sequence.
  • the ITRs of SEQ TD NO: 14595 and SEQ ID: 14596 are flanked by a 5'-TTAT-3' sequence.
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggy Bac-like transposon comprises a sequence of:
  • the left end of the piggyBac or piggyBac-like transposon comprises a sequence of SEQ ID NO: 14577, SEQ ID NO: 14595, or SEQ ID NOs: 1459744599. In certain embodiments, the left end of the piggyBac or piggyBac-like transposon is preceded by a left target sequence.
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggy Bac-like transposon comprises a sequence of: 1 cccggcgagc atqaggcagg gtatcccata ccctggtaaa attttaaagt tgtgcatttt
  • the right end of the piggyBac or piggy Bac-like transposon comprises a sequence of SEQ ID NO: 14578, SEQ ID NO: 14596, or SEQ ID NOs: 14600- 14601.
  • the right end of the piggyBac or piggyBac-like transposon is followed by a right target sequence.
  • the transposon is transposed by the transposase of SEQ ID NO: 14505.
  • the left and right ends of the piggyBac or piggyBac-like transposon share a 16 bp repeat sequence of SEQ ID NO: 14510 in inverted orientation and immediately adjacent to the target sequence.
  • the left transposon end begins with SEQ ID NO: 14510, and the right transposon end ends with the reverse complement of SEQ ID NO: 14510, 5' ⁇
  • the piggyBac or piggyBac-like transposon comprises an ITR with at least 93%, at least 87%, or at least 81% or any percentage in between identity to SEQ ID NO: 14510 or SEQ ID NO: 14603.
  • the piggyBac or piggyBac-like transposon comprises a target sequence followed by a left transposon end comprising a sequence selected from SEQ ID NOs: 88, 105 or 107 and a right transposon end comprising SEQ ID NO: 14578 or 106 followed by a target sequence
  • the piggyBac or piggyBac like transposon comprises one end that comprises a sequence that is at least 90%, at least 95% or at least 99% or any percentage in between identical to SEQ ID NO: 14577 and one end that comprises a sequence that is at least 90%, at least 95% or at least 99% or any percentage in between identical to SEQ ID NO: 14578.
  • one transposon end comprises at least 14, at least 16, at least 18 or at least 20 contiguous bases from SEQ ID NO: 14577 and one transposon end comprises at least 14, at least 16, at least 18 or at least 20 contiguous bases from SEQ ID NO: 14578.
  • the piggyBac or piggyBac-like transposon comprises two transposon ends wherein each transposon ends comprises a sequence that is at least 81 % identical, at least 87% identical or at least 93% identical or any percentage in between identi cal to SEQ ID NO: 14510 in inverted orientation in the two transposon ends.
  • One end may further comprise at least 14, at least 16, at least 18 or at least 20 contiguous bases from SEQ ID NO: 14599, and the other end may further comprise at least 14, at least 16, at least 18 or at least 20 contiguous bases from SEQ ID NO: 14601.
  • the piggy Bac or piggyBac-like transposon may be transposed by the transposase of SEQ ID NO: 14505, and the transposase may optionally be fused to a nuclear localization signal.
  • the piggy Bac or piggyBac-like transposon comprises SEQ ID NO: 14595 and SEQ ID NO: 14596 and the piggyBac or piggyBac-like transposase compnses SEQ ID NO: 14504 or SEQ ID NO: 14505.
  • the piggyBac or piggyBac-like transposon compnses SEQ ID NO: 14597 and SEQ ID NO: 14596 and the piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14504 or SEQ ID NO: 14505.
  • the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14595 and SEQ ID NO: 14578 and the piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14504 or SEQ ID NO: 14505.
  • the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14602 and SEQ ID NO: 14600 and the piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14504 or SEQ ID NO: 14505.
  • the piggyBac or piggyBac-like transposon comprises a left end comprising 1 , 2, 3, 4, 5, 6, or 7 sequences selected from ATGAGGCAGGGTAT (SEQ ID NO: 14614), ATACCCTGCCTCAT (SEQ ID NO: 14615), GGCAGGGTAT (SEQ ID NO: 14616), ATACCCTGCC (SEQ ID NO: 14617), TAAAATTTTA (SEQ ID NO: 14618), ATTTTATAAAAT (SEQ ID NO: 14619), TCATACCCTG (SEQ ID NO: 14620) and TAAATAATAATAA (SEQ ID NO: 14621).
  • the piggyBac or piggyBac-like transposon comprises a right end comprising 1, 2 or 3 sequences selected from SEQ ID NO: 14617, SEQ ID NO: 14620 and SEQ ID NO: 14621.
  • the transposase enzyme is a piggyBac or piggyBac-like transposase enzyme
  • the piggyBac or piggyBac-like transposase enzyme is isolated or derived from Xenopus tropicalis.
  • the piggyBac or piggyBac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%. 10%, 15%, 20%, 25%. 30%, 35%, 40%. 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:
  • the piggy Bac or pigg Bac-like transposase is a hyperactive variant of SEQ ID NO: 14517
  • the piggy Bac or piggyBac-like transposase is an integration defective variant of SEQ ID NO: 14517.
  • the piggyBac or piggy Bac-like transposase enzyme may comprise or consist of an amino acid sequence at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:
  • the piggyBac or piggyBac-like transposase is isolated or derived from Xenopus tropica!is.
  • the piggyBac or piggy Bac-like transposase is a hyperactive piggyBac or piggyBac-like transposase.
  • the hyperactive piggyBac or piggyBac-like transposase comprises a sequence at least 90% identical to:
  • piggyBac or piggyBac-like transposase is a hyperactive piggyBac or piggyBac-like transposase.
  • transposase is a transposase that is more active than the naturally occumng variant from which it is derived.
  • a hyperactive piggyBac or piggyBac-like transposase is more active than the transposase of SEQ ID NO: 14517.
  • the hyperactive piggvBac or piggyBac-like transposase comprises a sequence of:
  • the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:
  • the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:
  • the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:
  • the hyperactive piggyBac or piggyBac-like transposase comprises a sequence of:
  • the hyperactive piggyBac or piggyBac -like transposase comprises a sequence of:
  • the hyperactive piggyBac or piggyBac -like transposase comprises an ammo acid substitution at a position selected from amino acid 6, 7, 16, 19, 20, 21, 22, 23, 24, 26, 28, 31, 34, 67, 73, 76, 77, 88, 91, 141, 145, 146, 148, 150, 157, 162, 179, 182, 189, 192, 193, 196, 198, 200, 210, 212, 218, 248, 263, 270, 294, 297, 308, 310, 333, 336, 354, 357, 358, 359, 377, 423, 426, 428, 438, 447, 450, 462, 469.
  • the hyperactive piggyBac or piggyBac-like transposase compnses an amino acid substitution of Y6C, S7G, M16S, S19G, S20Q, S20G, S20D, E21D, E22Q, F23T, F23P, S24Y, S26V, S28Q, V31K.
  • the hyperactive piggyBac or piggyBac-like transposase comprises one or more substitutions of an amino acid that is not wild type, wherein the one or more substitutions a for wild type amino acid comprises a substitution of A2X, K3X, R4X, F5X, Y6X, S7X, A11X, A13X, C15X, M16X, A17X, S 18X, S 19X, S20X, E21X, E22X, F23X, S24X, G25X, 26X, D27X, S28X, E29X, E42X, E43X, S44X, C46X, S47X, S48X, S49X, T50X, V51X, S52X, A53X, L54X, E55X, E56X, P57X, M58X, E59X, E62X, D63X, V64X, D65X, D66X, L67X, E68X, D
  • a list of hyperactive amino acid substitutions can be found in US patent No.
  • the piggy Bac or piggyBac-like transposase is integration deficient.
  • an integration deficient piggyBac or piggyBac-like transposase is a transposase that can excise its corresponding transposon, but that integrates the excised transposon at a lower frequency than a corresponding naturally occurring transposase.
  • the piggyBac or piggyBac-like transposase is an integration deficient variant of SEQ ID NO: 14517, In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase is deficient relative to SEQ ID NO: 14517.
  • the piggyBac or piggyBac-like transposase is active for excision but deficient in integration.
  • the integration deficient piggyBac or piggy Bac-like transposase comprises a sequence that is at least 90% identical to a. sequence of :
  • the integration deficient piggyBac or piggyBac-like transposase comprises a sequence that is at least 90% identical to a sequence of:
  • the integration deficient piggy Bac or piggyBac-like transposase comprises a sequence that is at least 90% identical to a sequence of:
  • the integration deficient piggyBac or piggy Bac-like transposase comprises SEQ ID NO: 14611. In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises a sequence that is at least 90% identical to a sequence of:
  • the integration deficient piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14612. In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises a sequence that is at least 90% identical to a sequence of:
  • the integration deficient piggyBac or piggyBac-like transposase comprises SEQ ID NO: 14613. In certain embodiments, the integration deficient piggyBac or piggyBac-like transposase comprises an amino acid substitution wherein the Asn at position 218 is replaced by a GIu or an Asp (N218D or N218E) (relative to SEQ ID NO: 14517).
  • the excision competent, integration deficient piggyBac or piggyBac-like transposase comprises one or more substitutions of an amino acid that is not wild type, wherein the one or more substitutions a for wild type amino acid comprises a substitution of A2X, 3X, R4X, F5X, Y6X, S7X ; A8X, E9X, E10X, A11X, A12X, A13X, H14X, C 15X, M16X, A17X, S18X, S I 9X, S20X, E21X, E22X, F23X, S24X, G25X, 26X, D27X, S28X, E29X, V3 IX, P32X, P33X, A34X, S35X, E36X, S37X, D38X, S39X, S40X, T41X, E42X, E43X, S44X, W45X, C46X, S47X, S48
  • the piggyBac or piggyBac-like transposase is fused to a nuclear localization signal
  • SEQ ID NO: 14517 or SEQ ID NO: 14518 is fused to a nuclear localization signal.
  • the amino acid sequence of the piggyBac or piggyBac like transposase fused to a nuclear localization sig al is encoded by a polynucleotide sequence comprising:
  • the piggyBac or piggyBac-like transposon is isolated or derived from Xenopus tropicalis. In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14 19 and SEQ ID NO: 14520. In certain embodiments, the piggyBac or piggyBac- like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a sequence of:
  • the piggyBac or piggy Bac-like transposon comprises SEQ ID NO: 14520 and SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523.
  • the piggyBac or piggyBac-like transposon comprises SEQ ID NO: 14522 and SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523.
  • the piggyBac or piggyBac-like transposon comprises one end comprising at least 14, 16, 18, 20, 30 or 40 contiguous nucleotides from SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523.
  • the piggyBac or piggy Bac-like transposon comprises one end comprising at least 14, 16, 18, 20, 30 or 40 contiguous nucleotides from SEQ ID NO: 14520 or SEQ ID NO: 14522. In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end with at least 90% identity to SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523, In certain embodiments, the piggyBac or piggyBac-like transposon comprises one end with at least 90% identity to SEQ ID NO: 14520 or SEQ ID NO: 14522. In one embodiment, one transposon end is at least 90% identical to SEQ ID NO: 14519 and the other transposon end is at least 90% identical to SEQ ID NO: 14520.
  • the piggyBac or piggyBac-like transposon comprises a sequence of TTAACCTTTTTACTGCCA (SEQ ID NO: 14524). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of
  • the piggyBac or piggyBac-like transposon comprises a sequence of TTAACCYTTTTACTGCCA (SEQ ID NO: 14527). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of TGGC AGT AAAAGGGTTAA (SEQ ID NO: 14529). In certain embodiments, the piggyBac or piggyBac-like transposon comprises a sequence of
  • the piggyBac or piggyBac-like transposon comprises a sequence of TTAACCYTTTKMCTGCCA (SEQ ID NO: 14533).
  • one end of the piggyBac or piggyBac-like transposon comprises a sequence selected from SEQ ID NO: 14524, SEQ ID NO: 14526 and SEQ ID NO: 14527.
  • one end of the piggyBacTM (PB) or piggyBac- like transposon comprises a sequence selected from SEQ ID NO: 14529 and SEQ ID NO: 14531.
  • each inverted terminal repeat of the piggy Bac or piggyBac- like transposon comprises a sequence of ITR sequence of CCYTTTKMCTGCCA (SEQ ID NO: 14563).
  • each end of the piggyBacTM (PB) or piggyBac-like transposon comprises SEQ ID NO: 14563 in inverted orientations.
  • one ITR of the piggy Bac or piggyBac-like transposon comprises a sequence selected from SEQ ID NO: 14524, SEQ ID NO: 14526 and SEQ ID NO: 14527.
  • one ITR of the piggy Bac or piggyBac-like transposon comprises a sequence selected from SEQ ID NO: 14529 and SEQ ID NO: 14531.
  • the piggyBac or piggyBac like transposon comprises SEQ ID NO: 14533 in inverted orientation in the two transposon ends.
  • the piggyBac or piggy Bac-like transposon may have ends comprising SEQ ID NO: 14519 and SEQ ID NO: 14520 or a variant of either or both of these having at least 90% sequence identity to SEQ ID NO: S 4519 or SEQ ID NO: 14520, and the piggyBac or piggy Bac-like transposase has the sequence of SEQ ID NO: 14517 or a variant showing at least %, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between sequence identity to SEQ ID NO: 14517 or SEQ ID NO: 14518.
  • one piggyBac or piggyBac -like transposon end comprises at least 14 contiguous nucleotides from SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523, and the other transposon end comprises at least 14 contiguous nucleotides from SEQ ID NO: 14520 or SEQ ID NO: 14522.
  • one transposon end comprises at least 15, at least 1 , at least 17, at least 18, at least 19, at least 20, at least 22, at least 25, at least 30 contiguous nucleotides from SEQ ID NO: 14519, SEQ ID NO: 14521 or SEQ ID NO: 14523, and the other transposon end comprises at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 22, at least 25 or at least 30 contiguous nucleottdes from SEQ ID NO: 14520 or SEQ ID NO: 14522.
  • the piggyBac or piggyBac-like iransposase recognizes a transposon end with a left sequence corresponding to SEQ ID NO: 14519, and a right sequence corresponding to SEQ ID NO: 14520. It will excise the transposon from one DNA molecule by cutting the DN A at the 5'-TTAA-3' sequence at the left end of one transposon end to the 5'-TTAA-3' at the right end of the second transposon end, including any heterologous DNA that is placed between them, and insert the excised sequence into a second DNA molecule.
  • truncated and modified versions of the left and right transposon ends will also function as part of a transposon that can be transposed by the piggyBac or piggy Bac-like transposase.
  • the left transposon end can be replaced by a sequence corresponding to SEQ ID NO: 14521 or SEQ ID NO: 14523
  • the right transposon end can be replaced by a shorter sequence corresponding to SEQ ID NO: 14522.
  • the left and right transposon ends share an 18 bp almost perfectly repeated sequence at their ends (5 ' -TT A ACC YTTTKMCTGCC A : SEQ ID NO: 14533) that includes the 5 !
  • transposon that comprises a heterologous polynucleotide inserted between two transposon ends each comprising
  • one transposon end comprises a sequence selected from SEQ ID NOS: 14524, SEQ ID NO: 14526 and SEQ ID NO: 14527. In some embodiments, one transposon end comprises a seque ce selected from SEQ ID NO: 14529 and SEQ ID NO: 14531.
  • the piggyBacTM (PB) or pigg Bac-like transposon is isolated or derived from Xenopus tropicalis.
  • the piggyBac or piggyBac- ke transposon comprises at a sequence of:
  • the piggyBac or piggyBae-like transposon comprises at a sequence of:
  • the piggyBac or piggyBac-like transposon comprises at least 16 contiguous bases from SEQ ID NO: 14573 or SEQ ID NO: 14574, and inverted terminal repeat of CCYTTTBMCTGCCA (SEQ ID NO: 14575).
  • the piggyBac or piggyBac-like transposon comprises at a sequence of:
  • the piggyBac or piggyBac-like transposon comprises at a sequence of:
  • the piggyBac or piggyBae-like transposon comprises at a sequence of:
  • the piggyBac or piggyBac-like transposon comprises at a sequence of:
  • the piggyBac or piggyBae-like transposon comprises at a sequence of:
  • the piggyBac or piggyBae-like transposon comprises at a sequence of:
  • the piggyBac or pigg Bac-like transposon comprises at a sequence of:
  • the piggyBac or piggyBac-like transposon comprises at a sequence of:
  • the piggyBac or piggyBac-like transposon comprises a left transposon end sequence selected from SEQ ID NO: 14573 and SEQ ID NOs: 14579-14585. In certain embodiments, the left transposon end sequence is preceded by a left target sequence. In certain embodiments, the piggyBac or piggyBac-like transposon comprises at a sequence of:
  • the piggvBac or piggy Bac-like transposon comprises at a sequence of:
  • the piggvBac or piggyBae-like transposon comprises at a sequence of:

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Hematology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Diabetes (AREA)
  • Mycology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Developmental Biology & Embryology (AREA)
PCT/US2018/050288 2017-09-08 2018-09-10 COMPOSITIONS AND METHODS FOR CONDITIONAL GENE EXPRESSION MEDIATED BY A CHIMERIC LIGAND RECEPTOR (CLR) Ceased WO2019051424A2 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
EP18800779.3A EP3679145A2 (en) 2017-09-08 2018-09-10 Compositions and methods for chimeric ligand receptor (clr)-mediated conditional gene expression
CA3072777A CA3072777A1 (en) 2017-09-08 2018-09-10 Compositions and methods for chimeric ligand receptor (clr)-mediated conditional gene expression
CN201880071587.1A CN111727256A (zh) 2017-09-08 2018-09-10 用于嵌合配体受体(clr)-介导的条件性基因表达的组合物和方法
JP2020513604A JP2020532987A (ja) 2017-09-08 2018-09-10 キメラリガンド受容体(clr)介在性の条件遺伝子発現のための組成物および方法
AU2018329741A AU2018329741B2 (en) 2017-09-08 2018-09-10 Compositions and methods for chimeric ligand receptor (CLR)-mediated conditional gene expression
US16/640,788 US12385061B2 (en) 2017-09-08 2018-09-10 Compositions and methods for chimeric ligand receptor (CLR)-mediated conditional gene expression
JP2024076622A JP2024109657A (ja) 2017-09-08 2024-05-09 キメラリガンド受容体(clr)介在性の条件遺伝子発現のための組成物および方法
AU2025203769A AU2025203769A1 (en) 2017-09-08 2025-05-21 Compositions and methods for chimeric ligand receptor (CLR)-mediated conditional gene expression

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762556310P 2017-09-08 2017-09-08
US62/556,310 2017-09-08

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US16/640,788 A-371-Of-International US12385061B2 (en) 2017-09-08 2018-09-10 Compositions and methods for chimeric ligand receptor (CLR)-mediated conditional gene expression
US19/257,090 Continuation US20260125700A1 (en) 2025-07-01 Compositions and methods for chimeric ligand receptor (clr)-mediated conditional gene expression
US19/257,110 Division US20260125701A1 (en) 2025-07-01 Compositions and methods for chimeric ligand receptor (clr)-mediated conditional gene expression

Publications (3)

Publication Number Publication Date
WO2019051424A2 true WO2019051424A2 (en) 2019-03-14
WO2019051424A3 WO2019051424A3 (en) 2019-04-11
WO2019051424A9 WO2019051424A9 (en) 2019-05-23

Family

ID=64270934

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/050288 Ceased WO2019051424A2 (en) 2017-09-08 2018-09-10 COMPOSITIONS AND METHODS FOR CONDITIONAL GENE EXPRESSION MEDIATED BY A CHIMERIC LIGAND RECEPTOR (CLR)

Country Status (7)

Country Link
US (1) US12385061B2 (cg-RX-API-DMAC7.html)
EP (1) EP3679145A2 (cg-RX-API-DMAC7.html)
JP (2) JP2020532987A (cg-RX-API-DMAC7.html)
CN (1) CN111727256A (cg-RX-API-DMAC7.html)
AU (2) AU2018329741B2 (cg-RX-API-DMAC7.html)
CA (1) CA3072777A1 (cg-RX-API-DMAC7.html)
WO (1) WO2019051424A2 (cg-RX-API-DMAC7.html)

Cited By (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10676516B2 (en) 2017-05-24 2020-06-09 Pandion Therapeutics, Inc. Targeted immunotolerance
WO2020223478A1 (en) * 2019-05-01 2020-11-05 Pact Pharma, Inc. Compositions and methods for the treatment of cancer using a tet2 engineered t cell therapy
EP3753566A1 (en) * 2019-06-21 2020-12-23 Medizinische Hochschule Hannover All-in one viral vector for car and therapeutic effector molecule
WO2021026294A1 (en) * 2019-08-06 2021-02-11 Children's Medical Center Corporation Methods and compositions for reconstituting microglia
US10946068B2 (en) 2017-12-06 2021-03-16 Pandion Operations, Inc. IL-2 muteins and uses thereof
US10961310B2 (en) 2017-03-15 2021-03-30 Pandion Operations, Inc. Targeted immunotolerance
US11091526B2 (en) 2017-12-06 2021-08-17 Pandion Operations, Inc. IL-2 muteins and uses thereof
WO2021222249A1 (en) * 2020-04-27 2021-11-04 The Trustees Of The University Of Pennsylvania Compositions and methods for reducing nuclease expression and off-target activity using a promoter with low transcriptional activity
WO2021234662A1 (en) * 2020-05-21 2021-11-25 Crispr Therapeutics Ag Genetically engineered car t cells that secrete interleukin-12 and therapeutic uses thereof
CN114072129A (zh) * 2019-05-03 2022-02-18 宾夕法尼亚州大学信托人 可用于治疗异染性脑白质营养不良的组合物
WO2022226375A1 (en) * 2021-04-23 2022-10-27 Locanabio, Inc. Tissue-targeted modified aav capsids and methods of use thereof
US20220339245A1 (en) * 2021-04-27 2022-10-27 Academia Sinica Methods of treating hypertriglyceridemia or hypertriglyceridemia-related diseases
WO2022232796A1 (en) * 2021-04-28 2022-11-03 The General Hospital Corporation Il2 tethered to its receptor il2rbeta and pore-forming proteins as a platform to enhance immune cell activity
WO2023004021A3 (en) * 2021-07-23 2023-03-09 The Children's Medical Center Corporation Zinc finger ccch-type containing 14 (zc3h14) mutants and methods of use
US11672874B2 (en) 2019-09-03 2023-06-13 Myeloid Therapeutics, Inc. Methods and compositions for genomic integration
EP4063379A4 (en) * 2019-12-02 2023-07-26 LG Chem, Ltd. PROTEIN SECRETION FACTOR DERIVED FROM A CHO CELL AND EXPRESSION VECTOR COMPRISING THE SAME
US11739146B2 (en) 2019-05-20 2023-08-29 Pandion Operations, Inc. MAdCAM targeted immunotolerance
US11981715B2 (en) 2020-02-21 2024-05-14 Pandion Operations, Inc. Tissue targeted immunotolerance with a CD39 effector
WO2024134206A3 (en) * 2022-12-22 2024-09-12 Autolus Limited Chimeric antigen receptor with spacers
US12202856B2 (en) 2016-05-19 2025-01-21 The General Hospital Corporation Tethered interleukin-2 to its receptor IL-2RBETA, a platform to enhance natural killer and regulatory T cell activity
EP4197545A4 (en) * 2020-07-31 2025-04-09 Chugai Seiyaku Kabushiki Kaisha Pharmaceutical composition comprising a cell for expressing a chimeric receptor
US12319925B2 (en) 2021-05-11 2025-06-03 Myeloid Therapeutics, Inc. Methods and compositions for genomic integration
USRE50550E1 (en) 2017-12-06 2025-08-26 Pandion Operations, Inc. IL-2 muteins and uses thereof

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2018329741B2 (en) 2017-09-08 2025-02-20 Poseida Therapeutics, Inc. Compositions and methods for chimeric ligand receptor (CLR)-mediated conditional gene expression
WO2020117715A1 (en) 2018-12-03 2020-06-11 Board Of Regents, The University Of Texas System Oligo-benzamide analogs and their use in cancer treatment
TW202110873A (zh) 2019-04-30 2021-03-16 美商聖堤生物科技股份有限公司 嵌合受體及其使用方法
CN114940974A (zh) * 2021-09-28 2022-08-26 宁波熙宁检测技术有限公司 4-1bb报告基因293t稳转细胞株构建和应用
WO2023109911A1 (en) * 2021-12-15 2023-06-22 National Institute Of Biological Sciences, Beijing Microglia having car and use thereof
CN115216492B (zh) * 2022-06-29 2023-05-30 浙江欧赛思生物科技有限公司 一种小鼠原发神经胶质瘤模型的制备方法及其应用
WO2025070635A1 (ja) * 2023-09-27 2025-04-03 味の素株式会社 免疫細胞培養用培地

Citations (51)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4309989A (en) 1976-02-09 1982-01-12 The Curators Of The University Of Missouri Topical application of medication by ultrasound with coupling agent
US4589330A (en) 1981-04-22 1986-05-20 Teron International Urban Corp. Ltd. Ceiling structure
US4656134A (en) 1982-01-11 1987-04-07 Board Of Trustees Of Leland Stanford Jr. University Gene amplification in eukaryotic cells
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4704692A (en) 1986-09-02 1987-11-03 Ladner Robert C Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
US4766067A (en) 1985-05-31 1988-08-23 President And Fellows Of Harvard College Gene amplification
US4767402A (en) 1986-07-08 1988-08-30 Massachusetts Institute Of Technology Ultrasound enhancement of transdermal drug delivery
US4795699A (en) 1987-01-14 1989-01-03 President And Fellows Of Harvard College T7 DNA polymerase
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US4818542A (en) 1983-11-14 1989-04-04 The University Of Kentucky Research Foundation Porous microspheres for drug delivery and methods for making same
US4889818A (en) 1986-08-22 1989-12-26 Cetus Corporation Purified thermostable enzyme
US4921794A (en) 1987-01-14 1990-05-01 President And Fellows Of Harvard College T7 DNA polymerase
US4939666A (en) 1987-09-02 1990-07-03 Genex Corporation Incremental macromolecule construction methods
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US4965188A (en) 1986-08-22 1990-10-23 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme
US4994370A (en) 1989-01-03 1991-02-19 The United States Of America As Represented By The Department Of Health And Human Services DNA amplification technique
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
US5066584A (en) 1988-09-23 1991-11-19 Cetus Corporation Methods for generating single stranded dna by the polymerase chain reaction
WO1991018980A1 (en) 1990-06-01 1991-12-12 Cetus Corporation Compositions and methods for identifying biologically active molecules
WO1991019818A1 (en) 1990-06-20 1991-12-26 Affymax Technologies N.V. Peptide library and screening systems
US5091310A (en) 1988-09-23 1992-02-25 Cetus Corporation Structure-independent dna amplification by the polymerase chain reaction
WO1992005258A1 (en) 1990-09-20 1992-04-02 La Trobe University Gene encoding barley enzyme
US5122464A (en) 1986-01-23 1992-06-16 Celltech Limited, A British Company Method for dominant selection in eucaryotic cells
US5130238A (en) 1988-06-24 1992-07-14 Cangene Corporation Enhanced nucleic acid amplification process
US5142033A (en) 1988-09-23 1992-08-25 Hoffmann-La Roche Inc. Structure-independent DNA amplification by the polymerase chain reaction
WO1992014843A1 (en) 1991-02-21 1992-09-03 Gilead Sciences, Inc. Aptamer specific for biomolecules and method of making
US5168062A (en) 1985-01-30 1992-12-01 University Of Iowa Research Foundation Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence
WO1993008278A1 (en) 1991-10-16 1993-04-29 Affymax Technologies N.V. Peptide library and screening method
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US5266491A (en) 1989-03-14 1993-11-30 Mochida Pharmaceutical Co., Ltd. DNA fragment and expression plasmid containing the DNA fragment
WO1996019256A1 (en) 1994-12-22 1996-06-27 Advanced Cardiovascular Systems, Inc. Adjustable length balloon catheter
US5576195A (en) 1985-11-01 1996-11-19 Xoma Corporation Vectors with pectate lyase signal sequence
US5580734A (en) 1990-07-13 1996-12-03 Transkaryotic Therapies, Inc. Method of producing a physical map contigous DNA sequences
US5595898A (en) 1985-11-01 1997-01-21 Xoma Corporation Modular assembly of antibody genes, antibodies prepared thereby and use
US5641670A (en) 1991-11-05 1997-06-24 Transkaryotic Therapies, Inc. Protein production and protein delivery
US5643768A (en) 1989-10-05 1997-07-01 Optein, Inc. Cell-free synthesis and isolation of novel genes and polypeptides
US5656730A (en) 1995-04-07 1997-08-12 Enzon, Inc. Stabilized monomeric protein compositions
US5733761A (en) 1991-11-05 1998-03-31 Transkaryotic Therapies, Inc. Protein production and protein delivery
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5763733A (en) 1994-10-13 1998-06-09 Enzon, Inc. Antigen-binding fusion proteins
US5839446A (en) 1992-10-28 1998-11-24 Transmedica International, Inc. Laser perforator
WO1998053847A1 (en) 1997-05-29 1998-12-03 Ben Gurion University Of The Negev Research And Development Authority Transdermal delivery system
US5851198A (en) 1995-10-10 1998-12-22 Visionary Medical Products Corporation Gas pressured needle-less injection device and method
US5856456A (en) 1992-11-20 1999-01-05 Enzon, Inc. Linker for linked fusion polypeptides
US5885793A (en) 1991-12-02 1999-03-23 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
WO1999016419A1 (en) 1997-09-29 1999-04-08 Inhale Therapeutic Systems, Inc. Perforated microparticles and methods of use
US6019968A (en) 1995-04-14 2000-02-01 Inhale Therapeutic Systems, Inc. Dispersible antibody compositions and methods for their preparation and use
US9228180B2 (en) 2007-07-04 2016-01-05 Max-Delbruck-Centrum Fur Molekulare Medizin Polypeptide variants of sleeping beauty transposase
US10041077B2 (en) 2014-04-09 2018-08-07 Dna2.0, Inc. DNA vectors, transposons and transposases for eukaryotic genome modification

Family Cites Families (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2003135078A (ja) * 2001-07-26 2003-05-13 Japan Tobacco Inc C型肝炎ウイルスns5aタンパク質の変異体、およびその利用
WO2005063170A2 (en) * 2003-12-29 2005-07-14 Toudai Tlo, Ltd. Methods of identifying immunoregulatory agents, immunoregulatory agents, and uses thereof
WO2006133398A2 (en) 2005-06-08 2006-12-14 Invitrogen Corporation In vitro activated donor t-cells to promote transplant engraftment
WO2010126766A1 (en) 2009-04-30 2010-11-04 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Inducible interleukin-12
FR2952374B1 (fr) * 2009-11-06 2012-11-16 Univ Claude Bernard Lyon Production de facteur ix recombinant dans une lignee cellulaire hepatocytaire humaine
US9089520B2 (en) 2010-05-21 2015-07-28 Baylor College Of Medicine Methods for inducing selective apoptosis
JP6440496B2 (ja) 2011-09-27 2018-12-19 ヤンセン バイオテツク,インコーポレーテツド 選択的結合表面を有するフィブロネクチンiii型反復ベースのタンパク質スカフォールド
MX367100B (es) * 2012-02-17 2019-08-05 The Children´S Hospital Of Philadelphia Composiciones del vector aav y metodos para su transferencia genetica a celulas, organos y tejidos.
ES2791598T3 (es) 2013-06-05 2020-11-05 Bellicum Pharmaceuticals Inc Métodos para inducir apoptosis parcial utilizando polipéptidos de caspasa
KR102375998B1 (ko) 2014-02-14 2022-03-21 더 보드 오브 리젠츠 오브 더 유니버시티 오브 텍사스 시스템 키메라 항원 수용체 및 제조방법
CN107810420B (zh) * 2015-06-25 2020-08-14 豪夫迈·罗氏有限公司 用于测定抗体或配体结合和功能的基于细胞的测定
GB2592821B (en) 2015-07-31 2022-01-12 Univ Minnesota Modified cells and methods of therapy
GB201514875D0 (en) * 2015-08-20 2015-10-07 Autolus Ltd Receptor
WO2017133175A1 (en) * 2016-02-04 2017-08-10 Nanjing Legend Biotech Co., Ltd. Engineered mammalian cells for cancer therapy
CN109312361A (zh) 2016-02-26 2019-02-05 波赛伊达治疗学股份有限公司 转座子系统及应用方法
WO2018073394A1 (en) * 2016-10-19 2018-04-26 Cellectis Cell death inducing chimeric antigen receptors
CN118374493A (zh) 2017-05-17 2024-07-23 西雅图儿童医院(Dba西雅图儿童研究所) 生成哺乳动物t细胞活化诱导型合成启动子(syn+pro)以改善t细胞疗法
WO2019014390A1 (en) 2017-07-12 2019-01-17 Refuge Biotechnologies, Inc. METHODS AND SYSTEMS FOR CONDITIONAL REGULATION OF GENE EXPRESSION
AU2018329741B2 (en) 2017-09-08 2025-02-20 Poseida Therapeutics, Inc. Compositions and methods for chimeric ligand receptor (CLR)-mediated conditional gene expression
AU2019335014A1 (en) 2018-09-05 2021-03-25 Poseida Therapeutics, Inc. Allogeneic cell compositions and methods of use

Patent Citations (70)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4309989A (en) 1976-02-09 1982-01-12 The Curators Of The University Of Missouri Topical application of medication by ultrasound with coupling agent
US4589330A (en) 1981-04-22 1986-05-20 Teron International Urban Corp. Ltd. Ceiling structure
US4656134A (en) 1982-01-11 1987-04-07 Board Of Trustees Of Leland Stanford Jr. University Gene amplification in eukaryotic cells
US4818542A (en) 1983-11-14 1989-04-04 The University Of Kentucky Research Foundation Porous microspheres for drug delivery and methods for making same
US5168062A (en) 1985-01-30 1992-12-01 University Of Iowa Research Foundation Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence
US5385839A (en) 1985-01-30 1995-01-31 University Of Iowa Research Foundation Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter regulatory DNA sequence
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683202B1 (cg-RX-API-DMAC7.html) 1985-03-28 1990-11-27 Cetus Corp
US4766067A (en) 1985-05-31 1988-08-23 President And Fellows Of Harvard College Gene amplification
US5595898A (en) 1985-11-01 1997-01-21 Xoma Corporation Modular assembly of antibody genes, antibodies prepared thereby and use
US5693493A (en) 1985-11-01 1997-12-02 Xoma Corporation Modular assembly of antibody genes, antibodies prepared thereby and use
US5618920A (en) 1985-11-01 1997-04-08 Xoma Corporation Modular assembly of antibody genes, antibodies prepared thereby and use
US5576195A (en) 1985-11-01 1996-11-19 Xoma Corporation Vectors with pectate lyase signal sequence
US5698417A (en) 1985-11-01 1997-12-16 Xoma Corporation Modular assembly of antibody genes, antibodies prepared thereby and use
US5698435A (en) 1985-11-01 1997-12-16 Xoma Corporation Modular assembly of antibody genes, antibodies prepared thereby and use
US5122464A (en) 1986-01-23 1992-06-16 Celltech Limited, A British Company Method for dominant selection in eucaryotic cells
US5770359A (en) 1986-01-23 1998-06-23 Celltech Therapeutics Limited Recombinant DNA sequences, vectors containing them and method for the use thereof
US5827739A (en) 1986-01-23 1998-10-27 Celltech Therapeutics Limited Recombinant DNA sequences, vectors containing them and method for the use thereof
US4683195B1 (cg-RX-API-DMAC7.html) 1986-01-30 1990-11-27 Cetus Corp
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US4767402A (en) 1986-07-08 1988-08-30 Massachusetts Institute Of Technology Ultrasound enhancement of transdermal drug delivery
US4965188A (en) 1986-08-22 1990-10-23 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme
US4889818A (en) 1986-08-22 1989-12-26 Cetus Corporation Purified thermostable enzyme
US5534621A (en) 1986-09-02 1996-07-09 Enzon Labs, Inc. Immunoaffinity purification methods using single polypeptide chain binding molecules
US4704692A (en) 1986-09-02 1987-11-03 Ladner Robert C Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides
US5518889A (en) 1986-09-02 1996-05-21 Enzon Labs Inc. Immunoassay methods using single polypeptide chain binding molecules
US5455030A (en) 1986-09-02 1995-10-03 Enzon Labs, Inc. Immunotheraphy using single chain polypeptide binding molecules
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US4795699A (en) 1987-01-14 1989-01-03 President And Fellows Of Harvard College T7 DNA polymerase
US4921794A (en) 1987-01-14 1990-05-01 President And Fellows Of Harvard College T7 DNA polymerase
US4939666A (en) 1987-09-02 1990-07-03 Genex Corporation Incremental macromolecule construction methods
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5130238A (en) 1988-06-24 1992-07-14 Cangene Corporation Enhanced nucleic acid amplification process
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5403484A (en) 1988-09-02 1995-04-04 Protein Engineering Corporation Viruses expressing chimeric binding proteins
US5571698A (en) 1988-09-02 1996-11-05 Protein Engineering Corporation Directed evolution of novel binding proteins
US5837500A (en) 1988-09-02 1998-11-17 Dyax, Corp. Directed evolution of novel binding proteins
US5142033A (en) 1988-09-23 1992-08-25 Hoffmann-La Roche Inc. Structure-independent DNA amplification by the polymerase chain reaction
US5091310A (en) 1988-09-23 1992-02-25 Cetus Corporation Structure-independent dna amplification by the polymerase chain reaction
US5066584A (en) 1988-09-23 1991-11-19 Cetus Corporation Methods for generating single stranded dna by the polymerase chain reaction
US4994370A (en) 1989-01-03 1991-02-19 The United States Of America As Represented By The Department Of Health And Human Services DNA amplification technique
US5266491A (en) 1989-03-14 1993-11-30 Mochida Pharmaceutical Co., Ltd. DNA fragment and expression plasmid containing the DNA fragment
US5658754A (en) 1989-10-05 1997-08-19 Optein, Inc. Cell-free synthesis and isolation of novel genes and polypeptides
US5643768A (en) 1989-10-05 1997-07-01 Optein, Inc. Cell-free synthesis and isolation of novel genes and polypeptides
US5580717A (en) 1990-05-01 1996-12-03 Affymax Technologies N.V. Recombinant library screening methods
US5427908A (en) 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1991018980A1 (en) 1990-06-01 1991-12-12 Cetus Corporation Compositions and methods for identifying biologically active molecules
WO1991019818A1 (en) 1990-06-20 1991-12-26 Affymax Technologies N.V. Peptide library and screening systems
US5580734A (en) 1990-07-13 1996-12-03 Transkaryotic Therapies, Inc. Method of producing a physical map contigous DNA sequences
WO1992005258A1 (en) 1990-09-20 1992-04-02 La Trobe University Gene encoding barley enzyme
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
WO1992014843A1 (en) 1991-02-21 1992-09-03 Gilead Sciences, Inc. Aptamer specific for biomolecules and method of making
WO1993008278A1 (en) 1991-10-16 1993-04-29 Affymax Technologies N.V. Peptide library and screening method
US5641670A (en) 1991-11-05 1997-06-24 Transkaryotic Therapies, Inc. Protein production and protein delivery
US5733761A (en) 1991-11-05 1998-03-31 Transkaryotic Therapies, Inc. Protein production and protein delivery
US5885793A (en) 1991-12-02 1999-03-23 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US5839446A (en) 1992-10-28 1998-11-24 Transmedica International, Inc. Laser perforator
US5856456A (en) 1992-11-20 1999-01-05 Enzon, Inc. Linker for linked fusion polypeptides
US5767260A (en) 1994-10-13 1998-06-16 Enzon Inc. Antigen-binding fusion proteins
US5763733A (en) 1994-10-13 1998-06-09 Enzon, Inc. Antigen-binding fusion proteins
WO1996019256A1 (en) 1994-12-22 1996-06-27 Advanced Cardiovascular Systems, Inc. Adjustable length balloon catheter
US5656730A (en) 1995-04-07 1997-08-12 Enzon, Inc. Stabilized monomeric protein compositions
US6019968A (en) 1995-04-14 2000-02-01 Inhale Therapeutic Systems, Inc. Dispersible antibody compositions and methods for their preparation and use
US5851198A (en) 1995-10-10 1998-12-22 Visionary Medical Products Corporation Gas pressured needle-less injection device and method
WO1998053847A1 (en) 1997-05-29 1998-12-03 Ben Gurion University Of The Negev Research And Development Authority Transdermal delivery system
WO1999016419A1 (en) 1997-09-29 1999-04-08 Inhale Therapeutic Systems, Inc. Perforated microparticles and methods of use
US9228180B2 (en) 2007-07-04 2016-01-05 Max-Delbruck-Centrum Fur Molekulare Medizin Polypeptide variants of sleeping beauty transposase
US10041077B2 (en) 2014-04-09 2018-08-07 Dna2.0, Inc. DNA vectors, transposons and transposases for eukaryotic genome modification

Non-Patent Citations (57)

* Cited by examiner, † Cited by third party
Title
"GenBank", Database accession no. AAA87375
"GenBank", Database accession no. AAL39784
"GenBank", Database accession no. AB179012
"GenBank", Database accession no. ABD76335
"GenBank", Database accession no. ABS18391
"GenBank", Database accession no. BAD11135
"GenBank", Database accession no. BAF82026
"GenBank", Database accession no. EU287451
"GenBank", Database accession no. GU270322
"GenBank", Database accession no. GU329918
"GenBank", Database accession no. GU477713
"GenBank", Database accession no. GU477714
"GenBank", Database accession no. JX294476
"GenBank", Database accession no. NP_689808
"GenBank", Database accession no. NP_741958
"GenBank", Database accession no. XP_001814566
"GenBank", Database accession no. XP_001948139
"GenBank", Database accession no. XP_002123602
"GenBank", Database accession no. XP_220453
"GenBank", Database accession no. XP_310729
"GenBank", Database accession no. XP_312615
"GenBank", Database accession no. XP_320414
"Nursing 2001 Handbook of Drugs, 21st edition", 2001, SPRINGHOUSE CORP.
"PDR Pharmacopoeia, Tarascon Pocket Pharmacopoeia 2000", 2000, TARASCON PUBLISHING
A. OSOL: "Remington's Pharmaceutical Sciences", MACK PUBLISHING
ALBERTS, B. ET AL.: "Molecular Biology of The Cell, Third Ed.,", 1994, GARLAND PUBLISHING, INC.
ARCONE ET AL., NUCL. ACIDS RES., vol. 16, no. 8, 1988, pages 3195 - 3207
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1987, JOHN WILEY & SONS, INC.
BERZOFSKY ET AL.: "Fundamental Immunology", 1984, RAVEN PRESS, article "Antibody-Antigen Interactions"
BOJAK, A. ET AL., VACCINE, vol. 20, 2002, pages 1975 - 79
CAZEAUX, N. ET AL., VACCINE, vol. 20, 2002, pages 3322 - 31
COLLIGAN ET AL.: "Current Protocols in Protein Science", 1997, JOHN WILEY & SONS
COLLIGAN, ET AL.,: "Current Protocols in immunology", 1994, JOHN WILEY & SONS, INC.
CUNNINGHAM; WELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085
DE VOS ET AL., SCIENCE, vol. 255, 1992, pages 306 - 312
DONNELLY, J. J. ET AL., ANNU. REV. IMMUNOL., vol. 15, 1997, pages 617 - 48
GOSSEN ET AL., SCIENCE, vol. 268, 1995, pages 1766 - 1769
GOSSEN; BUJARD, PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 5547 - 5551
HARLOW; LANE: "Antibodies, a Laboratory Manual", 1989
INNIS ET AL.: "PCR Protocols A Guide to Methods and Applications", 1990, ACADEMIC PRESS INC.
IULIUCCI J D ET AL., J CLIN PHARMACOL., vol. 41, 2001, pages 870 - 9
JUNGINGER ET AL.: "Drug Permeation Enhancement", 1994, MARCEL DEKKER, INC., pages: 59 - 90
KAGEYAMA ET AL., J. BIOL. CHEM., vol. 262, 1987, pages 2345 - 2351
KUBY; JANIS: "Immunology", 1992, W.H. FREEMAN AND COMPANY
OLIVIERO ET AL., EMBO J., vol. 6, 1987, pages 1905 - 1912
PHILIP B ET AL., BLOOD, vol. 124, no. 8, 21 August 2014 (2014-08-21), pages 1277 - 87
POLI; CORTESE, PROC. NAT'L ACAD. SCI. USA, vol. 86, 1989, pages 8202 - 8206
PROWSE; BAUMANN, MOL CELL BIOL, vol. 8, 1988, pages 42 - 51
RON ET AL., MOL. CELL. BIOL., 1991, pages 2887 - 2895
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual, 2nd Edition,", 1989, COLD SPRING HARBOR
See also references of EP3679145A2
SHANNON, WILSON, STANG: "Health Professional's Drug Guide 2001", PRENTICE-HALL, INC
SMITH ET AL., J. MOL. BIOL., vol. 224, 1992, pages 899 - 904
SPRAGUE ET AL., J. VIROL., vol. 45, 1983, pages 773 - 781
WELLS ET AL.,: "Pharmacotherapy Handbook, 2nd Edition,", 2000, APPLETON AND LANGE
WILSON ET AL., MOL. CELL. BIOL., 1990, pages 6181 - 6191
ZECHNER ET AL., MOL. CELL. BIOL., 1988, pages 2394 - 2401

Cited By (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12202856B2 (en) 2016-05-19 2025-01-21 The General Hospital Corporation Tethered interleukin-2 to its receptor IL-2RBETA, a platform to enhance natural killer and regulatory T cell activity
US10961310B2 (en) 2017-03-15 2021-03-30 Pandion Operations, Inc. Targeted immunotolerance
US10676516B2 (en) 2017-05-24 2020-06-09 Pandion Therapeutics, Inc. Targeted immunotolerance
US11466068B2 (en) 2017-05-24 2022-10-11 Pandion Operations, Inc. Targeted immunotolerance
US11965008B2 (en) 2017-12-06 2024-04-23 Pandion Operations, Inc. IL-2 muteins and uses thereof
US11945852B2 (en) 2017-12-06 2024-04-02 Pandion Operations, Inc. IL-2 muteins and uses thereof
US11779632B2 (en) 2017-12-06 2023-10-10 Pandion Operation, Inc. IL-2 muteins and uses thereof
US11091526B2 (en) 2017-12-06 2021-08-17 Pandion Operations, Inc. IL-2 muteins and uses thereof
US11091527B2 (en) 2017-12-06 2021-08-17 Pandion Operations, Inc. IL-2 muteins and uses thereof
US10946068B2 (en) 2017-12-06 2021-03-16 Pandion Operations, Inc. IL-2 muteins and uses thereof
USRE50550E1 (en) 2017-12-06 2025-08-26 Pandion Operations, Inc. IL-2 muteins and uses thereof
US11304978B2 (en) 2019-05-01 2022-04-19 Pact Pharma, Inc. Compositions and methods for the treatment of cancer using a CD8 engineered T cell therapy
US12247061B2 (en) 2019-05-01 2025-03-11 Adoc Ssf, Llc Compositions and methods for the treatment of cancer using a CD8 engineered T cell therapy
WO2020223478A1 (en) * 2019-05-01 2020-11-05 Pact Pharma, Inc. Compositions and methods for the treatment of cancer using a tet2 engineered t cell therapy
CN114072129A (zh) * 2019-05-03 2022-02-18 宾夕法尼亚州大学信托人 可用于治疗异染性脑白质营养不良的组合物
EP3962454A4 (en) * 2019-05-03 2023-05-31 The Trustees of The University of Pennsylvania Compositions useful in treatment of metachromatic leukodystrophy
US11739146B2 (en) 2019-05-20 2023-08-29 Pandion Operations, Inc. MAdCAM targeted immunotolerance
WO2020254694A1 (en) * 2019-06-21 2020-12-24 Medizinische Hochschule Hannover All-in one vector for car and therapeutic effector molecule
EP3753566A1 (en) * 2019-06-21 2020-12-23 Medizinische Hochschule Hannover All-in one viral vector for car and therapeutic effector molecule
US12576110B2 (en) 2019-08-06 2026-03-17 The Children's Medical Center Corporation Methods and compositions for reconstituting microglia
WO2021026294A1 (en) * 2019-08-06 2021-02-11 Children's Medical Center Corporation Methods and compositions for reconstituting microglia
US11672874B2 (en) 2019-09-03 2023-06-13 Myeloid Therapeutics, Inc. Methods and compositions for genomic integration
EP4063379A4 (en) * 2019-12-02 2023-07-26 LG Chem, Ltd. PROTEIN SECRETION FACTOR DERIVED FROM A CHO CELL AND EXPRESSION VECTOR COMPRISING THE SAME
US11981715B2 (en) 2020-02-21 2024-05-14 Pandion Operations, Inc. Tissue targeted immunotolerance with a CD39 effector
WO2021222249A1 (en) * 2020-04-27 2021-11-04 The Trustees Of The University Of Pennsylvania Compositions and methods for reducing nuclease expression and off-target activity using a promoter with low transcriptional activity
WO2021234662A1 (en) * 2020-05-21 2021-11-25 Crispr Therapeutics Ag Genetically engineered car t cells that secrete interleukin-12 and therapeutic uses thereof
EP4197545A4 (en) * 2020-07-31 2025-04-09 Chugai Seiyaku Kabushiki Kaisha Pharmaceutical composition comprising a cell for expressing a chimeric receptor
WO2022226375A1 (en) * 2021-04-23 2022-10-27 Locanabio, Inc. Tissue-targeted modified aav capsids and methods of use thereof
US12064466B2 (en) * 2021-04-27 2024-08-20 Academia Sinica Methods of treating hypertriglyceridemia or hypertriglyceridemia-related diseases
US20220339245A1 (en) * 2021-04-27 2022-10-27 Academia Sinica Methods of treating hypertriglyceridemia or hypertriglyceridemia-related diseases
WO2022232796A1 (en) * 2021-04-28 2022-11-03 The General Hospital Corporation Il2 tethered to its receptor il2rbeta and pore-forming proteins as a platform to enhance immune cell activity
US12319925B2 (en) 2021-05-11 2025-06-03 Myeloid Therapeutics, Inc. Methods and compositions for genomic integration
WO2023004021A3 (en) * 2021-07-23 2023-03-09 The Children's Medical Center Corporation Zinc finger ccch-type containing 14 (zc3h14) mutants and methods of use
WO2024134206A3 (en) * 2022-12-22 2024-09-12 Autolus Limited Chimeric antigen receptor with spacers

Also Published As

Publication number Publication date
EP3679145A2 (en) 2020-07-15
US20210130845A1 (en) 2021-05-06
AU2025203769A9 (en) 2026-03-19
CN111727256A (zh) 2020-09-29
US12385061B2 (en) 2025-08-12
AU2018329741A2 (en) 2020-04-02
WO2019051424A3 (en) 2019-04-11
WO2019051424A9 (en) 2019-05-23
AU2018329741B2 (en) 2025-02-20
CA3072777A1 (en) 2019-03-14
JP2024109657A (ja) 2024-08-14
AU2018329741A1 (en) 2020-03-19
JP2020532987A (ja) 2020-11-19
AU2025203769A1 (en) 2025-06-12

Similar Documents

Publication Publication Date Title
US12385061B2 (en) Compositions and methods for chimeric ligand receptor (CLR)-mediated conditional gene expression
US12415844B2 (en) BCMA specific VCAR compositions and methods for use
US20220389077A1 (en) Allogeneic cell compositions and methods of use
US20210107993A1 (en) Cartyrin compositions and methods for use
AU2022235633B2 (en) Modified stem cell memory T cells, methods of making and methods of using same
US11802269B2 (en) Superpiggybac transposase compositions
US20210115453A1 (en) Transposon system and methods of use
US10329543B2 (en) Modified stem cell memory T cells, methods of making and methods of using same
US12447213B2 (en) Modulation of novel immune checkpoint targets
US20210171943A1 (en) Compositions and methods for treating disorders of genomic imprinting
CN117337326A (zh) 工程化的Cas12i核酸酶、效应蛋白及其用途
US20240318136A1 (en) Modified stem cell memory t cells, methods of making and methods of using same
WO2022062440A1 (zh) 靶向CTGF基因的gRNA及其应用
US20260125700A1 (en) Compositions and methods for chimeric ligand receptor (clr)-mediated conditional gene expression
US20260125701A1 (en) Compositions and methods for chimeric ligand receptor (clr)-mediated conditional gene expression
RU2820591C2 (ru) Композиции vcar и способы применения
US20250268938A1 (en) Small molecule-regulated cell signaling expression system

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18800779

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3072777

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020513604

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018329741

Country of ref document: AU

Date of ref document: 20180910

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018800779

Country of ref document: EP

Effective date: 20200408

WWG Wipo information: grant in national office

Ref document number: 16640788

Country of ref document: US