WO2019016402A1 - BINDING PROTEINS BINDING AT 5T4 AND 4-1BB, COMPOSITIONS AND METHODS RELATED THERETO - Google Patents

BINDING PROTEINS BINDING AT 5T4 AND 4-1BB, COMPOSITIONS AND METHODS RELATED THERETO Download PDF

Info

Publication number
WO2019016402A1
WO2019016402A1 PCT/EP2018/069850 EP2018069850W WO2019016402A1 WO 2019016402 A1 WO2019016402 A1 WO 2019016402A1 EP 2018069850 W EP2018069850 W EP 2018069850W WO 2019016402 A1 WO2019016402 A1 WO 2019016402A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
acid sequence
chain variable
variable region
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2018/069850
Other languages
English (en)
French (fr)
Inventor
David BIENVENUE
Gabriela HERNANDEZ-HOYOS
Lynda Misher
Danielle MITCHELL
Sara Fritzell
Laura Varas
Peter Ellmark
Anna Sall
Christina Furebring
Laura Von Schantz
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Alligator Bioscience AB
Aptevo Research and Development LLC
Original Assignee
Alligator Bioscience AB
Aptevo Research and Development LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to RU2020102289A priority Critical patent/RU2804458C2/ru
Priority to KR1020207004833A priority patent/KR102649757B1/ko
Priority to NZ761636A priority patent/NZ761636A/en
Priority to CN201880060362.6A priority patent/CN111148763B/zh
Priority to IL272103A priority patent/IL272103B2/en
Priority to BR112020001180-0A priority patent/BR112020001180A2/pt
Priority to EP18750355.2A priority patent/EP3655439A1/en
Priority to US16/632,144 priority patent/US11725060B2/en
Priority to SG11202000503QA priority patent/SG11202000503QA/en
Priority to MX2020000583A priority patent/MX2020000583A/es
Priority to AU2018304585A priority patent/AU2018304585B2/en
Priority to JP2020503056A priority patent/JP7369113B2/ja
Application filed by Alligator Bioscience AB, Aptevo Research and Development LLC filed Critical Alligator Bioscience AB
Priority to CA3070272A priority patent/CA3070272A1/en
Publication of WO2019016402A1 publication Critical patent/WO2019016402A1/en
Priority to PH12020500137A priority patent/PH12020500137A1/en
Anticipated expiration legal-status Critical
Priority to CONC2020/0001654A priority patent/CO2020001654A2/es
Priority to ZA2020/00961A priority patent/ZA202000961B/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5152Tumor cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/64Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/72Increased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/10Cells modified by introduction of foreign genetic material

Definitions

  • the present disclosure relates to molecules that specifically bind to trophoblast glycoprotein (5T4).
  • the molecules may have at least one humanized 5T4-binding domain. These molecules are useful for the characterization or treatment of disorders characterized by expression of 5T4, such as cancer.
  • a protein therapeutic binding to 5T4 may be a monospecific protein therapeutic or a multispecific protein therapeutic.
  • the disclosure also relates to protein therapeutics that specifically bind to tumor necrosis factor receptor superfamily member 9 (4- IBB or CD137).
  • a multispecific protein therapeutic may bind both 5T4-expressing cells and 4-1BB expressed on effector cells to enhance effector cell activation, proliferation, and/or effector-cell mediated cytotoxicity.
  • 5T4 also designated trophoblast glycoprotein, TPBG, M6P 1 and Waifl
  • TAA tumor-associated antigen
  • IBB also known as CD 137 or TNFRSF9
  • TNFRSF9 tumor necrosis factor
  • TNF tumor endothelial growth factor receptor
  • 4- IBB is expressed on various cell populations including activated CD4 + and CD8 + T cells, regulatory T cells (Treg), dendritic cells (DC), monocytes, mast cells, eosinophils and tumor endothelial cells.
  • Treg regulatory T cells
  • DC dendritic cells
  • monocytes monocytes
  • mast cells eosinophils
  • tumor endothelial cells Activation of 4- IBB is dependent on receptor oligomerization (Rabu et al, 2005; Wyzgol et al., 2009) induced by binding to 4- 1BBL (also known as CD137L), which is expressed as a trimer on the cell surface of antigen presenting cells (APCs) and other cell types.
  • APCs antigen presenting cells
  • 4-lBB activation on CD8 + T cells sustains and augments CD8 + T cell effector functions and preferentially supports Thl cytokine production (Shuford et al, 1997; Lee et al, 2002; Pulle et al, 2006).
  • 4-lBB activation on CD4 + T cells 4- 1 BB stimulation initially results in activation and later in activation-induced cell death, which is thought to explain why 4- IBB agonistic antibodies have shown therapeutic effect in tumor immunity as well as in autoimmunity (Zhang, JCI, 2007; Sun, Trends Mol Med, 2003).
  • 4- IBB activation has also been reported to suppress Treg function or convert Tregs to cytotoxic CD4 + T- cells (Akhmetzyanova et al, 2016; So et al, 2008).
  • NK 1BB is upregulated on CD16- and cytokine-activated natural killer (NK) cells.
  • Activation of 4- 1BB has been shown to increase antibody-dependent cellular cytotoxicity (ADCC) activity of NK cells in both murine and human cells (Kohrt 2012 and 2014 J Clin Invest, reviewed by Hout 2012, Oncoimm).
  • ADCC antibody-dependent cellular cytotoxicity
  • 4-lBB expressed on APCs, such as DCs and macrophages may also induce and/or modulate immune activation.
  • the disclosure relates to multispecific polypeptides that specifically bind to 5T4 and/or 4-lBB.
  • a 5T4-binding domain of the disclosure binds to an extracellular domain of human 5T4.
  • a 4-1BB- binding domain of the disclosure binds to an extracellular domain of human 4-lBB.
  • the disclosure provides a multispecific polypeptide comprising a 5T4-binding domain that specifically binds to human 5T4 and a 4-lBB-binding domain, wherein said 5T4- binding domain comprises: (i) an immunoglobulin heavy chain variable region comprising HCDR1 , HCDR2, and HCDR3, and (ii) an immunoglobulin light chain variable region comprising LCDRl, LCDR2, and LCDR3, wherein (a) the HCDR1 comprises an amino acid sequence of SEQ ID NO: 30; (b) the HCDR2 comprises an amino acid sequence of SEQ ID NO: 32; (c) the HCDR3 comprises an amino acid sequence of SEQ ID NO: 34; (d) the LCDRl comprises an amino acid sequence of SEQ ID NO: 42; (e) the LCDR2 comprises an amino acid sequence of SEQ ID NO: 10; and (f) the LCDR3 comprises an amino acid sequence of SEQ ID NO: 36.
  • the 5T4-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to a sequence selected from the group consisting of SEQ ID NOs: 38 and 46. In certain embodiments, the 5T4-binding domain comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 38 and 46.
  • the 5T4-binding domain comprising the CDR sequences recited above comprises a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to a sequence selected from the group consisting of SEQ ID NOs: 44, 48, and 50. In some embodiments, the 5T4-binding domain comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 44, 48, and 50.
  • the 5T4-binding domain comprising the CDR sequences recited above comprises i) a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 38 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 44; or ii) a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 48; or iii) a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 5.
  • the 5T4-binding domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 38 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 44; or ii) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 48; or iii) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 50.
  • the disclosure includes a multispecific polypeptide comprising a 5T4-binding domain that specifically binds to human 5T4 and a 4-lBB-binding domain that specifically binds to human 4-1BB, wherein each of the 4-lBB-binding domain and 5T4 binding domain comprise (i) an immunoglobulin heavy chain variable region (VH) comprising HCDR1 , HCDR2, and HCDR3; and (ii) an immunoglobulin light chain variable region (VL) comprising LCDRl , LCDR2, and LCDR3, wherein the VH and/or the VL region of the 5T4- binding domain comprise one or more mutations in the framework region; and wherein the 5T4- binding domain comprises (a) the HCDR1 comprising an amino acid sequence of SEQ ID NO: 30; (b) the HCDR2 comprising an amino acid sequence of SEQ ID NO: 32; (c) the HCDR3 comprising an amino acid sequence of SEQ ID NO: 34; (d
  • the 5T4-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NOs: 38. In one embodiment, the 5T4-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 38. In some embodiments, the 5T4-binding domain comprising the CDR sequences recited above comprises a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 40. In certain embodiments, the 5T4-binding domain comprises a light chain variable region comprising an amino acid sequence of SEQ ID NO: 40.
  • the 5T4-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 38 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 40.
  • 5T4-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 38 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 40.
  • the disclosure further provides a multispecific polypeptide comprising a
  • each of the 4-lBB-binding domain and 5T4 binding domain comprise (i) an immunoglobulin heavy chain variable region (VH) comprising HCDR1, HCDR2, and HCDR3; and (ii) an immunoglobulin light chain variable region (VL) comprising LCDRl , LCDR2, and LCDR3, wherein the VH and/or the VL region of the 4-1 BB-binding domain comprise one or more mutations in the framework region; and wherein the 5T4-binding domain comprises (a) the HCDR1 comprising an amino acid sequence of SEQ ID NO: 30; (b) the HCDR2 comprising an amino acid sequence of SEQ ID NO: 32; c) the HCDR3 comprising an amino acid sequence of SEQ ID NO: 34; (d) the LCDR1 comprising an amino acid sequence of SEQ ID NO: 42; (
  • the 5T4-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to a sequence selected from the group consisting of SEQ ID NOs: 38 and 46. In certain embodiments, the 5T4-binding domain comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 38 and 46.
  • the 5T4-binding domain comprising the CDR sequences recited above comprises a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to a sequence selected from the group consisting of SEQ ID NOs: 44, 48, and 50. In some aspects, the 5T4-binding domain comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 44, 48, and 50.
  • the 5T4-binding domain comprising the CDR sequences recited above comprises i) a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 38 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 44; or ii) a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 48; or iii) a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 50.
  • the 5T4-binding domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 38 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 44; or ii) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 48; or iii) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 50.
  • the disclosure provides a multispecific polypeptide comprising a 5T4-binding domain that specifically binds to human 5T4 and a 4-lBB-binding domain that specifically binds to human 4-lBB, wherein each of the 4-lBB-binding domain and 5T4 binding domain comprise (i) an immunoglobulin heavy chain variable region (VH) comprising HCDR1 , HCDR2, and HCDR3; and (ii) an immunoglobulin light chain variable region (VL) comprising LCDRl , LCDR2, and LCDR3, wherein the VH and/or the VL region of the 4- 1BB -binding domain comprise one or more mutations in the framework region; and wherein the 5T4-binding domain comprises (a) the HCDR1 comprising an amino acid sequence of SEQ ID NO: 52; (b) the HCDR2 comprising an amino acid sequence of SEQ ID NO: 32; (c) the HCDR3 comprising an amino acid sequence of SEQ ID NO: 34
  • the 5T4-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 56. In some aspects, the 5T4-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 56. In certain embodiments, the 5T4-binding domain comprising the CDR sequences recited above comprises a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NOs: 58.
  • the 5T4-binding domain comprises a light chain variable region comprising an amino acid sequence of SEQ ID NOs: 58.
  • the 5T4-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 56 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 58.
  • the 5T4-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 56 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 58.
  • the disclosure also provides a multispecific polypeptide comprising a 5T4- binding domain that specifically binds to human 5T4 and a4-lBB-binding domain that specifically binds to human 4-lBB, wherein each of the 4-lBB-binding domain and 5T4 binding domain comprise (i) an immunoglobulin heavy chain variable region (VH) comprising HCDR1, HCDR2, and HCDR3; and (ii) an immunoglobulin light chain variable region (VL) comprising LCDR1, LCDR2, and LCDR3, wherein the VH and/or the VL region of the 4-lBB-binding domain comprise one or more mutations in the framework region; and wherein the 5T4-binding domain comprises (a) the HCDR1 comprising an amino acid sequence of SEQ ID NO: 60; (b) the HCDR2 comprising an amino acid sequence of SEQ ID NO: 62; (c) the HCDR3 comprising an amino acid sequence of SEQ ID NO: 34; (d) the LCDR
  • the 5T4-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 64. In some embodiments, the 5T4-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 64. In certain aspects, the 5T4-binding domain comprising the CDR sequences recited above comprises a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NOs: 58.
  • the 5T4-binding domain comprises a light chain variable region comprising an amino acid sequence of SEQ ID NOs: 58.
  • the 5T4- binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 64 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 58.
  • the 5T4-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 64 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 58.
  • the disclosure provides a multispecific polypeptide comprising a 4-lBB-binding domain that specifically binds to human 4-lBB.
  • the disclosure also provides a multispecific polypeptide comprising a 4-lBB-binding domain and a 5T4-binding domain, wherein the 4-lBB-binding domain is linked to the 5T4-binding domain via a binding domain linker.
  • a multispecific polypeptide comprises, from amino- terminus to carboxyl-terminus, (i) a 5T4-binding domain, (ii) a binding domain linker, and (iii) a 4-lBB-binding domain.
  • the 5T4-binding domain is a single chain variable fragment (scFv).
  • the light chain variable region of said scFv is carboxy- terminal to the heavy chain variable region of said scFv.
  • the light chain variable region of said scFv is amino-terminal to the heavy chain variable region of said scFv.
  • the scFv comprises a linker polypeptide.
  • the linker polypeptide is between the light chain variable region and the heavy chain variable region of said scFv.
  • the linker polypeptide comprises a Gly4Ser linker.
  • an scFv comprising the CDR sequences recited above comprises a sequence having at least 80%, at least 85%, at least 90%, or at least 95% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 18, 120, 122, 124, 126, 128, 130, 132, 134, and 170.
  • an scFv comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 18, 120, 122, 124, 126, 128, 130, 132, 134, and 170.
  • the disclosure provides a multispecific polypeptide comprising a 4-lBB-binding domain that specifically binds to human 4- IBB and a 5T4-binding domain, wherein said 4-lBB-binding domain comprises: (i) an immunoglobulin heavy chain variable region (VH) comprising HCDR1 , HCDR2, and HCDR3, and (ii) an immunoglobulin light chain variable region (VL) comprising LCDR1, LCDR2, and LCDR3, wherein (a) the HCDR1 comprises an amino acid sequence of SEQ ID NO: 2; (b) the HCDR2 comprises an amino acid sequence of SEQ ID NO: 4; (c) the HCDR3 comprises an amino acid sequence of SEQ ID NO: 6; (d) the LCDR1 comprises an amino acid sequence of SEQ ID NO: 8; (e) the LCDR2 comprises an amino acid sequence of SEQ ID NO: 10; and (f) the LCDR3 comprises an amino acid sequence of SEQ ID NO: 12.
  • VH immunoglobulin heavy chain variable region
  • the 4-lBB-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 14.
  • the 4-1 BB-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 14.
  • the 4-lBB-binding domain comprising the CDR sequences recited above comprises a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 16.
  • the 4-lBB-binding domain comprises a light chain variable region comprising an amino acid sequence of SEQ ID NO: 16.
  • the 4-1BB- binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 14 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 16.
  • the 4-1 BB-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 14 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 16.
  • the disclosure further provides a multispecific polypeptide comprising a
  • the 4-lBB-binding domain comprises (i) an immunoglobulin heavy chain variable region (VH) comprising HCDR1 , HCDR2, and HCDR3; and (ii) an immunoglobulin light chain variable region (VL) comprising LCDRl, LCDR2, and LCDR3, and wherein the VH and/or the VL region of the 4-1 BB-binding domain comprise one or more mutations in the framework region, and wherein the 4-lBB-binding domain comprises (a) the HCDR1 comprising an amino acid sequence of SEQ ID NO: 18; (b) the HCDR2 comprising an amino acid sequence of SEQ ID NO: 4; (c) the HCDR3 comprising an amino acid sequence of SEQ ID NO: 6; (d) the LCDRl comprising an amino acid sequence of SEQ ID NO: 8; (e) the LCDR2 comprising an amino acid sequence of SEQ ID
  • the 4-1 BB-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 20. In some embodiments, the 4-1 BB-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 20. In certain embodiments, the 4-1 BB-binding domain comprising the CDR sequences recited above comprises a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 22.
  • the 4-lBB-binding domain comprises a light chain variable region comprising an amino acid sequence of SEQ ID NO: 22.
  • the 4-lBB-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 20 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 22.
  • the 4-lBB-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 20 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 22.
  • the disclosure also provides a multispecific polypeptide comprising a 5T4- binding domain that specifically binds to human 5T4 and a 4-1 BB-binding domain, wherein the 4-1 BB-binding domain comprises (i) an immunoglobulin heavy chain variable region (V H ) comprising HCDR1 , HCDR2, and HCDR3; and (ii) an immunoglobulin light chain variable region (VL) comprising LCDRl , LCDR2, and LCDR3, and wherein the VH and/or the VL region of the 4- 1 BB-binding domain comprise one or more mutations in the framework region, and wherein the 4-lBB-binding domain comprises (a) the HCDR1 comprising an amino acid sequence of SEQ ID NO: 24; (b) the HCDR2 comprising an amino acid sequence of SEQ ID NO: 4; (c) the HCDR3 comprising an amino acid sequence of SEQ ID NO: 6; (d) the LCDRl comprising an amino acid sequence of SEQ ID
  • the 4-1 BB-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 26. In some embodiments, the 4-1 BB-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 26. In certain embodiments, the 4-1 BB-binding domain comprising the CDR sequences recited above comprises a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 16. In some embodiments, the 4-lBB-binding domain comprises a light chain variable region comprising an amino acid sequence of SEQ ID NO: 16.
  • the 4-lBB-binding domain comprising the CDR sequences recited above comprises a heavy chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 26 and a light chain variable region comprising an amino acid sequence having at least 90%, at least 95%, or at least 97% identity to SEQ ID NO: 16.
  • the 4-lBB-binding domain comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 26 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 16.
  • the disclosure provides a multispecific polypeptide comprising a 4-1 BB-binding domain wherein the 4-lBB-binding domain is a single chain variable fragment (scFv).
  • the light chain variable region of said scFv is carboxy-terminal to the heavy chain variable region of said scFv.
  • the light chain variable region of said scFv is amino -terminal to the heavy chain variable region of said scFv.
  • the scFv comprises a linker polypeptide.
  • the linker polypeptide is between the light chain variable region and the heavy chain variable region of said scFv.
  • a multispecific polypeptide comprises, from amino- terminus to carboxyl-terminus, (i) the 5T4-binding domain, (ii) a binding domain linker, and (iii) the 4-1 BB-binding domain.
  • the 4-1 BB-binding domain comprising the CDR sequences recited above comprises a sequence having at least 80%, at least 85%, at least 90%, or at least 95% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 10, 1 12, 1 14, and 1 16.
  • the 4-lBB-binding domain comprises a sequence selected from the group consisting of SEQ ID NOs: 1 10, 1 12, 114, and 116.
  • a multispecific polypeptide of the disclosure comprises a
  • the disclosure further provides a multispecific polypeptide comprising a
  • an immunoglobulin constant region may be a human Fc domain.
  • the human Fc domain comprises a sequence set forth in SEQ ID NO: 158 or SEQ ID NO: 160.
  • the disclosure provides a multispecific polypeptide that comprises, from amino- terminus to carboxyl-terminus, (i) a 5T4-binding domain, (ii) a hinge region, (iii) an immunoglobulin constant region, (iv) a binding domain linker, and (v) a 4-lBB-binding domain.
  • the binding domain linker comprises a GlyiSer sequence.
  • the disclosure also provides a multispecific polypeptide comprising a first scFv domain and a second scFv domain, wherein the first and second scFv domains are linked together by a binding domain linker or a binding domain linker and an immunoglobulin Fc domain, wherein the immunoglobulin Fc domain comprises a hinge region and an immunoglobulin constant region; and wherein the second scFv domain specifically binds to human 4-1 BB and comprises: (i) an immunoglobulin heavy chain variable region comprising an HCDR1 amino acid sequence selected from the group consisting of SEQ ID NOs: 2, 18, 24, an HCDR2 amino acid sequence of SEQ ID NO: 4, and an HCDR3 amino acid sequence of SEQ ID NOs: 6; and (ii) an immunoglobulin light chain variable region comprising an LCDR1 amino acid sequence of SEQ ID NOs: 8, an LCDR2 amino acid sequence of SEQ ID NO: 10, and an LCDR3 amino acid sequence of S
  • this polypeptide comprises an amino acid sequence comprising at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, and 156. In some aspects, the polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, and 156. In some embodiments, the polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 136, 138, and 146.
  • the multispecific polypeptide comprises, from amino -terminus to carboxyl-terminus, (i) the first scFv domain, (ii) a binding domain linker, and (iii) the second binding domain. In other embodiments, the multispecific polypeptide comprises, from amino -terminus to carboxyl-terminus, (i) the second scFv domain, (ii) a binding domain linker, and (iii) the first scFv domain.
  • the multispecific polypeptide comprises, from amino -terminus to carboxyl-terminus, (i) the first scFv domain, (ii) a hinge region, (iii) an immunoglobulin constant region, (iv) a binding domain linker, and (v) the second scFv domain.
  • the binding domain linker comprises a GlyiSer sequence.
  • the binding domain linker comprises an amino acid sequence selected from SEQ ID NOs: 85-108.
  • the binding domain linker comprises an amino acid sequence set forth in SEQ ID NO: 107 (SGGGGSGGGGSGGGGSPS).
  • the second scFv domain of a multispecific polypeptide comprises: (a) the HCDR1 amino acid sequence set forth in SEQ ID NO: 2; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 4; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 6; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 8; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 12.
  • the second scFv domain of a multispecific polypeptide comprises: (a) the HCDR1 amino acid sequence set forth in SEQ ID NO: 24; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 4; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 6; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 8; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 12.
  • the second scFv domain of a multispecific polypeptide comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 14 and a light chain variable region of SEQ ID NO: 16. In other embodiments, the second scFv domain of a multispecific polypeptide comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 20 and a light chain variable region of SEQ ID NO: 22. In some embodiments, the second scFv domain of a multispecific polypeptide comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 26 and a light chain variable region of SEQ ID NO: 16. In other embodiments, the second scFv domain of a multispecific polypeptide comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 28 and a light chain variable region of SEQ ID NO: 16.
  • the disclosure further provides a multispecific polypeptide comprising a first scFv domain and a second scFv domain, wherein the first and second scFv domains are linked together by a binding domain linker or a binding domain linker and an immunoglobulin Fc domain, wherein the immunoglobulin Fc domain comprises a hinge region and an immunoglobulin constant region; wherein the second scFv domain specifically binds to human 4- IBB; and wherein the first scFv domain comprises (i) an immunoglobulin heavy chain variable region comprising an HCDR1 amino acid sequence selected from the group consisting of SEQ ID NOs: 30, 52, and 60, an HCDR2 amino acid sequence selected from the group consisting of SEQ ID NOs: 32 and 62, and an HCDR3 amino acid sequence of SEQ ID NO: 34; and (ii) an immunoglobulin light chain variable region comprising an LCDR1 amino acid sequence selected from the group consisting of SEQ ID NOs: 8, 42
  • the second scFv domain comprises (a) the HCDR1 amino acid sequence set forth in SEQ ID NO: 2; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 4; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 6; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 8; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 12.
  • the first scFv domain comprises: (a) the HCDR1 amino acid sequence set forth in SEQ ID NO: 30; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 32; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 8; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 36.
  • the first scFv domain comprises: (a) the HCDRl amino acid sequence set forth in SEQ ID NO: 30; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 32; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 42; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 36.
  • the first scFv domain comprises: (a) the HCDRl amino acid sequence set forth in SEQ ID NO: 30; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 32; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 42; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 36.
  • the first scFv domain comprises: (a) the HCDRl amino acid sequence set forth in SEQ ID NO: 52; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 32; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 54; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 36.
  • the first scFv domain comprises: (a) the HCDRl amino acid sequence set forth in SEQ ID NO: 60; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 62; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 54; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 36.
  • the second scFv domain comprises: (a) the HCDRl amino acid sequence set forth in SEQ ID NO: 18; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 4; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 6; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 8; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 12.
  • the first scFv domain comprises: (a) the HCDRl amino acid sequence set forth in SEQ ID NO: 30; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 32; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 42; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 36.
  • the second scFv domain comprises: (a) the HCDRl amino acid sequence set forth in SEQ ID NO: 24; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 4; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 6; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 8; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 12.
  • the first scFv domain comprises: (a) the HCDRl amino acid sequence set forth in SEQ ID NO: 52; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 32; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 54; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 36.
  • the second scFv domain comprises: (a) the HCDRl amino acid sequence set forth in SEQ ID NO: 24; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 4; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 6; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 8; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 amino acid sequence set forth in SEQ ID NO: 12, and, optionally, the first scFv domain comprises: (a) the HCDRl amino acid sequence set forth in SEQ ID NO: 30; (b) the HCDR2 amino acid sequence set forth in SEQ ID NO: 32; (c) the HCDR3 amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDR1 amino acid sequence set forth in SEQ ID NO: 8; (e) the LCDR2 amino acid sequence set forth in SEQ ID NO: 10
  • the disclosure also provides a multispecific polypeptide wherein a first scFv domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 38 and a light chain variable region comprising an amino acid of SEQ ID NO: 40, and wherein a second scFv domain comprises ii) a heavy chain variable region comprising an amino acid of SEQ ID NO: 14 and a light chain variable region of SEQ ID NO: 16.
  • the first scFv domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 38 and a light chain variable region comprising an amino acid of SEQ ID NO: 44
  • the second scFv domain comprises ii) a heavy chain variable region comprising an amino acid of SEQ ID NO: 14 and a light chain variable region of SEQ ID NO: 16.
  • the first scFv domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising an amino acid of SEQ ID NO: 48
  • the second scFv domain comprises ii) a heavy chain variable region comprising an amino acid of SEQ ID NO: 14 and a light chain variable region of SEQ ID NO: 16.
  • the first scFv domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 56 and a light chain variable region comprising an amino acid of SEQ ID NO: 58
  • the second scFv domain comprises ii) a heavy chain variable region comprising an amino acid of SEQ ID NO: 14 and a light chain variable region of SEQ ID NO: 16.
  • the first scFv domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 64 and a light chain variable region comprising an amino acid of SEQ ID NO: 58
  • the second scFv domain comprises ii) a heavy chain variable region comprising an amino acid of SEQ ID NO: 14 and a light chain variable region of SEQ ID NO: 16.
  • the first scFv domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising an amino acid of SEQ ID NO: 50
  • the second scFv domain comprises ii) a heavy chain variable region comprising an amino acid of SEQ ID NO: 20 and a light chain variable region of SEQ ID NO: 22.
  • the first scFv domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 56 and a light chain variable region comprising an amino acid of SEQ ID NO: 58
  • the second scFv domain comprises ii) a heavy chain variable region comprising an amino acid of SEQ ID NO: 26 and a light chain variable region of SEQ ID NO: 16.
  • the first scFv domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 38 and a light chain variable region comprising an amino acid of SEQ ID NO: 68
  • the second scFv domain comprises ii) a heavy chain variable region comprising an amino acid of SEQ ID NO: 28 and a light chain variable region of SEQ ID NO: 16.
  • the first scFv domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising an amino acid of SEQ ID NO: 70
  • the second scFv domain comprises ii) a heavy chain variable region comprising an amino acid of SEQ ID NO: 28 and a light chain variable region of SEQ ID NO: 16.
  • the present disclosure provides a multispecific polypeptide comprising a first scFv domain and a second scFv domain, wherein the first and second scFv domains are linked together by a binding domain linker or a binding domain linker and an immunoglobulin Fc domain, wherein the immunoglobulin Fc domain comprises a hinge region and an immunoglobulin constant region; and wherein the first scFv domain specifically binds to human 5T4 and comprises: (i) an immunoglobulin heavy chain variable region comprising an HCDR1 amino acid sequence of SEQ ID NO: 30, an HCDR2 amino acid sequence of SEQ ID NO: 32, and an HCDR3 amino acid sequence of SEQ ID NO: 34; and (ii) an immunoglobulin light chain variable region comprising an LCDR1 amino acid sequence of SEQ ID NO: 42, an LCDR2 amino acid sequence of SEQ ID NO: 10, and an LCDR3 amino acid sequence of SEQ ID NO: 36.
  • the first scFv domain comprises: i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 38 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 44; or ii) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 48; or iii) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 50.
  • the present disclosure provides a multispecific polypeptide comprising a first scFv domain and a second scFv domain, wherein the first and second scFv domains are linked together by a binding domain linker or a binding domain linker and an immunoglobulin Fc domain, wherein the immunoglobulin Fc domain comprises a hinge region and an immunoglobulin constant region; and wherein the first scFv domain specifically binds to human 5T4, wherein the VH and/or the VL region of the second scFv domain comprise one or more mutations in the framework region; and wherein the first scFv domain comprises: (a) the HCDR1 comprising an amino acid sequence of SEQ ID NO: 30; (b) the HCDR2 comprising an amino acid sequence of SEQ ID NO: 32; (c) the HCDR3 comprising an amino acid sequence of SEQ ID NO: 34; (d) the LCDR1 comprising an amino acid sequence of SEQ ID NO:
  • the first scFv domain comprises i) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 38 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 44; or ii) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 48; or iii) a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 46 and a light chain variable region comprising an amino acid sequence of SEQ ID NO: 50.
  • the multispecific polypeptides described herein comprise, from amino -terminus to carboxyl-terminus, (i) the first scFv domain, (ii) a binding domain linker, and (iii) the second binding domain. In some embodiments, the multispecific polypeptides comprise, from amino -terminus to carboxyl-terminus, (i) the second scFv domain, (ii) a binding domain linker, and (iii) the first scFv domain.
  • the multispecific polypeptides comprise, from amino -terminus to carboxyl-terminus, (i) the first scFv domain, (ii) a hinge region, (iii) an immunoglobulin constant region, (iv) a binding domain linker, and (v) the second scFv domain.
  • the binding domain linker comprises a Gly4Ser sequence.
  • the binding domain linker comprises an amino acid sequence selected from SEQ ID NOs: 85-108.
  • the binding domain linker comprises an amino acid sequence set forth in SEQ ID NO: 107 (SGGGGSGGGGSGGGGSPS).
  • the first scFv domain of a multispecific polypeptide of the disclosure specifically binds to human 5T4 and comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 18, 120, 122, 124, 126, 128, 130, 132, 134, and 170; and the second scFv domain specifically binds to human 4- IBB and comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 1 10, 1 12, 1 14, and 1 16.
  • the first scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 1 18 and the second scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 1 10.
  • the first scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 120 and the second scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 1 10.
  • the first scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 122 and the second scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 1 10.
  • the first scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 124 and the second scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 1 12.
  • the first scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 126 and the second scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 1 14. In other embodiments, the first scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 126 and the second scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 1 10. In certain embodiments, the first scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 128 and the second scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 110.
  • the first scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 170 and the second scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 1 16. In some embodiments, the first scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 130 and the second scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 1 16. In some embodiments, the first scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 132 and the second scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 116.
  • the first scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 134 and the second scFv domain comprises an amino acid sequence set forth in SEQ ID NO: 116.
  • the disclosure provides a multispecific polypeptide, wherein the polypeptide comprises an amino acid sequence comprising at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 172, 174, and 176.
  • the polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 172, 174, and 176.
  • the disclosure provides a multispecific polypeptide that specifically binds to 5T4 and 4-1 BB, wherein the polypeptide comprises an amino acid sequence comprising at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 172, 174, and 176.
  • the polypeptide that specifically binds to 5T4 and 4- IBB comprises an amino acid sequence comprising at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 172, 174, and 176, wherein the polypeptide comprises the same CDR amino acid sequences as the respective SEQ ID NO or the polypeptide comprises CDR amino acid sequences that deviate by no more than one amino acid as compared to the respective SEQ ID NO.
  • the polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 172, 174, and 176.
  • the disclosure further provides a multispecific polypeptide wherein the first scFv domain binds to an extracellular domain of 5T4 and wherein the second scFv domain binds to an extracellular domain of 4- IBB.
  • the polypeptide results in enhanced effector cell activation.
  • a multispecific polypeptide of the disclosure increases effector cell activation and/or effector cell proliferation.
  • a multispecific polypeptide enhances effector cell-dependent lysis of 5T4-expressing cells.
  • a 5T4- binding domain of the disclosure is capable of binding 5T4 with a kD value of less than 50 nM.
  • the light chain variable region and/or the heavy chain variable region of the 5T4- binding domain and/or the 4-lBB-binding domain is humanized.
  • the present disclosure provides a multispecific polypeptide comprising a first single chain variable fragment (scFv) domain and a second scFv domain linked together by a binding domain linker and an immunoglobulin Fc domain, wherein the immunoglobulin Fc domain comprises a hinge region and an immunoglobulin constant region; wherein the multispecific polypeptide is capable of forming a homodimer by association with a second identical multispecific polypeptide; wherein the first scFv domain specifically binds to human 5T4 and comprises: (i) an immunoglobulin heavy chain variable region comprising a heavy chain complementarity determining region (HCDR)-1 amino acid sequence of SEQ ID NO: 30, an HCDR2 amino acid sequence of SEQ ID NO: 32, and an HCDR3 amino acid sequence of SEQ ID NO: 34; and (ii) an immunoglobulin light chain variable region comprising a light chain complementarity determining region (LCDR)-l amino acid sequence of SEQ ID NO
  • the multispecific polypeptide of claim 1 wherein the multispecific polypeptide comprises, from amino-terminus to carboxyl- terminus: (i) the first scFv domain, (ii) the hinge region, (iii) the immunoglobulin constant region, (iv) the binding domain linker, and (v) the second scFv domain.
  • the first scFv domain comprises a mutation in the framework region compared to the framework region of SEQ ID NOs: 130 or 170.
  • the mutation introduces a stabilizing disulfide bond.
  • the first scFv domain of the multispecific polypeptide comprises the immunoglobulin heavy chain variable region of SEQ ID NO: 38 and the immunoglobulin light chain variable region of SEQ ID NO: 44. In some embodiments, the first scFv domain of the multispecific polypeptide comprises the immunoglobulin heavy chain variable region of SEQ ID NO: 46 and the immunoglobulin light chain variable region of SEQ ID NO:48. In some embodiments, the second scFv domain of the multispecific polypeptide comprises immunoglobulin heavy chain variable region of SEQ ID NO: 14 and the immunoglobulin light chain variable region of SEQ ID NO: 16.
  • the first scFv domain of the multispecific polypeptide comprises the immunoglobulin heavy chain variable region of SEQ ID NO: 46 and the immunoglobulin light chain variable region of SEQ ID NO: 48
  • the second scFv domain comprises the immunoglobulin heavy chain variable region of SEQ ID NO: 14 and the immunoglobulin light chain variable region of SEQ ID NO: 16.
  • the amino acid sequence of the first scFv domain is at least 97% identical to SEQ ID NO: 120
  • the amino acid sequence of the second scFv domain is at least 97% identical to SEQ ID NO: 1 10.
  • the polypeptide comprises an amino acid sequence at least 95% identical to SEQ ID NO: 172 or comprises an amino acid sequence identical to SEQ ID NO: 172.
  • the amino acid sequence of the first scFv domain is at least 97% identical to SEQ ID NO: 122 and the amino acid sequence of the second scFv domain is at least 97% identical to SEQ ID NO: 1 10.
  • the polypeptide comprises an amino acid sequence at least 95% identical to SEQ ID NO: 174 or comprises an amino acid sequence of SEQ ID NO: 174.
  • binding of the multispecific polypeptide to an effector cell results in increased effector cell activation, increased effector cell proliferation, or wherein binding of the multispecific polypeptide to an effector cell an a 5T4-expressing cell results in enhanced effector cell-dependent lysis of the 5T4-expressing cell.
  • the disclosure also encompasses a dimer comprising two identical polypeptides, wherein the two polypeptides are each the multispecific polypeptide described in the disclosure.
  • the disclosure provides a pharmaceutical composition
  • a pharmaceutical composition comprising a polypeptide or a protein described in the disclosure, and a pharmaceutically acceptable carrier, diluent, or excipient.
  • a pharmaceutical composition may be formulated in a dosage form selected from the group consisting of: an oral unit dosage form, an intravenous unit dosage form, an intranasal unit dosage form, a suppository unit dosage form, an intradermal unit dosage form, an intramuscular unit dosage form, an intraperitoneal unit dosage form, a subcutaneous unit dosage form, an epidural unit dosage form, a sublingual unit dosage form, and an intracerebral unit dosage form.
  • Non-limiting examples of an oral unit dosage form include tablets, pills, pellets, capsules, powders, lozenges, granules, solutions, suspensions, emulsions, syrups, elixirs, sustained-release formulations, aerosols, and sprays.
  • the disclosure further encompasses a method for enhancing effector cell activation against a cell expressing 5T4, the method comprising: contacting said 5T4-expressing cell with a polypeptide or a protein of the disclosure, wherein said contacting is under conditions whereby enhanced effector cell activation against the 5T4-expressing cell is induced.
  • the disclosure provides a method for treating a disorder in a subject, wherein said disorder is characterized by expression of 5T4, the method comprising administering to the subject a therapeutically effective amount of a polypeptide or a protein or a pharmaceutical composition of the disclosure.
  • the disclosure also encompasses a use of a polypeptide or a protein of the disclosure for the manufacture of a medicament for treatment of a disorder in a subject, wherein said disorder is characterized by expression of 5T4.
  • the disclosure is related to a polypeptide or a protein of the disclosure for use in treating a disorder in a subject, wherein said disorder is characterized by expression of 5T4.
  • the disorder is a cancer.
  • the cancer is breast cancer, pancreatic cancer, ovarian cancer, non-small cell lung cancer, mesothelioma, chronic lymphocytic leukemia (CLL), mantle cell leukemia (MCL), acute lymphoblastic leukemia (ALL), squamous cell carcinoma, melanoma, adrenal cancer, bladder cancer, cervical cancer, renal cancer, gastric cancer, prostate cancer, thyroid cancer, liver cancer, uterine cancer, neurofibroma, sarcoma or head and neck cancer.
  • CLL chronic lymphocytic leukemia
  • MCL mantle cell leukemia
  • ALL acute lymphoblastic leukemia
  • the multispecific polypeptide for use in such methods comprises, from amino -terminus to carboxyl-terminus: (i) the first scFv domain, (ii) the hinge region, (iii) the immunoglobulin constant region, (iv) the binding domain linker, and (v) the second scFv domain.
  • the multispecific polypeptide for use in such methods comprisines a second scFv domain comprising an immunoglobulin heavy chain variable region of SEQ ID NO: 14 and an immunoglobulin light chain variable region of SEQ ID NO: 16, and a first scFv domain comprising (i) the immunoglobulin heavy chain variable region of SEQ ID NO: 38 and the immunoglobulin light chain variable region of SEQ ID NO: 44; or (ii) the immunoglobulin heavy chain variable region of SEQ ID NO: 46 and the immunoglobulin light chain variable region of SEQ ID NO: 48.
  • the amino acid sequence of the second scFv domain of the multispecific polypeptide is at least 97% identical to SEQ ID NO: 1 10
  • the amino acid sequence of the first scFv domain of the multispecific polypeptide is at least 97% identical to SEQ ID NO: 120 (anti-5T4 scFv for 209) or SEQ ID NO: 122.
  • said polypeptide exhibits statistically significant enhanced effector cell activation compared to a second multispecific polypeptide, wherein the second multispecific polypeptide is an IgG-scFv structure comprising an anti-4-lBB antibody comprising a variable heavy chain comprising SEQ ID NO: 28 and a variable light chain comprising SEQ ID NO: 16 and an anti-5T4 scFv comprising a variable heavy chain comprising SEQ ID NO: 46 and a variable light chain comprising SEQ ID NO: 66.
  • the second multispecific polypeptide is an IgG-scFv structure comprising an anti-4-lBB antibody comprising a variable heavy chain comprising SEQ ID NO: 28 and a variable light chain comprising SEQ ID NO: 16 and an anti-5T4 scFv comprising a variable heavy chain comprising SEQ ID NO: 46 and a variable light chain comprising SEQ ID NO: 66.
  • said polypeptide induces statistically significant increased effector cell proliferation compared to a second multispecific polypeptide, wherein the second multispecific polypeptide is an IgG-scFv structure comprising an anti-4-lBB antibody comprising a variable heavy chain comprising SEQ ID NO: 28 and a variable light chain comprising SEQ ID NO: 16 and an anti-5T4 scFv comprising a variable heavy chain comprising SEQ ID NO: 46 and a variable light chain comprising SEQ ID NO: 66.
  • the second multispecific polypeptide is an IgG-scFv structure comprising an anti-4-lBB antibody comprising a variable heavy chain comprising SEQ ID NO: 28 and a variable light chain comprising SEQ ID NO: 16 and an anti-5T4 scFv comprising a variable heavy chain comprising SEQ ID NO: 46 and a variable light chain comprising SEQ ID NO: 66.
  • a nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of SEQ ID NOs: 109, 1 11 , 113, 1 15, 117, 1 19, 121 , 123, 125, 127, 129, 131 , 133, 135, 137, 139, 141, 143, 145, 147, 149, 151 , 153, 155, 171 , 173, and 175.
  • the disclosure encompasses an expression vector comprising an isolated nucleic acid molecule described herein.
  • the nucleic acid molecule in an expression vector is operatively linked to regulatory sequences suitable for expression of the nucleic acid segment in a host cell.
  • the disclosure provides a recombinant host cell comprising an expression vector described herein.
  • the disclosure provides a method for producing a polypeptide comprising a 5T4-binding domain, the method comprising culturing a recombinant host cell comprising an expression vector described herein under conditions whereby the nucleic acid segment is expressed, thereby producing the polypeptide comprising a 5T4- binding domain.
  • FIG. 1 illustrates the agonistic function of seven constructs (ALG.APV-004,
  • FIG. 2 illustrates binding curves of seven scFv-Fc-scFv molecules
  • ALG.APV-006, ALG.APV-178, ALG.APV-179, ALG.APV-187, ALG.APV-191, ALG.APV- 196, and ALG.APV-198) to the CHO-K1 cell line expressing human 4-1BB.
  • FIG. 3 illustrates binding curves of seven scFv-Fc-scFv molecules
  • ALG.APV-006, ALG.APV-178, ALG.APV-179, ALG.APV-187, ALG.APV-191, ALG.APV- 196 and ALG.APV-198) to the CHO-K1 cell line expressing cynomolgus 4-1BB.
  • FIG. 4 illustrates the binding curves of seven scFv-Fc-scFv molecules
  • ALG.APV-006, ALG.APV-178, ALG.APV-179, ALG.APV-187, ALG.APV-191, ALG.APV- 196, and ALG.APV-198) to the CHO-K1 cell line expressing human 5T4.
  • FIG. 5 illustrates the expression levels of human 5T4 in the CHO-K1
  • FIG. 6 illustrates the binding curves of the ALG.APV-006, ALG.APV-178,
  • FIG. 7 illustrates the binding curves of ALG.APV-006, ALG.APV-178,
  • FIG. 8 illustrates the activity of anti-5T4 x anti-4-lBB constructs in a 4-
  • FIG. 9 illustrates the effect of anti-5T4 x anti-4-lBB constructs on IFNy release from PBMC and CHO-K1 co-cultures.
  • FIG. 10 illustrates an exemplary embodiment of a protein with an scFv-Fc- scFv format (ADAPTIRTM format).
  • FIG. 1 1 A - FIG. 1 IB show the interferon gamma (IFNy) response in human
  • FIG. 11 A shows T cell responses when cultured in plates coated with 5T4-Fc antigen.
  • FIG. 1 1B shows T cell responses when cultured without 5T4-Fc antigen. The figure displays mean values from two donors.
  • FIG. 12 shows the binding curves of ALG.APV-004, ALG.APV-178,
  • ALG.APV-179, ALG.APV-187, ALG.APV-208, ALG.APV-209, and ALG.APV-210 to the CHO-Kl/human CD 137 cell line.
  • FIG. 13 shows the binding curves of ALG.APV-004, ALG.APV-178,
  • ALG.APV-179, ALG.APV-187, ALG.APV-208, ALG.APV-209, and ALG.APV-210 to murine CT26 cells (ATCC) expressing human 5T4.
  • FIG. 14 shows the binding curves of ALG.APV-004, ALG.APV-178,
  • FIG. 15 shows the binding curves of ALG.APV-004, ALG.APV-178,
  • FIG. 16 shows the activity of the bispecific constructs in Jurkat/NF- ⁇ reporter cells, after 5 hours of incubation in the presence of 5T4(+) cells (HCC1143) or 5T4(-) cells (MOLM13). Every point in the curve represents the average of duplicate wells.
  • the y-axis shows values in relative fluorescence units (RLU).
  • FIG. 17 shows the levels of IFN- ⁇ induced in primary PBMC cultures at 72 by ALG.APV-178, ALG.APV-179, ALG.APV-187, ALG.APV-208, ALG.APV-209, ALG.APV- 210, and the Morrison format control construct, ALG.APV-004. Every point in the curve represents the average of duplicate wells.
  • FIG. 18A - FIG. 18B illustrates FACS analysis of 5T4-dependent localization of bispecific constructs ALG.APV-209, ALG.APV-210, and ALG.APV-004 to antigen-expressing tumors. Localization was detected by staining with an anti-human Fc antibody (FIG. 18A) or biotinylated 4-lBB (FIG. 18B).
  • FIG. 19A - FIG. 19B illustrates immunohistochemical analysis of 5T4- dependent localization of bispecific constructs ALG.APV-209, ALG.APV-210, and ALG.APV- 004 to 5T4+ (FIG. 19A) and 5T4- (FIG. 19B) tumors.
  • FIG. 20 shows the IFNy response of human CD8 T cells cultured with the bispecific antibody ALG.APV-210 in the presence of CT26 cells expressing different levels of 5T4.
  • FIG. 21 A - FIG. 2 IB show the maximum IFNy release of human CD 8 T cells cultured with the bispecific antibody ALG. APV-210 in the presence of CT26 cells expressing different levels of 5T4.
  • FIG. 22A - FIG. 22C show ALG.APV-210 or ANC107 (isotype control) binding to primary CD 8 T cells gated from CD3 -stimulated or unstimulated human and cynomolgus PBMC.
  • the MFI (and SEM) from 2 independent experiments are shown in FIG. 22A and FIG. 22B.
  • FIG. 23A - FIG. 23C show ALG.APV-210 or ANC107 (isotype control) binding to primary CD 8 T cells gated from CD3 -stimulated or unstimulated human and cynomolgus PBMC. Percentage and SEM of ALG.APV-210 binding to CD8 T cells from 2 independent experiments are shown in FIG. 23A and 23B.
  • FIG. 24 shows the agonistic function of ALG.APV-210 on human CD8 T cells.
  • FIG. 25 A - FIG. 25B show the agonistic function of ALG.APV-210 on human CD8 T cells from individual representative donors.
  • FIG. 26 shows the agonistic function of ALG.APV-210 on cynomolgus
  • FIG. 27A - FIG. 27C show the agonistic function of ALG.APV-210 on cynomolgus CD8 T cells from individual representative donors. The figures show a dose response dependent IFNy production by cynomolgus CD8 T activated with ALG.APV-210 in the presence of 5T4-FC.
  • FIG. 28 shows the anti-tumor efficacy of a bispecific antibody ALG.APV-
  • FIG. 29 shows the PK analysis of ALG.APV-210 or ALG.APV-209.
  • FIG. 30A - FIG. 30B show the binding of the Fc portion of ALG.APV-210 to FcyR. Titrated ALG.APV-210 was incubated with the FcyR-expressing cells and probed with a fluorescently-labelled anti-human IgG secondary antibody (FIG. 30A). Human IgGl molecule was used as a positive control (FIG. 30B).
  • FIG. 31A - FIG. 3 IB show the CD8+ and CD4+ T-cell proliferation induced by the bispecific molecules ALG.APV-209 and ALG.APV-210 in the presence of CHO- Kl cells expressing human 5T4 and anti-CD3 antibodies.
  • FIG. 32A - FIG. 32B show induction of IFN- ⁇ secretion by the bispecific molecule ALG.APV-210 in whole PBMC cultures, from two different human PBMC donors (A and B).
  • FIG. 33A - FIG. 33B show CD8+ T-cell proliferation induced by the bispecific molecule ALG.APV-210 in whole PBMC cultures, from two different human PBMC donors.
  • FIG. 34 shows binding of ALG.APV-210 to 5T4-expressing cell lines.
  • FIG. 35 shows agonist function of the bispecific construct ALG.APV-210 in Jurkat/NF- ⁇ reporter cells after incubation in the presence of cells expressing a range of surface 5T4 protein densities.
  • FIG. 36 shows the IFNy response of human CD8+ T cells cultured with the bispecific antibody ALG.APV-210 in the presence of human HCT116 cells expressing 5T4.
  • FIG. 37 shows IFNy response of human CD8+ T cells cultured with the bispecific antibody ALG.APV-210 in the presence of human HCT116 cells expressing 5T4.
  • FIG. 38 shows the maximum IFNy release of human CD8 T cells cultured with the bispecific antibody ALG.APV-210 in the presence of HCTl 16 cells expressing human 5T4.
  • FIG. 39A - FIG. 39D show ALG.APV-210 binding to 5T4 expressing human tumor cells or trans fected cell lines.
  • FIG. 40A - FIG. 40D show normalized MFI for experiments demonstrating
  • ALG.APV-210 binding to 5T4 expressing human tumor cells or transfected cell lines ALG.APV-210 binding to 5T4 expressing human tumor cells or transfected cell lines.
  • the disclosure provides polypeptides comprising binding domains that specifically bind to trophoblast glycoprotein (5T4) and polypeptides that specifically bind to 5T4.
  • the polypeptides are multispecific polypeptides that may bind specifically to 5T4 and to another target.
  • the polypeptides described herein are multispecific polypeptides that bind specifically to 5T4 and also bind specifically to a target on an effector cell.
  • the disclosure also provides polypeptides comprising binding domains that specifically bind to tumor necrosis factor receptor superfamily member 9 (4 IBB or CD 137) and polypeptides that specifically bind to 4-1BB.
  • the polypeptides are multispecific polypeptides that may bind specifically to 4-1 BB and to another target (e.g., a tumor- associated antigen).
  • the polypeptides described herein are multispecific polypeptides that bind specifically to 4- IBB and also bind specifically to a target on a target cell.
  • the multispecific polypeptides are bispecific polypeptides that bind specifically to 5T4 and bind specifically to 4- IBB.
  • the bispecific polypeptides bind to 5T4 expressed on a target cell and 4- IBB expressed on an effector cell, thereby resulting in amplification of effector cell activation and enhancing effector cell-mediated cytotoxicity of a target cell.
  • the present disclosure provides 5T4-binding domains and/or 4-lBB-binding domains (and polypeptides or proteins comprising such binding domains) that exhibit less off-target binding relative to previously known 5T4-binding domains and/or 4-lBB-binding domains.
  • the binding domains and/or polypeptides comprising the binding domains described herein bind to 5T4 and/or 4-1 BB more effectively in certain formats and/or certain orientations (e.g., VH-VL compared to VL-VH), leading to higher potency and/or improved utility in treating disorders associated with expression of 5T4.
  • administration of a therapeutically effective amount of a polypeptide or protein described herein to a patient in need thereof is useful for treatment of certain disorders associated with the expression of 5T4, including certain cancers.
  • the polypeptide or protein binds both a target cell expressing 5T4 and an effector- cell, thereby "cross-linking" the target cell expressing 5T4 and the effector cell.
  • the binding of both domains to their targets enhances the activation of the effector cells, leading to a prolonged and/or more robust effector cell response (e.g., effector cell-mediated cytotoxicity).
  • a target cell expresses 5T4 at a higher level than a non-target cell (e.g., normal cell or non-cancerous cell in the same subject, organ, or tissue) expresses 5T4.
  • a target cell expresses 5T4 while a non-target cell (e.g., normal cell or non-cancerous cell in the same subject, organ, or tissue) does not express 5T4.
  • any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated.
  • fractions thereof such as one tenth and one hundredth of an integer
  • the terms “a” and “an” as used herein refer to “one or more” of the enumerated components unless otherwise indicated.
  • the use of the alternative should be understood to mean either one, both, or any combination thereof of the alternatives.
  • the terms “include” and “comprise” are used synonymously.
  • polypeptides comprising the various combinations of the components (e.g., domains or regions) and substituents described herein, are disclosed by the present application to the same extent as if each polypeptide was set forth individually. Thus, selection of particular components of individual polypeptides is within the scope of the present disclosure.
  • binding domain refers to the domain, region, portion, or site of a protein, polypeptide, oligopeptide, peptide, antibody, or binding domain derived from an antibody that possesses the ability to specifically recognize and bind to a target molecule, such as an antigen, ligand, receptor, substrate, or inhibitor (e.g., 5T4 or 4-1BB).
  • exemplary binding domains include, antibodies and antibody-like proteins or domains, antibody heavy and light chain variable regions, and single-chain antibody variable regions (e.g., domain antibodies, sFv, scFv, scFab).
  • the binding domain comprises or consists of an antigen binding site (e.g.
  • the polypeptides of the present invention comprise a binding domain that specifically binds to a target antigen expressed by a target cell (e.g., a tumor associated antigen, such as 5T4).
  • a target cell e.g., a tumor associated antigen, such as 5T4
  • the polypeptides of the present invention comprise a binding domain that specifically binds to a target antigen expressed by an effector cell (e.g., 4- 1BB).
  • the polypeptides of the present invention are multispecific polypeptides and comprise two or more binding domains.
  • a binding domain or protein comprising a binding domain "specifically binds" a target if it binds the target with an affinity or Ka (i.e., an equilibrium association constant of a particular binding interaction with units of 1/M) equal to or greater than 10 5 M "1 , while not significantly binding other components present in a test sample. Binding domains can be classified as "high affinity" binding domains and "low affinity” binding domains.
  • High affinity binding domains refer to those binding domains with a Ka of at least 10 7 M “1 , at least 10 8 M “1 , at least 10 9 M 1 , at least 10 10 M 1 , at least 10 11 M 1 , at least 10 12 M 1 , or at least 10 13 M “1 .
  • Low affinity binding domains refer to those binding domains with a Ka of up to 10 7 M “1 , up to 10 6 M “1 , up to 10 5 M "1 .
  • affinity can be defined as an equilibrium dissociation constant (Kd) of a particular binding interaction with units of M (e.g., 10 "5 M to 10 "13 , or about 500 nM, about 300 nM, about 250 nM, about 200 nM, about 150 nM, about 100 nM, about 50 nM, about 25 nM, about 10 nM, or about 5 nM).
  • Kd equilibrium dissociation constant
  • Affinities of binding domain polypeptides and single chain polypeptides according to the present disclosure can be readily determined using conventional techniques (see, e.g., Scatchard et al. (1949) Ann. N.Y. Acad. Sci. 51 :660; and U.S. Patent Nos. 5,283,173, 5,468,614, or the equivalent).
  • a "conservative substitution” is recognized in the art as a substitution of one amino acid for another amino acid that has similar properties.
  • Exemplary conservative substitutions are well-known in the art (see, e.g., PCT Application Publication No. WO 97/09433, page 10, published March 13, 1997; Lehninger, Biochemistry, Second Edition; Worth Publishers, Inc. NY:NY (1975), pp.71-77; Lewin, Genes IV, Oxford University Press, NY and Cell Press, Cambridge, MA (1990), p. 8).
  • derivative refers to a modification of one or more amino acid residues of a peptide by chemical or biological means, either with or without an enzyme, e.g., by glycosylation, alkylation, acylation, ester formation, or amide formation.
  • a polypeptide or amino acid sequence "derived from” a designated polypeptide or protein refers to the origin of the polypeptide.
  • the polypeptide or amino acid sequence which is derived from a particular sequence (sometimes referred to as the "parent” or “parental” sequence) and has an amino acid sequence that is essentially identical to the parent sequence or a portion thereof, wherein the portion consists of at least 10-20 amino acids, at least 20-30 amino acids, or at least 30-50 amino acids, or at least 50- 150 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the parent sequence.
  • a binding domain e.g., a Fab, F(ab')2, Fab', scFv, single domain antibody (sdAb), etc.
  • a binding domain sequence e.g., a 5T4- or 4-lBB-binding domain
  • a binding domain sequence is derived from an antibody or protein by means of a computer algorithm or in silico.
  • Polypeptides derived from another polypeptide can have one or more mutations or alterations relative to the parent polypeptide, e.g., one or more amino acid residues which have been substituted with another amino acid residue or which has one or more amino acid insertions or deletions.
  • polypeptides derived from a parent polypeptide and comprising one or more mutations or alteration are referred to as "variants.”
  • variant or variants refers to a polynucleotide or polypeptide with a sequence differing from that of a reference polynucleotide or polypeptide, but retaining essential properties thereof.
  • variant polynucleotide or polypeptide sequences are overall closely similar, and, in many regions, identical to the reference polynucleotide or polypeptide.
  • a variant polynucleotide or polypeptide may exhibit at least about 70%, at least about 80%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% sequence identity compared to the active portion or full length reference polynucleotide or polypeptide.
  • the polypeptide can comprise an amino acid sequence which is not naturally occurring. Such variations necessarily have less than 100% sequence identity or similarity with the parent polypeptide.
  • the variant will have an amino acid sequence from about 60% to less than 100% amino acid sequence identity or similarity with the amino acid sequence of the parent polypeptide. In another embodiment, the variant will have an amino acid sequence from about 75% to less than 100%, from about 80% to less than 100%, from about 85% to less than 100%, from about 90% to less than 100%, from about 95% to less than 100% amino acid sequence identity or similarity with the amino acid sequence of the parent polypeptide.
  • sequence identity refers to a relationship between two or more polynucleotide sequences or between two or more polypeptide sequences. When a position in one sequence is occupied by the same nucleic acid base or amino acid residue in the corresponding position of the comparator sequence, the sequences are said to be “identical” at that position.
  • the percentage sequence identity is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of identical positions. The number of identical positions is then divided by the total number of positions in the comparison window and multiplied by 100 to yield the percentage of sequence identity. Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window.
  • the comparison window for polynucleotide sequences can be, for instance, at least 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 300, 400, 500, 600, 700, 800, 900 or 1000 or more nucleic acids in length.
  • the comparison window for polypeptide sequences can be, for instance, at least 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 300 or more amino acids in length.
  • the portion of a polynucleotide or polypeptide sequence in the comparison window can comprise additions or deletions termed gaps while the reference sequence is kept constant.
  • An optimal alignment is that alignment which, even with gaps, produces the greatest possible number of "identical” positions between the reference and comparator sequences. Percentage "sequence identity" between two sequences can be determined using the version of the program "BLAST 2 Sequences" which was available from the National Center for Biotechnology Information as of September 1 , 2004, which program incorporates the programs BLASTN (for nucleotide sequence comparison) and BLASTP (for polypeptide sequence comparison), which programs are based on the algorithm of Karlin and Altschul (Proc. Natl. Acad. Sci.
  • a position of an amino acid residue in a variable region of an immunoglobulin molecule is numbered according to either the IMGT criteria (Brochet et al, Nucl. Acids Res. (2008) 36, W503-508) or according to EU nomenclature (Ward et al., 1995 Therap. Immunol. 2:77-94), and a position of an amino acid residue in a constant region of an immunoglobulin molecule is numbered according to EU nomenclature (Ward et al., 1995 Therap. Immunol. 2:77-94).
  • the Kabat numbering convention Kabat numbering convention (Kabat, Sequences of Proteins of Immunological Interest, 5 th ed.
  • the term "dimer” refers to a biological entity that consists of two subunits associated with each other via one or more forms of intramolecular forces, including covalent bonds (e.g., disulfide bonds) and other interactions (e.g., electrostatic interactions, salt bridges, hydrogen bonding, and hydrophobic interactions), and is stable under appropriate conditions (e.g., under physiological conditions, in an aqueous solution suitable for expressing, purifying, and/or storing recombinant proteins, or under conditions for non-denaturing and/or non-reducing electrophoresis).
  • covalent bonds e.g., disulfide bonds
  • other interactions e.g., electrostatic interactions, salt bridges, hydrogen bonding, and hydrophobic interactions
  • heterodimer or “heterodimeric protein,” as used herein, refers to a dimer formed from two different polypeptides.
  • a heterodimer may comprise an anti-5T4 x anti-4-lBB molecule as described herein.
  • a heterodimer does not include an antibody formed from four polypeptides (i.e., two light chains and two heavy chains).
  • homodimer or “homodimeric protein,” as used herein, refers to a dimer formed from two identical polypeptides.
  • Fc region or "Fc domain” refers to a polypeptide sequence corresponding to or derived from the portion of a source antibody that is capable of binding to Fc receptors on cells and/or the Clq component of complement, thereby mediating the effector function of an antibody.
  • Fc stands for "fragment crystalline," the fragment of an antibody that will readily form a protein crystal. Distinct protein fragments, which were originally described by proteolytic digestion, can define the overall general structure of an immunoglobulin protein. As originally defined in the literature, the Fc region is a homodimeric protein comprising two polypeptides that are associated by disulfide bonds, and each comprising a hinge region, a CH2 domain, and a CH3 domain.
  • Fc region or “Fc domain” will refer herein to either the dimeric form or the individual monomers that associate to form the dimeric protein.
  • Fc includes variants of naturally occurring sequences.
  • an "immunoglobulin constant region” or “constant region” is a term defined herein to refer to a peptide or polypeptide sequence that corresponds to or is derived from part or all of one or more constant domains of an immunoglobulin.
  • the constant region comprises IgG CH2 and CH3 domains, e.g., IgGl CH2 and CH3 domains.
  • the constant region does not comprise a CHI domain.
  • the constant domains making up the constant region are human.
  • the constant region of a fusion protein of this disclosure lacks or has minimal effector functions while retaining the ability to bind some Fc receptors such as the neonatal Fc receptor (FcRn) and retaining a relatively long half-life in vivo.
  • FcRn neonatal Fc receptor
  • the constant region of a fusion protein of this disclosure do not result in, or substantially reduce the induction of antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cell-mediated phagocytosis (ADCP), complement activation, and/or complement-dependent cytotoxicity (CDC).
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • ADCP antibody-dependent cell-mediated phagocytosis
  • CDC complement-dependent cytotoxicity
  • a fusion protein of this disclosure comprises constant domains that retain one or more effector functions, such as of one or both of ADCC and CDC.
  • a binding domain of this disclosure is fused to a human IgGl constant region, wherein the IgGl constant region has one or more of the following amino acids mutated: leucine at position 234 (L234), leucine at position 235 (L235), glycine at position 237 (G237), glutamate at position 318 (E318), lysine at position 320 (K320), lysine at position 322 (K322), or any combination thereof (numbering according to EU). For example, any one or more of these amino acids can be changed to alanine.
  • an IgGl Fc domain has each of L234, L235, G237, E318, K320, and K322 (according to EU numbering) mutated to an alanine (i.e., L234A, L235A, G237A, E318A, K320A, and K322A, respectively), and optionally an N297A mutation as well (i.e., essentially eliminating glycosylation of the CH2 domain).
  • variable region also referred to as “light chain variable domain” or “VL”
  • heavy chain variable region also referred to as “heavy chain variable domain” or “VH "
  • the variable binding regions are made up of discrete, well-defined sub-regions known as “complementarity determining regions” (CDRs) and “framework regions” (FRs). In one embodiment, the FRs are humanized.
  • CDRs complementarity determining regions
  • FRs framework regions
  • the FRs are humanized.
  • CL refers to an "immunoglobulin light chain constant region” or a “light chain constant region,” i.e., a constant region from an antibody light chain.
  • CH refers to an "immunoglobulin heavy chain constant region" or a “heavy chain constant region,” which is further divisible, depending on the antibody isotype into CHI , CH2, and CH3 (IgA, IgD, IgG), or CHI , CH2, CH3, and CH4 domains (IgE, IgM).
  • a "Fab” fragment antigen binding is the part of an antibody that binds to antigens and includes the variable region and CHI domain of the heavy chain linked to the light chain via an inter-chain disulfide bond.
  • linker generally refers to a short polypeptide sequence connecting two sub-domains of a polypeptide.
  • linkers include flexible linkers comprising glycine-serine repeats, and linkers derived from (a) an interdomain region of a transmembrane protein (e.g., a type I transmembrane protein); (b) a stalk region of a type II C-lectin; or (c) an immunoglobulin hinge.
  • a linker provides a spacer function compatible with interaction of the two sub-binding domains so that the resulting polypeptide retains a specific binding affinity to the same target molecule as an antibody that comprises the same light and heavy chain variable regions.
  • a linker is comprised of five to about 35 amino acids, for instance, about 15 to about 25 amino acids.
  • a linker between CH3 and CHI or CL refers to one or more amino acid residues (e.g., about 2-12, about 2-10, about 4-10, about 5-10, about 6-10, about 7-10, about 8-10, about 9-10, about 8-12, about 9-12, or about 10-12) between the C-terminus of a CH3 domain (e.g., a wild type CH3 or a mutated CH3) and the N-terminus of a CHI domain or CL domain (e.g., CK).
  • a linker may refer to (1 ) a polypeptide region between VH and VL regions in a single-chain Fv (scFv) or (2) a polypeptide region between a first binding domain and a second binding domain in a multispecific polypeptide comprising two binding domains.
  • scFv single-chain Fv
  • a linker connects two or more binding domains, such a linker is referred to herein as a "binding domain linker.”
  • a binding domain linker may directly link or connect two or more binding domains, resulting in a construct comprising the following structure: binding domain - binding domain linker - binding domain.
  • the multispecific polypeptides described herein comprise, in order from amino-terminus to carboxyl-terminus (i) a first binding domain, (ii) a binding domain linker, and (iii) a second binding domain.
  • a multispecific polypeptide comprises, in order from amino-terminus to carboxyl-terminus (i) a second binding domain, (ii) a binding domain linker, and (iii) a first binding domain.
  • a binding domain linker may link or connect two or more binding domains by linking at least one binding domain to a non-binding domain polypeptide, such as an immunoglobulin Fc domain (i.e., a polypeptide comprising the structure: Ig hinge - Ig constant region).
  • a non-binding domain polypeptide such as an immunoglobulin Fc domain (i.e., a polypeptide comprising the structure: Ig hinge - Ig constant region).
  • the resulting constructs may comprise the following structure: binding domain - Fc domain - binding domain linker - binding domain.
  • the multispecific polypeptides described herein comprise, in order from amino-terminus to carboxyl-terminus: (i) a first binding domain, (ii) a hinge region, (iii) an immunoglobulin constant region, (iv) a binding domain linker, and (v) a second binding domain.
  • a multispecific polypeptide comprises, in order from amino-terminus to carboxyl-terminus (i) a second binding domain, (ii) a binding domain linker, (iii) an immunoglobulin constant region, (iv) a hinge region, and (v) a first binding domain.
  • a polypeptide region between an immunoglobulin constant region and a second binding domain in a multispecific polypeptide comprising two binding domains may also be referred to as a "carboxyl-terminus linker" or an "amino-terminus linker” depending on the orientation of the domains within the multispecific polypeptide.
  • linkers are provided in Table 1 .
  • a "hinge” or a “hinge region” refers to a polypeptide derived from an immunoglobulin hinge region and located between a binding domain (e.g. , a 5T4- binding domain or a 4-lBB-binding domain) and an immunoglobulin constant region in a polypeptide described herein.
  • a "wild-type immunoglobulin hinge region” refers to a naturally occurring upper and middle hinge amino acid sequences interposed between and connecting the CHI and CH2 domains (for IgG, IgA, and IgD) or interposed between and connecting the CHI and CH3 domains (for IgE and IgM) found in the heavy chain of an antibody.
  • a wild type immunoglobulin hinge region sequence is human, and can comprise a human IgG hinge region (e.g., and IgGl , IgG2, IgG3, or IgG4 hinge region).
  • an "altered immunoglobulin hinge region" or “variant immunoglobulin hinge region” refers to a hinge region polypeptide with one or more mutations, substitutions, insertions, or deletions compared to a corresponding parental wild-type immunoglobulin hinge region.
  • an altered immunoglobulin hinge region is at least 70% homologous to a wild-type immunoglobulin hinge region (e.g., at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% homologous).
  • an altered immunoglobulin hinge region is a fragment of a wild type immunoglobulin hinge region that has a length of about 5 amino acids (e.g., about 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acids) up to about 120 amino acids (for instance, having a length of about 10 to about 40 amino acids or about 15 to about 30 amino acids or about 15 to about 20 amino acids or about 20 to about 25 amino acids).
  • an altered immunoglobulin hinge region that is a fragment of a wild type immunoglobulin hinge region comprises an IgG core hinge region (e.g., a polypeptide comprising the sequence C-X-X-C, wherein X is any amino acid) as disclosed in U.S. Patent Application Publication Nos. 2013/0129723 and 2013/0095097.
  • Non-limiting examples of hinges are provided in Table 1.
  • the term "humanized” refers to a process of making an antibody or immunoglobulin binding proteins and polypeptides derived from a non-human species (e.g., mouse or rat) less immunogenic to humans, while still retaining antigen-binding properties of the original antibody, using genetic engineering techniques.
  • the binding domain(s) of an antibody or immunoglobulin binding proteins and polypeptides e.g., light and heavy chain variable regions, Fab, scFv
  • Fab heavy chain variable regions
  • Non-human binding domains can be humanized using techniques known as CDR grafting (Jones et al, Nature 321 :522 (1986)) and variants thereof, including “reshaping” (Verhoeyen, et al, 1988 Science 239:1534-1536; Riechmann, et al, 1988 Nature 332:323-337; Tempest, et al, Bio/Technol 1991 9:266-271), “hyperchimerization” (Queen, et al, 1989 Proc Natl Acad Sci USA 86:10029-10033; Co, et al, 1991 Proc Natl Acad Sci USA 88:2869-2873; Co, et al, 1992 J Immunol 148:1 149-1154), and “veneering” (Mark, et al, “Derivation of therapeutically active humanized and veneered anti- CD18 antibodies.” In: Metcalf BW, Dalton BJ, eds.
  • the term "patient in need” refers to a patient at risk of, or suffering from, a disease, disorder or condition that is amenable to treatment or amelioration with a 5T4-binding protein or multispecific polypeptide or a composition thereof provided herein.
  • the term "pharmaceutically acceptable” refers to molecular entities and compositions that do not generally produce allergic or other serious adverse reactions when administered using routes well known in the art. Molecular entities and compositions approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans are considered to be “pharmaceutically acceptable.”
  • promoter refers to a region of DNA involved in binding RNA polymerase to initiate transcription.
  • nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the terms encompass nucleic acids containing analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences as well as the sequence explicitly indicated.
  • degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al. (1991) Nucleic Acid Res. 19:5081; Ohtsuka et al. (1985) J. Biol. Chem. 260:2605-2608; Cassol et al. (1992); Rossolini et al. (1994) Mol. Cell. Probes 8:91-98).
  • nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
  • nucleic acid As used herein, the terms “nucleic acid,” “nucleic acid molecule,” or “polynucleotide” are intended to include DNA molecules (e.g., cDNA or genomic DNA), RNA molecules (e.g., mRNA), analogs of the DNA or RNA generated using nucleotide analogs, and derivatives, fragments and homologs thereof.
  • DNA molecules e.g., cDNA or genomic DNA
  • RNA molecules e.g., mRNA
  • analogs of the DNA or RNA generated using nucleotide analogs e.g., mRNA
  • expression refers to the biosynthesis of a product encoded by a nucleic acid.
  • expression involves transcription of the nucleic acid segment into mRNA and the translation of mRNA into one or more polypeptides.
  • expression unit and "expression cassette” are used interchangeably herein and denote a nucleic acid segment encoding a polypeptide of interest and capable of providing expression of the nucleic acid segment in a host cell.
  • An expression unit typically comprises a transcription promoter, an open reading frame encoding the polypeptide of interest, and a transcription terminator, all in operable configuration.
  • an expression unit can further include other nucleic acid segments such as, e.g., an enhancer or a polyadenylation signal.
  • expression vector refers to a nucleic acid molecule, linear or circular, comprising one or more expression units.
  • an expression vector can also include additional nucleic acid segments such as, for example, one or more origins of replication or one or more selectable markers.
  • Expression vectors are generally derived from plasmid or viral DNA, or can contain elements of both.
  • polypeptide refers to a single, linear and contiguous arrangement of covalently linked amino acids. Polypeptides can form one or more intrachain disulfide bonds. With regard to polypeptides as described herein, reference to modifications or alterations of amino acid residues corresponding to those specified by SEQ ID NO includes post-translational modifications of such residues.
  • polypeptide and protein also encompass embodiments where two polypeptide chains link together in a nonlinear fashion, such as via an interchain disulfide bond. For example, a native immunoglobulin molecule is comprised of two heavy chain polypeptides and two light chain polypeptides.
  • Each of the heavy chain polypeptides associate with a light chain polypeptide by virtue of interchain disulfide bonds between the heavy and light chain polypeptides to form two heterodimeric proteins or polypeptides (i.e., a protein comprised of two heterologous polypeptide chains).
  • the two heterodimeric proteins then associate by virtue of additional interchain disulfide bonds between the heavy chain polypeptides to form an immunoglobulin protein or polypeptide.
  • a protein or polypeptide may be an antibody or an antigen-binding fragment of an antibody.
  • a protein may be an scFv-Fc-scFv protein, scFv-scFv dimer, or a diabody.
  • proteins and polypeptides are defined herein in terms of the amino acid sequences of the individual polypeptide chains, which are indicated by the SEQ ID NOs reference throughout this disclosure.
  • an scFv-Fc-scFv protein or polypeptide described herein is comprised of two scFv- Fc-scFv polypeptide chains associated by interchain bonds (e.g., interchain disulfide bonds) to form a dimeric scFv-Fc-scFv protein (e.g., a homodimeric or heterodimeric scFv-Fc-scFv protein) (See, for example, FIG. 10).
  • the scFv-Fc-scFv protein is defined by the amino acid sequences of the individual scFv-Fc-scFv polypeptide chains.
  • Polypeptides and proteins can also comprise non-peptidic components, such as carbohydrate groups. Carbohydrates and other non-peptidic substituents can be added to a protein or polypeptide by the cell in which the protein is produced, and will vary with the type of cell. Proteins and polypeptides are defined herein in terms of their amino acid backbone structures; substituents such as carbohydrate groups are generally not specified, but may be present nonetheless.
  • amino-terminal and “carboxyl-terminal” are used herein to denote positions within polypeptides. Where the context allows, these terms are used with reference to a particular sequence or portion of a polypeptide to denote proximity or relative position. For example, a certain sequence positioned carboxyl-terminal to a reference sequence within a polypeptide is located proximal to the carboxyl-terminus of the reference sequence, but is not necessarily at the carboxyl-terminus of the complete polypeptide.
  • transduction refers to the transfer of nucleic acid (i.e., a nucleotide polymer) into a cell.
  • nucleic acid i.e., a nucleotide polymer
  • genetic transformation refers to the transfer and incorporation of DNA, especially recombinant DNA, into a cell.
  • the transferred nucleic acid can be introduced into a cell via an expression vector.
  • Antibody-dependent cell-mediated cytotoxicity and "ADCC,” as used herein, refer to a cell-mediated process in which nonspecific cytotoxic cells that express FcyRs (e.g. , monocytic cells such as natural killer (NK) cells and macrophages) recognize bound antibody (or other protein capable of binding FcyRs) on a target cell and subsequently cause lysis of the target cell.
  • FcyRs e.g. , monocytic cells such as natural killer (NK) cells and macrophages
  • NK natural killer
  • any effector cell with an activating FcyR can be triggered to mediate ADCC.
  • the primary cells for mediating ADCC are NK cells, which express only FcyRIII, whereas monocytes, depending on their state of activation, localization, or differentiation, can express FcyRI, FcyRII, and FcyRIII.
  • NK cells which express only FcyRIII
  • monocytes depending on their state of activation, localization, or differentiation, can express FcyRI, FcyRII, and FcyRIII.
  • the term "having ADCC activity," as used herein in reference to a polypeptide or protein, means that the polypeptide or protein, for example, one comprising an Fc domain (e.g., an immunoglobulin hinge region and an immunoglobulin constant region having CH2 and CH3 domains) such as derived from IgG (e.g., IgGl), is capable of mediating antibody- dependent cell-mediated cytotoxicity (ADCC) through binding of a cytolytic Fc receptor (e.g., FcyRIII) on a cytolytic immune effector cell expressing the Fc receptor (e.g., an NK cell).
  • a cytolytic Fc receptor e.g., FcyRIII
  • a multispecific polypeptide or protein comprising an Fc domain may lack effector function (e.g., null ADCC activity) as the result of mutations in the CH2 and/or CH3 domain.
  • effector function e.g., null ADCC activity
  • Complement-dependent cytotoxicity and “CDC,” as used herein, refer to a process in which components in normal serum (“complement”), together with an antibody or other Clq-complement-binding protein bound to a target antigen, exhibit lysis of a target cell expressing the target antigen.
  • Complement consists of a group of serum proteins that act in concert and in an orderly sequence to exert their effect.
  • classical complement pathway and “classical complement system,” as used herein, are synonymous and refer to a particular pathway for the activation of complement.
  • the classical pathway requires antigen-antibody complexes for initiation and involves the activation, in an orderly fashion, of nine major protein components designated CI through C9.
  • the product is an enzyme that catalyzes the subsequent step. This cascade provides amplification and activation of large amounts of complement by a relatively small initial signal.
  • the term "having CDC activity," as used herein in reference to a polypeptide or protein, means that the polypeptide or protein, for example, one comprising an Fc domain (e.g., an immunoglobulin hinge region and an immunoglobulin constant region having CH2 and CH3 domains) such as derived from IgG (e.g., IgGl) is capable of mediating complement-dependent cytotoxicity (CDC) through binding of Cl q complement protein and activation of the classical complement system.
  • an Fc domain e.g., an immunoglobulin hinge region and an immunoglobulin constant region having CH2 and CH3 domains
  • IgG e.g., IgGl
  • CDC complement-dependent cytotoxicity
  • a multispecific polypeptide or protein may have lack effector function (e.g., null CDC activity) as the result of one or more mutations in the CH2 and/or CH3 domains.
  • enhanced effector cell activation refers to the increase, prolonging, and/or potentiation of an effector cell response by the polypeptides or proteins described herein.
  • enhanced effector cell activation refers to an increase in the cytotoxic activity of an effector cell.
  • enhanced effector cell activation refers to an increase in cytokine production, cell proliferation, or a change in cell-surface molecule expression such that the ability of the effector cell to lyse a target cell is enhanced.
  • the polypeptides and proteins described herein enhance effector cell activation by modulating Wnt/ -catenin signaling.
  • effector cell refers to a cell of the immune system that is capable of lysing or killing a target cell, such as a tumor cell.
  • an effector cell may refer to a lymphocyte, such as a T cell, a natural killer (NK) cell, or an NKT cell, a monocyte, a macrophage, a dendritic cell, or a granulocyte.
  • the term effector cell refers to a T cell, an NK cell, or an NKT cell.
  • treatment refers to either a therapeutic treatment or prophylactic/preventative treatment.
  • a treatment is therapeutic if at least one symptom of disease in an individual receiving treatment improves or a treatment can delay worsening of a progressive disease in an individual, or prevent onset of additional associated diseases.
  • the term "therapeutically effective amount (or dose)" or “effective amount (or dose)” of a polypeptide or protein described herein or a composition thereof refers to that amount of the compound sufficient to result in amelioration of one or more symptoms of the disease being treated in a statistically significant manner or a statistically significant improvement in organ function.
  • a therapeutically effective dose refers to that ingredient alone.
  • a therapeutically effective dose refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered serially or simultaneously (in the same formulation or concurrently in separate formulations).
  • the term "statistical significance” refers the probability of obtaining a test result that occurs by chance. For example, an observation or test result is said to be statistically significant if the probability of it occurring purely by chance (p) is less than the predetermined statistical threshold (a), or p ⁇ a.
  • the statistical threshold for a particular test may be set according to the characteristics of the data and conventions known in the art. For example, a is conventionally set to 5% (0.05), such that, for a given result, p ⁇ 0.05 in order for said result to be considered statistically significant.
  • a "5T4-binding domain” refers to a domain of a polypeptide described herein that specifically bind to oncofetal trophoblast glycoprotein (5T4) ⁇ e.g., human 5T4), also known as TPBG and Wnt-activated inhibitory factor 1 (WAIF1).
  • 5T4 is a 72kD oncofetal glycoprotein that is heavily N-glycosylated proteins with several leucine -rich repeats associated with protein-protein interactions.
  • the term “5T4" may refer to any isoform of 5T4.
  • Exemplary human 5T4 nucleotide sequences are shown in Table 1 below and provided in SEQ ID NOs: 163 and 167 and exemplary human 5T4 amino acid sequences are provided in SEQ ID NOs: 164 and 168.
  • 4-lBB-binding domain refers to a binding domain of a protein or polypeptide described herein that is capable of specifically binding to human 4-1 BB (also known as CD 137).
  • 4-1 BB may refer to any isoform of 4- IBB.
  • Exemplary human 4- IBB nucleotide sequences are shown in Table 1 below and provided in SEQ ID NOs: 161 and 165, and exemplary human 4-1BB amino acid sequences are provided in SEQ ID NOs: 162 and 166.
  • a “multispecific polypeptide” refers to a polypeptide comprising two or more binding domains each capable of specifically binding to a target antigen.
  • the polypeptides described herein may comprise 2, 3, 4, or more binding domains and may be able to bind 2, 3, 4, or more target antigens.
  • a multispecific polypeptide is a bispecific polypeptide.
  • a "bispecific polypeptide” comprises two binding domains and capable of binding to two distinct target antigens.
  • the bispecific polypeptides described herein comprise a first binding domain that specifically binds to a cell surface antigen expressed on a target cell, such as 5T4.
  • the bispecific polypeptides described herein comprise a binding domain that specifically binds to a cell surface antigen expressed on an effector cell, such as 4-1BB.
  • the multispecific polypeptide is an ADAPTIRTM homodimer bispecific polypeptide in the format scFv-Fc-scFv.
  • Multispecific polypeptides using scaffolds are disclosed, for instance, in PCT Publication Nos. WO 2007/146968; WO 2010/040105; WO 2010/003108; WO 2016/094873; WO 2017/053469; U.S. Patent Application Publication No. 2006/0051844; and U.S. Patent Nos. 7,166,707; and 8,409,577, which are each incorporated herein by reference in their entirety.
  • the multispecific polypeptides described herein are bispecific polypeptides and may comprise an scFv-Fc-scFv structure, also referred to herein as an ADAPTIRTM polypeptide, or Format 1 , an exemplary embodiment of which is shown in FIG. 10.
  • the structure of a polypeptide comprising a Format 1 structure comprises, from N-terminus to C- terminus: a first scFv binding domain - an immunoglobulin (Ig) hinge region - an Ig constant region - a second scFv binding domain (FIG. 10).
  • the multispecific polypeptides described herein may comprise an IgG-scFv structure (also referred to herein as the Morrison format, or Format 2).
  • the structure of a polypeptide comprising a Format 2 structure comprises, from N-terminus to C-terminus: an scFv binding domain - an Ig constant region - an Ig hinge region - an Ig variable region.
  • Format 2 is, essentially, an intact Ig molecule comprising a C-terminal scFv domain.
  • the present disclosure describes polypeptides capable of specifically binding to 5T4 (e.g., 5T4-binding polypeptides), as well as multispecific polypeptides and proteins comprising these binding domains. Such embodiments may be referred to as 5T4-binding polypeptides.
  • the present invention provides multispecific binding proteins comprising a 5T4-binding domain and a second binding domain capable of binding to a cell-surface molecule on an effector cell.
  • the present invention provides bispecific binding proteins comprising a 5T4-binding domain and a second binding domain capable of binding to 4-1BB (e.g., a 4-lBB-binding domain).
  • the 5T4-binding polypeptides comprise the structure, from N-terminus to C- terminus: a 5T4-binding domain - Fc domain.
  • the present disclosure describes polypeptides capable of specifically binding to 4-1BB, as well as multispecific polypeptides and proteins comprising these binding domains. Such embodiments may be referred to as 4-lBB-binding polypeptides.
  • the present invention provides multispecific polypeptides comprising a 4-lBB-binding domain and a second binding domain capable of binding to a cell-surface molecule on a target cell.
  • the present invention provides bispecific polypeptides comprising a 4-lBB-binding domain and a second binding domain capable of binding to 5T4 (e.g., a 5T4-binding domain).
  • the 4-1BB- binding polypeptides comprise the structure, from N-terminus to C-terminus: a 4-lBB-binding domain - Fc domain.
  • polypeptides described herein can further comprise immunoglobulin constant regions, linker peptides, hinge regions, immunoglobulin dimerization/heterodimerization domains, junctional amino acids, tags, etc. These components of the disclosed polypeptides and proteins are described in further detail below.
  • the polypeptides and proteins described herein comprise one or more binding domains capable of specifically binding a target antigen.
  • the binding domains described herein can be in the form of an antibody or a fusion protein of any of a variety of different formats (e.g., the fusion protein can be in the form of a bispecific or multispecific molecule).
  • bispecific molecules include an scFv-Fc-scFv molecule (e.g. a bispecific protein comprising the structure of Format 1 ), an scFv-Ig molecule (e.g.
  • bispecific protein comprising the structure of Format 2) and an scFv-scFv molecule.
  • the bispecific molecules described herein comprise or consist of a first binding domain scFv linked to a second binding domain scFv and do not include other sequences such as an immunoglobulin constant region.
  • the bispecific protein described herein are diabodies.
  • polypeptides and proteins described herein are conjugated to a drug or a toxic moiety.
  • the polypeptides and proteins described herein may comprise sequences amino acid and/or nucleic acid shown in Tables 2-10.
  • the binding domains of the polypeptides described herein comprise (i) an immunoglobulin light chain variable region (VL) comprising CDRs LCDR1 , LCDR2, and LCDR3, and (ii) an immunoglobulin heavy chain variable region (VH) comprising CDRs HCDR1 , HCDR2, and HCDR3.
  • amino acid sequences provided for polypeptide constructs do not include the human immunoglobulin leader sequences.
  • CDR sequences and amino acid substitution positions shown are those defined using the IMGT criteria (Brochet et al, Nucl. Acids Res. (2008) 36, W503-508).
  • the sequences shown in the disclosure, including in Tables 2-10 contain amino acid substitutions relative to a parent sequence (e.g. an anti-4-l BB antibody or binding fragment thereof such as clone 1618/1619, which is disclosed in PCT Application Publication No. WO 2016/185016, or an anti-5T4 antibody or binding fragment thereof such as those disclosed in PCT Application Publication No. WO 2016/185016).
  • the parent sequence of an anti-5T4 binding domain comprises the amino acid sequence provided in SEQ ID NOs: 38 and 68.
  • the parent sequence of an anti-4-l BB binding domain comprises the amino acid sequence provided in SEQ ID NOs: 28 and 16.
  • Exemplary parental sequences for the anti-4-lBB and anti-5T4 binding domains described herein are shown below in Table 2. Underlined text indicates CDR sequences.
  • a binding domain VL and/or VH region of the present disclosure is derived from a VL and/or VH of a parent VL and/or VH region (e.g., 1618/1619 as described in PCT Application Publication No.
  • WO 2016/185016 and optionally contains about one or more (e.g., about 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, about one or more (e.g., about 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, about one or more (e.g., about 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions or non-conservative amino acid substitutions), or a combination of the above-noted changes, when compared to the VL and/or VH sequence of a known monoclonal antibody.
  • amino acid substitutions e.g., conservative amino acid substitutions or non-conservative amino acid substitutions
  • the insertion(s), deletion(s) or substitution(s) can be anywhere in the VL and/or VH region, including at the amino- or carboxyl-terminus or both ends of this region, provided that each CDR comprises zero changes or at most one, two, or three changes.
  • the binding domain containing the modified VL and/or VH region can still specifically bind its target with an affinity similar to or greater than the parent binding domain.
  • a binding domain described herein is derived from an antibody and comprises a variable heavy chain (VH) and a variable light chain (VL).
  • VH variable heavy chain
  • VL variable light chain
  • binding domains and variable chains may be arranged in any order that still retains some binding to the target(s).
  • the variable domains may be arranged in the order such as V H 5T4 - V L 5T4 - V H 4-1BB - V L 4-1BB; V L 5T4
  • the pairs of VH regions and VL regions in the binding domain binding to 4-1 BB and/or the binding domain binding to 5T4 may be in the format of a single chain antibody (scFv).
  • the polypeptides and proteins described herein comprise binding domains that are scFvs.
  • the binding domains may be referred to as scFv domains.
  • a binding domain is a single-chain Fv fragment (scFv) that comprises VH and VL regions specific for a target of interest.
  • the VH and VL regions are human or humanized.
  • a binding domain is a single-chain Fv (scFv) comprising VL and VH regions joined by a peptide linker.
  • peptide linkers for joining VL and VH regions are well-known in the art, and a large number of publications exist within this particular field.
  • a peptide linker is a 15mer consisting of three repeats of a Gly-Gly-Gly-Gly-Ser amino acid sequence ((Gly4Ser) 3 ) (SEQ ID NO: 96).
  • Other linkers have been used, and phage display technology, as well as selective infective phage technology, has been used to diversify and select appropriate linker sequences (Tang et al., J. Biol. Chem. 271 , 15682-15686, 1996; Hennecke et al, Protein Eng.
  • the linker comprises (Gly4Ser)4.
  • Other suitable linkers can be obtained by optimizing a simple linker (e.g., (Gly4Ser) n ) through random mutagenesis.
  • the VH region of the scFv described herein may be positioned N-terminally to a linker sequence.
  • the VL region of the scFvs described herein may be positioned C-terminally to the linker sequence.
  • the scFv may bind to 5T4 and/or 4- IBB more effectively than the antibody comprising the same VH and VL region sequences in the same orientation. In certain embodiments, the scFv may bind more effectively to 5T4 and/or 4- IBB in the VL-VH orientation than in the VH-VL orientation, or vice versa.
  • the polypeptide comprises a binding domain linker linking the binding domains (e.g., linking the scFv domains).
  • the binding domain linker is a Gly4Ser linker.
  • the binding domain linker is a 20mer consisting of four repeats of a Gly-Gly-Gly-Gly-Ser amino acid sequence ((Gly4Ser) 3 ) (SEQ ID NO: 98).
  • the binding domain linker comprises an amino acid sequence selected from SEQ ID NOs 86-108.
  • linkers have been used, and phage display technology, as well as selective infective phage technology, has been used to diversify and select appropriate linker sequences (Tang et al., J. Biol. Chem. 271 , 15682-15686, 1996; Hennecke et al., Protein Eng. 1 1 , 405-410, 1998).
  • Other suitable linkers can be obtained by optimizing a simple linker (e.g., (Gly4Ser) n ) through random mutagenesis.
  • abispecific molecule may comprise an scFv binding to 5T4 linked to an scFv binding to 4-1 BB.
  • bispecific molecules do not comprise a hinge region or a constant region.
  • the polypeptides and proteins described herein further comprise a hinge.
  • the hinge is an altered immunoglobulin hinge in which one or more cysteine residues in a wild type immunoglobulin hinge region is substituted with one or more other amino acid residues (e.g., serine or alanine).
  • Exemplary altered immunoglobulin hinges, carboxyl-terminus linkers, and amino -terminus linkers include an immunoglobulin human IgGl hinge region having one, two or three cysteine residues found in a wild type human IgGl hinge substituted by one, two or three different amino acid residues (e.g., serine or alanine).
  • An altered immunoglobulin hinge can additionally have a proline substituted with another amino acid (e.g., serine or alanine).
  • the above-described altered human IgGl hinge can additionally have a proline located carboxyl-terminal to the three cysteines of wild type human IgGl hinge region substituted by another amino acid residue (e.g., serine, alanine).
  • a hinge, a carboxyl-terminus linker, or an amino -terminus linker polypeptide comprises or is a sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a wild type immunoglobulin hinge region, such as a wild type human IgGl hinge, a wild type human IgG2 hinge, or a wild type human IgG4 hinge.
  • a hinge present in a polypeptide that forms a heterodimer with another polypeptide chain can be an immunoglobulin hinge, such as a wild-type immunoglobulin hinge region or an altered immunoglobulin hinge region thereof.
  • a hinge of one polypeptide chain of a heterodimeric protein is identical to a corresponding hinge of the other polypeptide chain of the heterodimer.
  • a hinge of one chain is different from that of the other chain (in their length or sequence).
  • a heterodimeric protein has a 4-lBB-binding domain in one chain and a 5T4-binding domain in another chain. Having two different hinges in the two chains may allow the heterodimer to bind to the 5T4 first, and then to 4-1 BB second.
  • the heterodimer may recruit 4-lBB-expressing effector cells to 5T4-expressing target cells (e.g., 5T4-expressing tumor or cancer cells), which in turn may damage or destroy the 5T4-expressing cells.
  • a carboxyl-terminus linker or an amino -terminus linker is a flexible linker sequence comprising glycine-serine (e.g., Gly4Ser) repeats.
  • the linker comprises three Gly4Ser repeats (SEQ ID NO: 96) followed by a proline residue.
  • the proline residue is followed by an amino acid selected from the group consisting of glycine, arginine and serine.
  • a carboxyl-terminus linker or an amino -terminus linker comprises or consists of a sequence selected from SEQ ID NO: 86 - 108.
  • hinge, carboxyl-terminus linker, and amino -terminus linker sequences suitable for use in accordance with the present disclosure are Table 3 below. Additional exemplary hinge and linker regions are set forth in SEQ ID NOs: 241 -244, 601 , 78, 763-791 , 228, 379-434, 618-749 of U.S. Patent Publication No. 2013/0129723 (said sequences incorporated by reference herein).
  • Hinge Region Amino Acid Sequence SEQ ID sss(s)-hIgGl hinge EPKSSDKTHTS PPS S 71 csc(s)- gGl hinge EPKSCDKTHTSPPCS 72 ssc(s)-hIgGl hinge EPKSSDKTHTSPPCS 73 scc(s)-hIgGl hinge EPKSSDKTHTCPPCS 74 css(s)-hIgGl hinge EPKSCDKTHTSPPSS 75 scs(s)-hIgGl hinge EPKSSDKTHTCPPSS 76 ccc(s)-hIgGl hinge EPKSCDKTHTSPPCS 77 cc(p)-hIgGl hinge EPKSCDKTHTSPPCP 78 sss(p)-hIgGl hinge EPKSSDKTHTS PPS P 79 csc(p)-hIgGl hinge EPKSCDKTHTSPPCP 80 Hinge Region
  • the polypeptides and proteins described herein include a heterodimerization domain that is capable of heterodimerization with a different heterodimerization domain in a second, non-identical polypeptide chain.
  • the second polypeptide chain for heterodimerization includes a second binding domain. Accordingly, in certain embodiments of the present disclosure, two non-identical polypeptide chains, one comprising the polypeptide comprising a first binding domain and the second optionally comprising a second binding domain, dimerize to form a heterodimeric binding protein.
  • Dimerization/heterodimerization domains can be used where it is desired to form heterodimers from two non-identical polypeptide chains, where one or both polypeptide chains comprise a binding domain.
  • one polypeptide chain member of certain heterodimers described herein does not contain a binding domain. Examples of types of heterodimers include those described in U.S. Patent Application Publication Nos. 2013/0095097 and 2013/0129723, and International PCT Publication No. WO 2016/094873.
  • the first and second polypeptide chains dimerize via the inclusion of an "immunoglobulin dimerization domain" or "immunoglobulin heterodimerization domain.”
  • An “immunoglobulin dimerization domain” or “immunoglobulin heterodimerization domain” refers herein to an immunoglobulin domain of a first polypeptide chain that preferentially interacts or associates with a different immunoglobulin domain of a second polypeptide chain, wherein the interaction of the different immunoglobulin domains substantially contributes to or efficiently promotes heterodimerization of the first and second polypeptide chains (i.e., the formation of a dimer between two different polypeptide chains, which is also referred to as a "heterodimer").
  • immunoglobulin heterodimerization domains in the polypeptide chains of a heterodimer are different from each other and thus can be differentially modified to facilitate heterodimerization of both chains and to minimize homodimerization of either chain.
  • Immunoglobulin heterodimerization domains provided herein allow for efficient heterodimerization between different polypeptides and facilitate purification of the resulting heterodimeric protein.
  • immunoglobulin heterodimerization domains useful for promoting heterodimerization of two different polypeptide chains according to the present disclosure include wild-type and altered immunoglobulin CHI and CL domains, for instance, human CHI and CL domains.
  • an immunoglobulin heterodimerization domain is a wild-type CHI domain, such as a wild type IgGl , IgG2, IgG3, IgG4, IgAl , IgA2, IgD, IgE, or IgM CHI domain, for example, as set forth in SEQ ID NOs: 1 14, 186-192 and 194, respectively, of U.S. Patent Application Publication No.
  • a cysteine residue of a wild-type CHI domain e.g., a human CHI
  • a wild type immunoglobulin CL domain e.g., a human CL
  • an immunoglobulin heterodimerization domain is a wild-type CL domain, such as a wild type CK domain or a wild type ⁇ domain, for example, as set forth in SEQ ID NOs: 1 12 and 1 13, respectively, of U.S. Patent Application Publication No. 2013/0129723 (said sequences incorporated by reference herein).
  • an immunoglobulin heterodimerization domain is an altered immunoglobulin CL domain, such as an altered CK or CX domain, for instance, an altered human CK or human CX domain.
  • a cysteine residue of a wild-type CL domain involved in forming a disulfide bond with a wild type immunoglobulin CHI domain is deleted or substituted in the altered immunoglobulin CL domain, for example a CK domain as set forth in SEQ ID NO: 141 of U.S. Patent Application Publication No. 2013/0129723 or a CX domain as set forth in SEQ ID NO: 140 of U.S. Patent Application Publication No. 2013/0129723 (said sequences incorporated by reference herein).
  • only the last cysteine of the wild type human CK domain is deleted in the altered CK domain because the first arginine deleted from the wild type human CK domain can be provided by a linker that has an arginine at its carboxyl-terminus and links the amino -terminus of the altered CK domain with another domain (e.g., an immunoglobulin sub- region, such as a sub-region comprising immunoglobulin CH2 and CH3 domains).
  • a linker that has an arginine at its carboxyl-terminus and links the amino -terminus of the altered CK domain with another domain (e.g., an immunoglobulin sub- region, such as a sub-region comprising immunoglobulin CH2 and CH3 domains).
  • an immunoglobulin heterodimerization domain is an altered CK domain that contains one or more amino acid substitutions, as compared to a wild type CK domain, at positions that may be involved in forming the interchain-hydrogen bond network at a CK-CK interface.
  • an immunoglobulin heterodimerization domain is an altered human CK domain having one or more amino acids at positions N29, N30, Q52, V55, T56, S68 or T70 that are substituted with a different amino acid. The numbering of the amino acids is based on their positions in the altered human CK sequence as set forth in SEQ ID NO: 141 of U.S. Patent Application Publication No.
  • an immunoglobulin heterodimerization domain is an altered human CK domain having one, two, three or four amino acid substitutions at positions N29, N30, V55, or T70.
  • the amino acid used as a substitute at the above -noted positions can be an alanine, or an amino acid residue with a bulk side chain moiety such as arginine, tryptophan, tyrosine, glutamate, glutamine, lysine aspartate, methionine, serine or phenylalanine.
  • Altered human CK domains are those that facilitate heterodimerization with a CHI domain, but minimize homodimerization with another CK domain.
  • both the immunoglobulin heterodimerization domains (i.e., immunoglobulin CHI and CL domains) of a polypeptide heterodimer have mutations so that the resulting immunoglobulin heterodimerization domains form salt bridges (i.e., ionic interactions) between the amino acid residues at the mutated sites.
  • the immunoglobulin heterodimerization domains of a polypeptide heterodimer can be a mutated CHI domain in combination with a mutated CK domain.
  • valine at position 68 (V68) of the wild type human CH 1 domain is substituted by an amino acid residue having a negative charge (e.g., aspartate or glutamate), whereas leucine at position 29 (L29) of a mutated human CK domain in which the first arginine and the last cysteine have been deleted is substituted by an amino acid residue having a positive charge (e.g., lysine, arginine or histidine).
  • a negative charge e.g., aspartate or glutamate
  • leucine at position 29 (L29) of a mutated human CK domain in which the first arginine and the last cysteine have been deleted is substituted by an amino acid residue having a positive charge (e.g., lysine, arginine or histidine).
  • V68 of the wild type CH I can be substituted by an amino acid residue having a positive charge
  • L29 of a mutated human CK domain in which the first arginine and the last cysteine have been deleted can be substituted by an amino acid residue having a negative charge
  • Exemplary mutated CHI sequences in which V68 is substituted by an amino acid with either a negative or positive charge are set forth in SEQ ID NOs: 844 and 845 of U.S. Patent Application Publication No. 2013/0129723 (said sequences incorporated by reference herein).
  • Exemplary mutated CK sequences in which L29 is substituted by an amino acid with either a negative or positive charge are set forth in SEQ ID NOs: 842 and 843 of U.S . Patent Application Publication No. 2013/0129723 (said sequences incorporated by reference herein).
  • Positions other than V68 of human CH I domain and L29 of human CK domain can be substituted with amino acids having opposite charges to produce ionic interactions between the amino acids in addition or alternative to the mutations in V68 of CH I domain and L29 of CK domain.
  • Such positions can be identified by any suitable method, including random mutagenesis, analysis of the crystal structure of the CH1 -CK pair to identify amino acid residues at the CH1 -CK interface, and further identifying suitable positions among the amino acid residues at the CH1 -CK interface using a set of criteria (e.g., propensity to engage in ionic interactions, proximity to a potential partner residue, etc.).
  • polypeptide heterodimers of the present disclosure contain only one pair of immunoglobulin heterodimerization domains.
  • a first chain of a polypeptide heterodimer can comprise a CH I domain as an immunoglobulin heterodimerization domain, while a second chain can comprise a CL domain (e.g., a CK or CX) as an immunoglobulin heterodimerization domain.
  • a first chain can comprise a CL domain (e.g., a CK or Ck) as an immunoglobulin heterodimerization domain
  • a second chain can comprise a CHI domain as an immunoglobulin heterodimerization domain.
  • the immunoglobulin heterodimerization domains of the first and second chains are capable of associating to form a heterodimeric protein of this disclosure.
  • heterodimeric proteins of the present disclosure can have two pairs of immunoglobulin heterodimerization domains.
  • a first chain of a heterodimer can comprise two CHI domains, while a second chain can have two CL domains that associate with the two CHI domains in the first chain.
  • a first chain can comprise two CL domains, while a second chain can have two CH I domains that associate with the two CL domains in the first chain.
  • a first polypeptide chain comprises a CHI domain and a CL domain
  • a second polypeptide chain comprises a CL domain and a CH I domain that associate with the CH I domain and the CL domain, respectively, of the first polypeptide chain.
  • the immunoglobulin heterodimerization domain of each chain can be located amino -terminal to the immunoglobulin constant region of that chain.
  • the immunoglobulin heterodimerization domain in each chain can be located carboxyl-terminal to the immunoglobulin constant region of that chain.
  • both immunoglobulin heterodimerization domains in each chain can be located amino-terminal to the immunoglobulin constant region of that chain.
  • both immunoglobulin heterodimerization domains in each chain can be located carboxyl-terminal to the immunoglobulin constant region of that chain.
  • one immunoglobulin heterodimerization domain in each chain can be located amino-terminal to the immunoglobulin constant region of that chain, while the other immunoglobulin heterodimerization domain of each chain can be located carboxyl-terminal to the immunoglobulin constant region of that chain.
  • the immunoglobulin constant region is interposed between the two immunoglobulin heterodimerization domains of each chain.
  • the polypeptides and proteins e.g., 5T4-binding polypeptides, 4-lBB-binding polypeptides, and/or multispecific binding proteins thereof
  • the polypeptides and proteins further comprise an immunoglobulin constant region (also referred to herein as a constant region, Fc domain, Fc region, and the like) in a polypeptide chain.
  • the immunoglobulin constant region comprises an amino acid sequence according to SEQ ID NO: 158, 160, or a variant thereof. The inclusion of an immunoglobulin constant region slows clearance of the polypeptides and proteins of the present invention from circulation after administration to a subject.
  • an immunoglobulin constant region further enables relatively easy modulation of polypeptide effector functions (e.g., ADCC, ADCP, CDC, complement fixation, and binding to Fc receptors), which can either be increased or decreased depending on the disease being treated, as known in the art and described herein.
  • the polypeptides and proteins described herein comprise an immunoglobulin constant region capable of mediating one or more of these effector functions.
  • one or more of these effector functions are reduced or absent in an immunoglobulin constant region of a polypeptide or protein described herein present disclosure, as compared to a corresponding wild-type immunoglobulin constant region.
  • an immunoglobulin constant region preferably has reduced or no effector function relative to a corresponding wild-type immunoglobulin constant region.
  • an immunoglobulin constant region present in the polypeptides and proteins of the present disclosure can comprise or can be derived from part or all of: a CH2 domain, a CH3 domain, a CH4 domain, or any combination thereof.
  • an immunoglobulin constant region can comprise a CH2 domain, a CH3 domain, both CH2 and CH3 domains, both CH3 and CH4 domains, two CH3 domains, a CH4 domain, two CH4 domains, and a CH2 domain and part of a CH3 domain.
  • the polypeptides or proteins described herein do not comprise a CHI domain.
  • a polypeptide or protein described herein may comprise a wild type immunoglobulin CH2 domain or an altered immunoglobulin CH2 domain from certain immunoglobulin classes or subclasses (e.g., IgGl , IgG2, IgG3, IgG4, IgAl , IgA2, or IgD) and from various species (including human, mouse, rat, and other mammals).
  • immunoglobulin classes or subclasses e.g., IgGl , IgG2, IgG3, IgG4, IgAl , IgA2, or IgD
  • a CH2 domain of a polypeptide or a protein described herein is a wild type human immunoglobulin CH2 domain, such as wild type CH2 domains of human IgGl , IgG2, IgG3, IgG4, IgAl , IgA2, or IgD, as set forth in SEQ ID NOs: 1 15, 199-201 and 195-197, respectively, of U.S. Patent Application Publication No. 2013/0129723 (said sequences incorporated by reference herein).
  • the CH2 domain is a wild type human IgGl CH2 domain as set forth in SEQ ID NO: 1 15 of U.S. Patent Application Publication No. US 2013/0129723 (said sequence incorporated by reference herein).
  • an altered CH2 region in a polypeptide or a protein of the present disclosure comprises or is a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to a wild type immunoglobulin CH2 region, such as the CH2 region of wild type human IgGl , IgG2, or IgG4, or mouse IgG2a (e.g., IGHG2c).
  • a wild type immunoglobulin CH2 region such as the CH2 region of wild type human IgGl , IgG2, or IgG4, or mouse IgG2a (e.g., IGHG2c).
  • An altered immunoglobulin CH2 region in a polypeptide or protein of the present disclosure can be derived from a CH2 region of various immunoglobulin isotypes, such as IgGl , IgG2, IgG3, IgG4, IgAl , IgA2, and IgD, from various species (including human, mouse, rat, and other mammals).
  • an altered immunoglobulin CH2 region in a fusion protein of the present disclosure can be derived from a CH2 region of human IgGl , IgG2 or IgG4, or mouse IgG2a (e.g., IGHG2c), whose sequences are set forth in SEQ ID NOs: 1 15, 199, 201 , and 320 of U.S. Patent Application Publication No. 2013/0129723 (said sequences incorporated by reference herein).
  • an altered CH2 domain of a polypeptide or a protein described herein e.g.
  • 5T4-binding polypeptides is an altered human IgGl CH2 domain with mutations known in the art that enhance or reduce immunological activities (i.e., effector functions) such as ADCC, ADCP, CDC, complement fixation, Fc receptor binding, or any combination thereof.
  • immunological activities i.e., effector functions
  • a CH2 domain of a polypeptide or a protein described herein is an altered immunoglobulin CH2 region (e.g., an altered human IgGl CH2 domain) that comprises one or more amino acid deletions or substitutions.
  • the CH2 domain comprises an amino acid substitution at the asparagine of position 297 (e.g., asparagine to alanine). Such an amino acid substitution reduces or eliminates glycosylation at this site and abrogates efficient Fc binding to FcyR and Cl q.
  • the sequence of an altered human IgGl CH2 domain with an Asn to Ala substitution at position 297 is set forth in SEQ ID NO: 324 of U.S. Patent Application Publication No.
  • the altered CH2 domain comprises at least one substitution or deletion at positions 234 to 238.
  • an immunoglobulin CH2 region can comprise a substitution at position 234, 235, 236, 237 or 238; positions 234 and 235; positions 234 and 236; positions 234 and 237; positions 234 and 238; positions 234-236; positions 234, 235 and 237; positions 234, 236 and 238; positions 234, 235, 237, and 238; positions 236-238; or any other combination of two, three, four, or five amino acids at positions 234-238.
  • an altered CH2 region comprises one or more (e.g., two, three, four or five) amino acid deletions at positions 234-238, for instance, at one of position 236 or position 237 while the other position is substituted.
  • the amino acid residues at one or more of positions 234- 238 has been replaced with one or more alanine residues.
  • only one of the amino acid residues at positions 234-238 have been deleted while one or more of the remaining amino acids at positions 234-238 can be substituted with another amino acid (e.g., alanine or serine).
  • the above -noted mutation(s) decrease or eliminate the ADCC activity or Fc receptor-binding capability of a polypeptide that comprises the altered CH2 domain.
  • a CH2 domain of a polypeptide or a protein described herein is an altered immunoglobulin CH2 region (e.g., an altered human IgGl CH2 domain) that comprises one or more amino acid substitutions at positions 253, 310, 318, 320, 322, and 331.
  • an immunoglobulin CH2 region can comprise a substitution at position 253, 310, 318, 320, 322, or 331 , positions 318 and 320, positions 318 and 322, positions 318, 320 and 322, or any other combination of two, three, four, five or six amino acids at positions 253, 310, 318, 320, 322, and 331.
  • the above -noted mutation(s) decrease or eliminate the CDC activity of a polypeptide comprising the altered CH2 domain.
  • an altered CH2 region of a polypeptide or a protein described herein can further comprise one or more (e.g., two, three, four, or five) additional substitutions at positions 234-238.
  • an immunoglobulin CH2 region can comprise a substitution at positions 234 and 297, positions 234, 235, and 297, positions 234, 236 and 297, positions 234-236 and 297, positions 234, 235, 237 and 297, positions 234, 236, 238 and 297, positions 234, 235, 237, 238 and 297, positions 236-238 and 297, or any combination of two, three, four, or five amino acids at positions 234-238 in addition to position 297.
  • an altered CH2 region can comprise one or more (e.g., two, three, four or five) amino acid deletions at positions 234-238, such as at position 236 or position 237.
  • the additional mutation(s) decreases or eliminates the ADCC activity or Fc receptor-binding capability of a polypeptide comprising the altered CH2 domain.
  • the amino acid residues at one or more of positions 234-238 have been replaced with one or more alanine residues.
  • only one of the amino acid residues at positions 234-238 has been deleted while one or more of the remaining amino acids at positions 234-238 can be substituted with another amino acid (e.g., alanine or serine).
  • another amino acid e.g., alanine or serine
  • a mutated CH2 region of a polypeptide or a protein described herein e.g., an altered human IgGl CH2 domain
  • a fusion protein of the present disclosure can contain one or more (e.g., 2, 3, 4, 5, or 6) additional amino acid substitutions (e.g., substituted with alanine) at one or more positions involved in complement fixation (e.g., at positions 1253, H310, E318, K320, K322, or P331).
  • mutated immunoglobulin CH2 regions include human IgGl , IgG2, IgG4 and mouse IgG2a CH2 regions with alanine substitutions at positions 234, 235, 237 (if present), 318, 320 and 322.
  • An exemplary mutated immunoglobulin CH2 region is mouse IGHG2c CH2 region with alanine substitutions at L234, L235, G237, E318, K320, and K322.
  • an altered CH2 region of a polypeptide or a protein described herein can further comprise one or more (e.g., two, three, four, five, or six) additional substitutions at positions 253, 310, 318, 320, 322, and 331.
  • an immunoglobulin CH2 region can comprise a (1) substitution at position 297, (2) one or more substitutions or deletions or a combination thereof at positions 234-238, and one or more (e.g., 2, 3, 4, 5, or 6) amino acid substitutions at positions 1253, H310, E318, K320, K322, and P331 , such as one, two, three substitutions at positions E318, K320 and K322.
  • the amino acids at the above -noted positions can be substituted by alanine or serine.
  • an immunoglobulin CH2 region of a polypeptide or a protein described herein comprises: (i) an amino acid substitution at the asparagines of position 297 and one amino acid substitution at position 234, 235, 236 or 237; (ii) an amino acid substitution at the asparagine of position 297 and amino acid substitutions at two of positions 234-237; (iii) an amino acid substitution at the asparagine of position 297 and amino acid substitutions at three of positions 234-237; (iv) an amino acid substitution at the asparagine of position 297, amino acid substitutions at positions 234, 235 and 237, and an amino acid deletion at position 236; (v) amino acid substitutions at three of positions 234-237 and amino acid substitutions at positions 318, 320 and 322; or (vi) amino acid substitutions at three of positions 234-237, an amino acid deletion at position 236, and amino acid substitutions at positions 318, 320 and 322.
  • Exemplary altered immunoglobulin CH2 regions with amino acid substitutions at the asparagine of position 297 include: human IgGl CH2 region with alanine substitutions at L234, L235, G237 and N297 and a deletion at G236 (SEQ ID NO: 325 of U.S. Patent Application Publication No. 2013/0129723, said sequence incorporated by reference herein), human IgG2 CH2 region with alanine substitutions at V234, G236, and N297 (SEQ ID NO: 326 of U.S. Patent Application Publication No.
  • an altered CH2 region of a polypeptide or a protein described herein can contain one or more additional amino acid substitutions at one or more positions other than the above -noted positions.
  • Such amino acid substitutions can be conservative or non-conservative amino acid substitutions.
  • P233 can be changed to E233 in an altered IgG2 CH2 region (see, e.g., SEQ ID NO: 326 of U.S. Patent Application Publication No. 2013/0129723, said sequence incorporated by reference herein).
  • the altered CH2 region can contain one or more amino acid insertions, deletions, orboth.
  • the insertion(s), deletion(s) or substitution(s) can be anywhere in an immunoglobulin CH2 region, such as at the N- or C-terminus of a wild type immunoglobulin CH2 region resulting from linking the CH2 region with another region (e.g., a binding domain or an immunoglobulin heterodimerization domain) via a hinge.
  • an altered CH2 domain of a polypeptide or protein described herein is a human IgGl CH2 domain with alanine substitutions at positions 235, 318, 320, and 322 (i.e., a human IgGl CH2 domain with L235A, E318A, K320A and K322A substitutions) (SEQ ID NO: 595 of U.S. Patent Application Publication No. 2013/0129723, said sequence incorporated by reference herein), and optionally an N297 mutation (e.g., to alanine).
  • an altered CH2 domain is a human IgGl CH2 domain with alanine substitutions at positions 234, 235, 237, 318, 320 and 322 (i.e., a human IgGl CH2 domain with L234A, L235A, G237A, E318A, K320A and K322A substitutions) (SEQ ID NO: 596 of U.S. Patent Application Publication No. 2013/0129723, said sequence incorporated by reference herein), and optionally an N297 mutation (e.g., to alanine).
  • an immunoglobulin constant region of a polypeptide or a protein described herein comprises a human IgGl CH2 domain comprising the substitutions L234A, L235A, G237A, and K322A, according to the EU numbering system.
  • the CH3 domain that can form an immunoglobulin constant region of a polypeptide or a protein described herein can be a wild type immunoglobulin CH3 domain or an altered immunoglobulin CH3 domain thereof from certain immunoglobulin classes or subclasses (e.g., IgGl , IgG2, IgG3, IgG4, IgAl , IgA2, IgD, IgE, IgM) of various species (including human, mouse, rat, and other mammals).
  • a CH3 domain of a polypeptide described herein is a wild type human immunoglobulin CH3 domain, such as wild type CH3 domains of human IgGl , IgG2, IgG3, IgG4, IgAl , IgA2, IgD, IgE, or IgM as set forth in SEQ ID NOs: 1 16, 208-210, 204-207, and 212, respectively of U.S. Patent Application Publication No. 2013/0129723 (said sequences incorporated by reference herein).
  • the CH3 domain is a wild type human IgGl CH3 domain as set forth in SEQ ID NO: 1 16 of U.S. Patent Application Publication No. 2013/0129723 (said sequence incorporated by reference herein).
  • a CH3 domain of a polypeptide described herein is a wild type human IgGl CH3 domain as set forth in SEQ ID NO: 1 16 of U.S. Patent Application Publication No. 2013/0129723 (said sequence incorporated by reference herein).
  • an altered human immunoglobulin CH3 domain is an altered human immunoglobulin CH3 domain, such as an altered CH3 domain based on or derived from a wild-type CH3 domain of human IgGl , IgG2, IgG3, IgG4, IgAl, IgA2, IgD, IgE, or IgM antibodies.
  • an altered CH3 domain can be a human IgGl CH3 domain with one or two mutations at positions H433 and N434 (positions are numbered according to EU numbering). The mutations in such positions can be involved in complement fixation.
  • an altered CH3 domain of a polypeptide described herein can be a human IgGl CH3 domain but with one or two amino acid substitutions at position F405 or Y407. The amino acids at such positions are involved in interacting with another CH3 domain.
  • an altered CH3 domain of polypeptide described herein can be an altered human IgGl CH3 domain with its last lysine deleted. The sequence of this altered CH3 domain is set forth in SEQ ID NO: 761 of U.S. Patent Application Publication No. 2013/0129723 (said sequence incorporated by reference herein).
  • a polypeptide or a protein described herein e.g.,
  • 5T4-binding polypeptides, 4-lBB-binding polypeptides, and/or multispecific binding proteins thereof comprises a CH3 domain that comprises so called "knobs-into-holes" mutations (see, Marvin and Zhu, Acta Pharmacologica Sinica 26:649-58, 2005; Ridgway et al, Protein Engineering 9:617-21 , 1966). More specifically, mutations can be introduced into each of the CH3 domains of each polypeptide chain so that the steric complementarity required for CH3/CH3 association obligates these two CH3 domains to pair with each other.
  • a CH3 domain in one single chain polypeptide of a polypeptide heterodimer can contain a T366W mutation (a "knob” mutation, which substitutes a small amino acid with a larger one), and a CH3 domain in the other single chain polypeptide of the polypeptide heterodimer can contain a Y407A mutation (a "hole” mutation, which substitutes a large amino acid with a smaller one).
  • Other exemplary knobs-into-holes mutations include (1) a T366Y mutation in one CH3 domain and a Y407T in the other CH3 domain, and (2) a T366W mutation in one CH3 domain and T366S, L368A and Y407V mutations in the other CH3 domain.
  • the CH4 domain that can form an immunoglobulin constant region a polypeptide or a protein described herein can be a wild type immunoglobulin CH4 domain or an altered immunoglobulin CH4 domain thereof from IgE or IgM molecules.
  • the CH4 domain of a polypeptide described herein is a wild type human immunoglobulin CH4 domain, such as wild type CH4 domains of human IgE and IgM molecules as set forth in SEQ ID NOs: 213 and 214, respectively, of U.S. Patent Application Publication No.
  • a CH4 domain of a polypeptide described herein is an altered human immunoglobulin CH4 domain, such as an altered CH4 domain based on or derived from a CH4 domain of human IgE or IgM molecules, which have mutations that increase or decrease an immunological activity known to be associated with an IgE or IgM Fc region.
  • an immunoglobulin constant region of a polypeptide or a protein described herein comprises a combination of CH2, CH3 or CH4 domains (i.e., more than one constant region domain selected from CH2, CH3 and CH4).
  • the immunoglobulin constant region can comprise CH2 and CH3 domains or CH3 and CH4 domains.
  • the immunoglobulin constant region can comprise two CH3 domains and no CH2 or CH4 domains (i.e., only two or more CH3).
  • the multiple constant region domains that form an immunoglobulin constant region of the polypeptides described herein can be based on or derived from the same immunoglobulin molecule, or the same class or subclass immunoglobulin molecules.
  • the immunoglobulin constant region is an IgG CH2-CH3 (e.g., IgGl CH2-CH3, IgG2 CH2-CH3, and IgG4 CH2-CH3) and can be a human (e.g., human IgGl , IgG2, and IgG4) CH2CH3.
  • the immunoglobulin constant region of a polypeptide described herein comprises (1) wild type human IgGl CH2 and CH3 domains, (2) human IgGl CH2 with N297A substitution (i.e., CH2(N297A)) and wild type human IgGl CH3, or (3) human IgGl CH2(N297A) and an altered human IgGl CH3 with the last lysine deleted.
  • the multiple constant region domains of a polypeptide or a protein described herein can be based on or derived from different immunoglobulin molecules, or different classes or subclasses immunoglobulin molecules.
  • an immunoglobulin constant region comprises both human IgM CH3 domain and human IgGl CH3 domain.
  • the multiple constant region domains that form an immunoglobulin constant region of a polypeptide described herein can be directly linked together or can be linked to each other via one or more (e.g., about 2- about 10) amino acids.
  • immunoglobulin constant regions that can be used in a polypeptide or a protein described herein (e.g., 5T4-binding polypeptides, 4-lBB-binding polypeptides, and/or multispecific binding proteins thereof) are set forth in SEQ ID NOs: 305-309, 321 , 323, 341 , 342, and 762 of U.S. Patent Application Publication No. 2013/0129723 (said sequences incorporated by reference herein). Further exemplary immunoglobulin constant regions that can be used in a polypeptide or a protein described herein are provided in Table 4 below.
  • the immunoglobulin constant regions of each polypeptide chain of a homodimeric or heterodimeric protein described herein are identical to each other.
  • the immunoglobulin constant region of one polypeptide chain of a heterodimeric protein is different from the immunoglobulin constant region of the other polypeptide chain of the heterodimer.
  • one immunoglobulin constant region of a heterodimeric protein can contain a CH3 domain with a "knob” mutation, whereas the other immunoglobulin constant region of the heterodimeric protein can contain a CH3 domain with a "hole” mutation.
  • the polypeptides of the present disclosure may comprise an immunoglobulin constant region comprising any of the above described mutations and a binding domain comprising one or more amino acid mutations compared to a parental binding domain amino acid sequence.
  • the polypeptides of the present disclosure may comprise an immunoglobulin constant region comprising one or more of the L234A, L235A, G237A, and K322A mutations in the human IgGl CH2 domain and a 5T4- binding domain comprising a VH domain selected from the group consisting of SEQ ID NOs: 38 and 46 and a VL domain selected from the group consisting of SEQ ID NOs: 44, 48, and 50.
  • the polypeptides of the present disclosure may comprise an immunoglobulin constant region comprising one or more of the L234A, L235A, G237A, and K322A mutations in the human IgGl CH2 domain and a 41BB-binding domain comprising a VH domain amino acid sequence of SEQ ID NO: 14 and a VL domain amino acid sequence of SEQ ID NO: 16.
  • polypeptides of the present disclosure may comprise an immunoglobulin constant region comprising one or more of the L234A, L235A, G237A, and K322A mutations in the human IgGl CH2 domain and a 5T4-binding domain comprising a VH domain selected from the group consisting of SEQ ID NOs: 38 and 46 and a VL domain selected from the group consisting of SEQ ID NOs: 44, 48, and 50; and a 41BB-binding domain comprising a VH domain amino acid sequence of SEQ ID NO: 14, and a VL domain amino acid sequence of SEQ ID NO: 16.
  • Polypeptides and proteins described herein may be made using scaffolding as generally disclosed in U.S. Patent Application Publication Nos. 2013/0129723 and 2013/0095097, which are each incorporated herein by reference in their entirety.
  • the polypeptides described herein may comprise two non-identical polypeptide chains, each polypeptide chain comprising an immunoglobulin heterodimerization domain.
  • the interfacing immunoglobulin heterodimerization domains are different.
  • the immunoglobulin heterodimerization domain comprises a CHI domain or a derivative thereof.
  • the immunoglobulin heterodimerization domain comprises a CL domain or a derivative thereof.
  • the CL domain is a CK or CX isotype or a derivative thereof.
  • polypeptides and proteins described herein e.g., 5T4-binding polypeptides, 4-lBB-binding polypeptides, and/or multispecific binding proteins thereof may have improved characteristics compared to other 5T4-binding polypeptides or 4- lBB-binding polypeptides.
  • the 5T4-binding polypeptides, 4-lBB-binding polypeptides, or multispecific proteins thereof of the present invention may exhibit a reduced isoelectric point compared to the isoelectric point of a different 5T4-binding polypeptide and/or 4- lBB-binding polypeptide.
  • “Isoelectric point” or “pi” is the pH at which net charge is zero.
  • the isoelectric point of a protein may be measured by any suitable method, e.g., analytical capillary isoelectric focusing chromatography.
  • polypeptides and proteins described herein may bind to 5T4 (e.g., human 5T4) and/or 4- IBB with a higher affinity than a previously known 5T4- and/or 4-lBB-binding domains and/or a parent 5T4- and/or 4-lBB-binding domain or protein.
  • the dissociation constant of a 5T4- and/or 4-lBB-binding domain or polypeptide may be about 2-5 nM.
  • the off rate of a 5T4- and/or 4-lBB-binding domain or polypeptide may be 4- to 10-fold reduced compared to the off rate of a previously known antibody or scFv construct or the parent 5T4- and/or 4-lBB-binding domain or protein.
  • polypeptides and proteins described herein may have a low level of high molecular weight aggregates produced during recombinant expression of the polypeptide or protein.
  • polypeptides and proteins described herein may exhibit longer stability in human serum, depending on the combination of domains present in the polypeptide or protein.
  • the present invention provides 5T4-binding domains that specifically bind to 5T4 (e.g. human 5T4).
  • the present invention further provides polypeptides comprising a 5T4-binding domain (e.g., 5T4-binding polypeptides).
  • the 5T4-binding polypeptide comprises a hinge region carboxyl-terminal to the 5T4-binding domain, and an immunoglobulin constant region.
  • the 5T4- binding polypeptide comprises a carboxyl-terminus binding domain linker carboxyl-terminal to the immunoglobulin constant region, and a second binding domain carboxyl-terminal to the carboxyl-terminus linker.
  • a 5T4-binding polypeptide comprises a hinge region amino-terminal to the polypeptide comprising the 5T4-binding domain, and an immunoglobulin constant amino-terminal to the hinge region.
  • the 5T4-binding domains described herein binds an epitope located on the extracellular domain of 5T4 (e.g. , an epitope comprised within SEQ ID NO: 168). In certain aspects, this epitope is a discontinuous and/or conformational epitope.
  • a 5T4-binding domain polypeptide may specifically bind to human 5T4 and comprise a heavy chain CDR1 (HCDRl), HCDR2, HCDR3, light chain CDR1 (LCDRl), LCDR2, and LCDR3, wherein the HCDRl comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 30, 52, and 60; the HCDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 32 and 62; the HCDR3 comprises an amino acid sequence of SEQ ID NO: 34; the LCDRl comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 8, 42, and 54; the LCDR2 comprises an amino acid sequence of SEQ ID NOs: 10; and the LCDR3 comprises an amino acid sequence of SEQ ID NO: 36.
  • HCDRl heavy chain CDR1
  • HCDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 32 and 62
  • the HCDR3 comprises an amino acid sequence of SEQ
  • a 5T4-binding domain polypeptide may specifically bind to human 5T4 and comprise an HCDRl , HCDR2, HCDR3, LCDRl , LCDR2, and LCDR3, wherein (a) the HCDRl comprises an amino acid sequence set forth in SEQ ID NO: 30; (b) the HCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 32; (c) the HCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDRl comprises an amino acid sequence set forth in SEQ ID NO: 8; the LCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 36.
  • a 5T4-binding domain polypeptide specifically binds to human 5T4 and comprises an HCDRl , HCDR2, HCDR3, LCDRl , LCDR2, and LCDR3, wherein (a) the HCDRl comprises an amino acid sequence set forth in SEQ ID NO: 30; (b) the HCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 32; (c) the HCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDRl comprises an amino acid sequence set forth in SEQ ID NO: 42; (e) the LCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 36.
  • a 5T4-binding domain polypeptide specifically binds to human 5T4 and comprises an HCDRl , HCDR2, HCDR3, LCDRl , LCDR2, and LCDR3, wherein (a) the HCDRl comprises an amino acid sequence set forth in SEQ ID NO: 52; (b) the HCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 32; (c) the HCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDRl comprises an amino acid sequence set forth in SEQ ID NO: 54; (e) the LCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 36.
  • a 5T4-binding domain polypeptide specifically binds to human 5T4 and comprises an HCDRl , HCDR2, HCDR3, LCDRl , LCDR2, and LCDR3, wherein (a) the HCDRl comprises an amino acid sequence set forth in SEQ ID NO: 60; (b) the HCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 62; (c) the HCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 34; (d) the LCDRl comprises an amino acid sequence set forth in SEQ ID NO: 54; (e) the LCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 36.
  • a 5T4-binding domain polypeptide comprises or is a sequence that is at least about 85%, at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.5%, or 100% identical to an amino acid sequence of a light chain variable region (VL) selected from the group consisting of SEQ ID NOs: 40, 44, 48, 50, 58, 68, and 70, wherein the polypeptide is a multispecific polypeptide in the format scFv-Fc-scFv and comprises a Y to F substitution in the LCDRl at position 99 of the VL and/or a F to S substitution in the FR3 at position 148 of the VL.
  • VL light chain variable region
  • a polypeptide comprising a 5T4-binding domain comprises an amino acid sequence of a light chain variable region (VL) selected from the group consisting of SEQ ID NOs: 40, 44, 48, 50, 58, 68, and 70.
  • a 5T4-binding domain polypeptide comprises an amino acid sequence of a heavy chain variable region (VH) selected from the group consisting of SEQ ID NOs 38, 46, 56, and 64.
  • VL light chain variable region
  • VH heavy chain variable region
  • a 5T4-binding domain polypeptide comprises a VH region comprising the amino acid sequence of SEQ ID NO: 38 and a VL region comprising the amino acid sequence of SEQ ID NO: 40.
  • a 5T4-binding domain polypeptide comprises a VH region comprising the amino acid sequence of SEQ ID NO: 38 and a VL region comprising the amino acid sequence of SEQ ID NO: 44. In certain embodiments, a 5T4- binding domain polypeptide comprises a VH region comprising the amino acid sequence of SEQ ID NO: 46 and a VL region comprising the amino acid sequence of SEQ ID NO: 48. In certain embodiments, a 5T4-binding domain polypeptide comprises a VH region comprising the amino acid sequence of SEQ ID NO: 46 and a VL region comprising the amino acid sequence of SEQ ID NO: 50.
  • a 5T4-binding domain polypeptide comprises a VH region comprising the amino acid sequence of SEQ ID NO: 56 and a VL region comprising the amino acid sequence of SEQ ID NO: 58. In certain embodiments, a 5T4-binding domain polypeptide comprises a VH region comprising the amino acid sequence of SEQ ID NO: 64 and a VL region comprising the amino acid sequence of SEQ ID NO: 58. In certain embodiments, a 5T4-binding domain polypeptide comprises a VH region comprising the amino acid sequence of SEQ ID NO: 38 and a VL region comprising the amino acid sequence of SEQ ID NO: 68. In certain embodiments, a 5T4-binding domain polypeptide comprises a VH region comprising the amino acid sequence of SEQ ID NO: 46 and a VL region comprising the amino acid sequence of SEQ ID NO: 70.
  • the present invention provides for multispecific polypeptides (e.g., bispecific polypeptides) comprising a 5T4-binding domain.
  • a 5T4-binding protein or polypeptide can comprise one or more additional binding domains (e.g., second binding domain) that bind a target other than 5T4.
  • additional binding domains e.g., second binding domain
  • These other binding domains can comprise, for example, a particular cytokine or a molecule that targets the binding domain polypeptide to, for example, a particular cell type, a toxin, an additional cell receptor, or an antibody.
  • a multispecific 5T4-binding polypeptide or protein may comprise two binding domains (the domains can be designed to specifically bind the same or different targets), a hinge region, a linker (e.g., a carboxyl-terminus or an amino -terminus linker), and an immunoglobulin constant region.
  • a multispecific 5T4-binding protein may be a homodimeric protein comprising two identical, disulfide -bonded polypeptides.
  • the 5T4-binding domains may be derived from a monoclonal antibody that binds to 5T4.
  • a 5T4-binding polypeptide is capable of forming a heterodimer with a second polypeptide chain and comprises a hinge region (a) immediately amino -terminal to an immunoglobulin constant region (e.g., amino-terminal to a CH2 domain wherein the immunoglobulin constant region includes CH2 and CH3 domains, or amino-terminal to a CH3 domain wherein the immunoglobulin sub-regions includes CH3 and CH4 domains), (b) interposed between and connecting a binding domain (e.g., scFv) and a immunoglobulin heterodimerization domain, (c) interposed between and connecting a immunoglobulin heterodimerization domain and an immunoglobulin constant region (e.g., wherein the immunoglobulin constant region includes CH2 and CH3 domains or CH3 and CH4 domains), (d) interposed between and connecting an immunoglobulin constant region and a binding domain, (e) at the amino
  • an immunoglobulin constant region e
  • a polypeptide chain comprising a hinge region as described herein will be capable of associating with a different polypeptide chain to form a heterodimeric protein provided herein, and the heterodimer formed will contain a binding domain that retains its target specificity or its specific target binding affinity.
  • the 5T4-binding polypeptide provided herein is a polypeptide comprising two scFvs.
  • the two scFvs comprise 5T4-binding domains.
  • the two scFvs comprise identical 5T4-binding domains.
  • the two scFvs comprise different 5T4-binding domains.
  • the polypeptide comprises an 5T4-binding domain as a first scFv and an effector cell binding domain as a second scFv.
  • the effector cell binding domain may be an scFv specific for 4- 1BB.
  • a 5T4-binding polypeptide provided herein comprises an anti-5T4 scFv that is at least about 82%, at least about 85%, at least about 87%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 18, 120, 122, 124, 126, 128, 130, 132, 134, and 170, wherein the polypeptide is a multispecific polypeptide in the format scFv-Fc-scFv and comprises a Y to F substitution in the LCDRl at position 99 of the anti-5T4 VL and/or a F to S substitution in the FR3 at position 148 of the anti- 5T4 VL.
  • a 5T4-binding polypeptide provided herein comprises an anti-5T4 scFv that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 118, 120, 122, 124, 126, 128, 130, 132, 134, and 170.
  • Amino acid and nucleic acid sequences for exemplary anti-5T4 scFvs are provided in Table 6 below.
  • a 5T4-binding polypeptide comprises, in order from amino -terminus to carboxyl-terminus (or in order from carboxyl-terminus to amino -terminus), (i) a 5T4-binding domain, (ii) a hinge region, (iii) an immunoglobulin constant region, (iv) a carboxyl- terminus linker (or an amino -terminus linker), and (v) a second binding domain.
  • the second binding domain is an scFv specific for 4-1 BB.
  • a 5T4-binding polypeptide comprises, in order from amino -terminus to carboxyl-terminus (or in order from carboxyl-terminus to amino -terminus), (i) second binding domain, (ii) a hinge region, (iii) an immunoglobulin constant region, (iv) a carboxyl-terminus linker (or an amino-terminus linker), and (v) a 5T4-binding domain.
  • the second binding domain comprises or is a 4-lBB-binding domain.
  • a 5T4-binding protein can comprise an effector-cell binding domain for recruitment of effector to target cells expressing 5T4. In certain embodiments, the effector-cell binding domain specifically binds to 4- IBB.
  • the second binding domain of a 5T4-binding polypeptide described herein is a 4-lBB-binding domain and comprises one ormore ofthe 4-1BB- binding sequences (e.g., CDRs or variable regions) disclosed in PCT Application Publication No WO 2016/185016; PCT Application No . PCT/EP2017/059656; Dubrot et al. , 2010; Gauttier et al.
  • the second binding domain specifically binds 4- IBB and comprises an immunoglobulin light chain variable region (VL) and an immunoglobulin heavy chain variable region (VH); wherein the VL comprises an amino acid sequence that is at least about 93% identical, at least about 95% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 16 and 22; and wherein the VH comprises an amino acid sequence that is at least about 93% identical, at least about 95% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 20, 26, and 28, wherein the polypeptide is a multispecific polypeptide in the format scFv-Fc-scFv and comprises a Y to H substitution in the HCDR1 at position 150 of the V H and/or an R to H substitution
  • the second binding domain specifically binds 4- 1BB and comprises a VL and a VH; wherein the VL comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 16 and 22; and wherein the VH comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 20, 26, and 28.
  • the second binding domain is a 4-lBB-binding domain polypeptide, wherein the polypeptide is an scFv comprising a sequence that is at least about 82%, at least about 85%, at least about 87%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 10, 1 12, 1 14, and 1 16. Exemplary anti-4- 1BB binding domain sequences are shown in Tables 6 and 7 and are discussed further below.
  • the present invention provides 4-lBB-binding domains that specifically bind to 4- IBB ⁇ e.g. human 4-1 BB).
  • 4- IBB is also known as CD 137 or TNFRSF9 and is a member of the tumor necrosis factor (TNF) receptor family.
  • 4-1 BB is expressed on multiple cell types, including activated subsets of T cell (e.g., CD4+ and CD8+ T cells and T regulatory cells (Tregs)), natural killer (NK) cells, dendritic cells, monocytes, mast cells, and eosinophils.
  • 4-1 BB activation on CD8+ T cells sustains and/or augments cellular activation, while 4- IBB activation on CD4+ T cells can initiate cell activation and, in some instance, lead to activation-induced cell death.
  • 4- IBB activation on Tregs generally suppresses Treg function.
  • Exemplary human 4- IBB nucleotide and amino acid sequences are provided in SEQ ID NOs: 163, 167 and SEQ ID NOs: 164 and 166, respectively.
  • the present invention further provides polypeptides comprising a 4-lBB-binding domain (e.g., 4-lBB-binding polypeptides).
  • the 4-lBB-binding polypeptide comprises a hinge region carboxyl-terminal to the 4-lBB-binding domain, and an immunoglobulin constant region.
  • the 4-lBB-binding polypeptide comprises a carboxyl-terminus binding domain linker carboxyl-terminal to the immunoglobulin constant region, and a second binding domain carboxyl-terminal to the carboxyl- terminus linker.
  • a 4-l BB-binding polypeptide comprises a hinge region amino -terminal to the polypeptide comprising the 4-lBB-binding domain, and an immunoglobulin constant amino -terminal to the hinge region.
  • the 4-lBB-binding domains described herein binds an epitope located on the extracellular domain of 4- IBB (e.g., an epitope comprised within SEQ ID NO: 166). In certain aspects, this epitope is a discontinuous and/or conformational epitope.
  • a 4-lBB-binding domain polypeptide may specifically bind to human 4-
  • HCDR1 heavy chain CDR1
  • HCDR2 comprises an amino acid sequence of SEQ ID NO: 4
  • HCDR3 comprises an amino acid sequence of SEQ ID NO: 6
  • the LCDRl comprises an amino acid sequence of SEQ ID NO: 8
  • the LCDR2 comprises an amino acid sequence of SEQ ID NO: 10
  • the LCDR3 comprises an amino acid sequence of SEQ ID NO: 12, wherein the polypeptide is a multispecific polypeptide in the format scFv-Fc-scFv and comprises a Y to H substitution in the HCDRl at position 150 of the anti-4-lBB V H and/or an R to H substitution in the FR3 at position 127 of the anti-4-lBB VH.
  • a 4-lBB-binding domain polypeptide may specifically bind to human 4-1 BB and comprise an HCDRl , HCDR2, HCDR3, LCDRl , LCDR2, and LCDR3, wherein (a) the HCDRl comprises an amino acid sequence set forth in SEQ ID NO: 2; (b) the HCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 4; (c) the HCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 6; (d) the LCDRl comprises an amino acid sequence set forth in SEQ ID NO: 8; the LCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 12.
  • a 5T4-binding domain polypeptide specifically binds to human 5T4 and comprises an HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and LCDR3, wherein (a) the HCDRl comprises an amino acid sequence set forth in SEQ ID NO: 18; (b) the HCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 4; (c) the HCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 6; (d) the LCDRl comprises an amino acid sequence set forth in SEQ ID NO: 8; (e) the LCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 10 and (f) the LCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 12.
  • a 5T4-binding domain polypeptide specifically binds to human 5T4 and comprises an HCDRl, HCDR2, HCDR3, LCDRl, LCDR2, and LCDR3, wherein (a) the HCDRl comprises an amino acid sequence set forth in SEQ ID NO: 24; (b) the HCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 4; (c) the HCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 6; (d) the LCDRl comprises an amino acid sequence set forth in SEQ ID NO: 8; (e) the LCDR2 comprises an amino acid sequence set forth in SEQ ID NO: 10; and (f) the LCDR3 comprises an amino acid sequence set forth in SEQ ID NO: 12.
  • a 4-1 BB-binding domain polypeptide comprises an amino acid sequence of a light chain variable region (VL) selected from the group consisting of SEQ ID NOs: 16 and 22.
  • a 4-lBB-binding domain polypeptide comprises an amino acid sequence that is at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.5%, or 100% identical to an amino acid of a heavy chain variable region (VH) selected from the group consisting of SEQ ID NOs: 14, 20, 26, and 28, wherein the polypeptide is a multispecific polypeptide in the format scFv- Fc-scFv and comprises a Y to H substitution in the HCDR1 at position 150 of the anti-4-lBB VH and/or an R to H substitution in the
  • a 4-1 BB-binding domain polypeptide comprises a
  • a 4-lBB-binding domain polypeptide comprises a VH region comprising the amino acid sequence of SEQ ID NO: 20 and a VL region comprising the amino acid sequence of SEQ ID NO: 22.
  • a 4- lBB-binding domain polypeptide comprises a VH region comprising the amino acid sequence of SEQ ID NO: 26 and a VL region comprising the amino acid sequence of SEQ ID NO: 16.
  • a 4-1 BB-binding domain polypeptide comprises a VH region comprising the amino acid sequence of SEQ ID NO: 28 and a VL region comprising the amino acid sequence of SEQ ID NO: 16.
  • the present invention provides for multispecific polypeptides (e.g., bispecific polypeptides) comprising a 4-l BB-binding domain.
  • multispecific polypeptides e.g., bispecific polypeptides
  • a multispecific polypeptide comprising a 4-l BB-binding domain e.g., bispecific polypeptides
  • 4-lBB-binding polypeptide or protein may comprise two binding domains (the domains can be designed to specifically bind the same or different targets), a hinge region, a linker (e.g., a carboxyl-terminus or an amino -terminus linker), and an immunoglobulin constant region.
  • a multispecific 4-l BB-binding protein may be a homodimeric protein comprising two identical, disulfide -bonded polypeptides.
  • the 4-1BB binding domains may be derived from a monoclonal antibody that binds to 4-1 BB (e.g., Urelumab (BMS-66513) or PF-05082566 (Pfizer)), derived from a 4-lBB-binding domain described in PCT Application Publication No. WO 2016/185016, or derived from a 4-lBB-binding domain PCT Application No. PCT/EP2017/059656.
  • a monoclonal antibody that binds to 4-1 BB e.g., Urelumab (BMS-66513) or PF-05082566 (Pfizer)
  • a multispecific polypeptide comprising a 4-1BB binding domain may comprise, in order from amino-terminus to carboxyl-terminus: (i) a first binding domain; (ii) a hinge region; (iii) an immunoglobulin constant region; (iv) a binding domain linker; and (v) a 4-lBB-binding domain.
  • a multispecific polypeptide comprising a 4-1 BB binding domain may comprise, in order from amino-terminus to carboxyl- terminus: (i) a 4-lBB-binding domain; (ii) a binding domain linker; (iii) an immunoglobulin constant region; (iv) a hinge region; and (v) a first binding domain.
  • Amino acid and nucleic acid sequences for exemplary anti-4-lBB binding domain sequences are provided in Table 7.
  • a 4-lBB-binding protein or polypeptide can comprise one or more additional binding domains (e.g., second binding domain) that bind a target other than 4- IBB.
  • additional binding domains e.g., second binding domain
  • These other binding domains can comprise, for example, a particular cytokine or a molecule that targets the binding domain polypeptide to, for example, a particular cell type, a toxin, an additional cell receptor, or an antibody.
  • a 4-l BB-binding polypeptide is capable of forming a heterodimer with a second polypeptide chain and comprises a hinge region (a) immediately amino -terminal to an immunoglobulin constant region (e.g., amino-terminal to a CH2 domain wherein the immunoglobulin constant region includes CH2 and CH3 domains, or amino-terminal to a CH3 domain wherein the immunoglobulin sub-regions includes CH3 and CH4 domains), (b) interposed between and connecting a binding domain (e.g., scFv) and a immunoglobulin heterodimerization domain, (c) interposed between and connecting a immunoglobulin heterodimerization domain and an immunoglobulin constant region (e.g., wherein the immunoglobulin constant region includes CH2 and CH3 domains or CH3 and CH4 domains), (d) interposed between and connecting an immunoglobulin constant region and a binding domain, (e) at the
  • a polypeptide chain comprising a hinge region as described herein will be capable of associating with a different polypeptide chain to form a heterodimeric protein provided herein, and the heterodimer formed will contain a binding domain that retains its target specificity or its specific target binding affinity.
  • a 4- lBB-binding polypeptide can comprise a target cell binding domain for recruitment of target cells to effector cells expressing 4-1 BB.
  • the target cell binding domain specifically binds to 5T4.
  • a 4-lBB-binding protein as described herein can comprise (i) a binding domain that specifically binds 4- 1 BB and (ii) another binding domain that specifically binds to 5T4.
  • Non-limiting examples of anti-5T4 antibodies from which the 5T4 binding domain can be derived include those described in PCT Application Publication No. WO 2016/185016 and PCT Application No. PCT/EP2017/059656.
  • the 4-lBB-binding polypeptide provided herein is a polypeptide comprising two scFvs.
  • the two scFvs comprise 4-lBB-binding domains.
  • the two scFvs comprise identical 4-lBB-binding domains.
  • the two scFvs comprise different 4-lBB-binding domains.
  • the polypeptide comprises a 4-lBB-binding domain as a first scFv and an target cell binding domain as a second scFv.
  • the target cell binding domain may be an scFv specific for 5T4.
  • the bispecific 4-lBB-binding polypeptides and proteins provided herein comprise an anti-4-lBB scFv that is at least about 82%, at least about 85%, at least about 87%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 10, 112, 1 14, and 116, wherein the polypeptide is a multispecific polypeptide in the format scFv-Fc-scFv and comprises a Y to H substitution in the HCDR1 at position 150 of the anti-4-lBB V H and/or an R to H substitution in the FR3 at position 127 of the anti-4-lBB VH.
  • the bispecific 4-lBB-binding polypeptides and proteins provided herein comprise an anti-4-lBB scFv that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 10, 112, 1 14, and 1 16. Amino acid and nucleic acid sequences for exemplary anti-4-lBB scFvs are provided in Table 8 below.
  • the present invention provides multispecific 5T4- binding polypeptides comprising two binding domains wherein one binding domain is specific for 5T4 and the second binding domain is specific for a different target antigen.
  • the present invention provides bispecific 4-lBB-binding polypeptides comprising two binding domains wherein binding domain is specific for 4- IBB and the second binding domain is specific for a different target antigen.
  • the present invention provides bispecific polypeptides comprising two binding domains, wherein one binding domain is specific for 4- IBB and wherein the other binding domain is specific for 5T4.
  • anti-5T4 x anti-4-lBB molecules or anti-5T4 x anti-4-lBB polypeptides or proteins.
  • the 5T4 and 4-1 BB binding domains of an anti-5T4 x anti-4-lBB molecule are scFv domains that specifically bind to 5T4 and 4-1BB, respectively.
  • the anti-5T4 x anti-4-lBB molecules described herein comprise in order from amino -terminus to carboxyl-terminus (i) a 5T4-binding domain; (ii) a binding domain linker; and (iii) a 4-lBB-binding domain. In some embodiments, the anti-5T4 x anti-4-lBB molecules described herein comprise in order from amino -terminus to carboxyl- terminus (i) a 4-lBB-binding domain; (ii) a binding domain linker; and (iii) a 5T4-binding domain.
  • the anti-5T4 x anti-4-lBB molecules described herein comprise in order from amino -terminus to carboxyl-terminus (or in order from carboxyl-terminus to amino- terminus), (i) a 5T4-binding domain, (ii) a hinge region, (iii) an immunoglobulin constant region, (iv) a carboxyl-terminus linker (or an amino -terminus linker), and (v) a second binding domain.
  • the anti-5T4 x anti-4-lBB molecules described herein may comprise any combination of the anti-5T4 and the anti-4-lBB binding domain sequences shown in Tables 4 - 7.
  • the anti-5T4 x anti-4-1 BB molecules of the present invention comprise a 5T4-binding domain and a 4-lBB-binding domain that each comprise a HCDRl , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3.
  • the anti-5T4 x anti-4-lBB molecules comprise (a) a first scFv domain comprising: (i) VH comprising an HCDRl amino acid sequence selected from the group consisting of SEQ ID NOs: 30, 52, and 60, an HCDR2 amino acid sequence selected from the group consisting of SEQ ID NOs: 32 and 62, and an HCDR3 amino acid sequence of SEQ ID NO: 34; and (ii) a VL comprising an LCDR1 amino acid sequence selected from the group consisting of SEQ ID NOs: 8, 42, and 54, an LCDR2 amino acid sequence of SEQ ID NO: 10, and an LCDR3 amino acid sequence of SEQ ID NO: 36; and (b) a second scFv domain comprising (i) a VH comprising an HCDRl amino acid sequence selected from the group consisting of SEQ ID NOs: 2, 18, and 24, an HCDR2 amino acid sequence of SEQ ID NO: 4, and an HCDR3 amino acid sequence of SEQ ID
  • the anti-5T4 x anti-4-lBB molecules of the present invention comprise a 5T4-binding domain and a 4-lBB-binding domain that each comprise a VH and a VL domain.
  • the anti-5T4 x anti-4-lBB molecules comprise a first scFv domain comprising i) a VH comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 38, 46, 56, and 64 and a VL comprising an amino acid selected from the group consisting of SEQ ID NOs: 40, 44, 48, 50 58, 66, 68, and 70; and a second scFv domain comprising ii) a VH comprising an amino acid selected from the group consisting of SEQ ID NO: 14, 20, 26, and 28 and a VL comprising an amino acid selected from the group consisting of SEQ ID NO: 16 and 22.
  • 1BB molecule comprises or is an scFv that is at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.5%, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 18, 120, 122, 124, 126, 128, 130, 132, 134, and 170, wherein the molecule is a multispecific polypeptide in the format scFv- Fc-scFv and comprises a Y to F substitution in the LCDRl at position 99 of the anti-5T4 VL and/or a F to S substitution in the FR3 at position 148 of the anti-5T4 VL.
  • the 5T4-binding domain of an anti-5T4 x anti-4-lBB molecule comprises an scFv that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 18, 120, 122, 124, 126, 128, 130, 132, 134, and 170.
  • 4- IBB molecule comprises or is an scFv that is at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.5%, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 110, 112, 114, and 1 16, wherein the molecule is a multispecific polypeptide in the format scFv-Fc-scFv and comprises a Y to H substitution in the HCDRl at position 150 of the anti-4-lBB V H and/or an R to H substitution in the FR3 at position 127 of the anti-4-lBB VH.
  • the 4-1BB- binding domain of an anti-5T4 x anti-4-lBB molecule comprises scFv that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 110, 112, 114,
  • the anti-5T4 x anti-4-lBB molecule comprises a combination of CDR sequences, VH VL sequences, and/or scFv sequences as shown in Table 9 below.
  • ALG.APV-179, ALG.APV-209, ALG.APV-222 (scFv-Fc- scFv Format)
  • the anti-5T4 x anti-4-lBB molecules described herein may comprise an amino acid sequence that is at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.5%, or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 172, 174, and 176.
  • the anti-5T4 x anti-4-lBB molecules described herein may comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 172, 174, and 176.
  • Exemplary amino acid and nucleic acid sequences for the anti-5T4 x anti-4-lBB molecules described herein are provided in Tables 10 and 11. In each of Tables 10 and 11 , immunoglobulin Fc domains (hinge - CHI - CH2) are indicated in underlined text, and binding domain linker sequences are indicated in bolded text.
  • ALG.APV-178 ATGGAAGCACCAGCGCAGCTTCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCA 135
  • ALG.APV-191 ATGGAAGCACCAGCGCAGCTTCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCA 141
  • ALG.APV-196 ATGGAAGCACCAGCGCAGCTTCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCA 143
  • ALG.APV-208 ATGGAAGCACCAGCGCAGCTTCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCA 175
  • ALG.APV-209 ATGGAAGCACCAGCGCAGCTTCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCA 171
  • ALG.APV-222 CCGGTGAGGTGCAGCTGTTGGAGAGCGGGGGAGGCTTGGTACAGCCTGGGGGGTC
  • ALG.APV-210 ATGGAAGCACCAGCGCAGCTTCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCA 173
  • ALG.APV-223 CCGGTGAGGTGCAGCTGTTGGAGAGCGGGGGAGGCTTGGTACAGCCTGGGGGGTC
  • ALG.APV-014 ATGGAAGCACCAGCGCAGCTTCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCA 153
  • ALG.APV-018 ATGGAAGCACCAGCGCAGCTTCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCA 155
  • ALG.APV-178 MEAPAQLLFLLLLWLPDTTGEVQLLESGGGLVQPGGSLRLSCAASGFTFSHGSMY 136
  • ALG.APV-196 MEAPAQLLFLLLLWLPDTTGEVQLLESGGGLVQPGGSLRLSCAASGFTFSYGSMY 144
  • ALG.APV-210 MEAPAQLLFLLLLWLPDTTGEVQLLESGGGLVQPGGSLRLSCAASGFTFSHGSMY 174
  • ALG.APV-223 WVRQAPGKGLEWVSSISSGSGSTYYADSVKGRFTISHDNSKNTLYLQMNSLRAED
  • ALG.APV-006 MEAPAQLLFLLLLWLPDTTGEVQLLESGGGLVQPGGSLRLSCAASGFTFSYGSMY 150
  • ALG.APV-014 MEAPAQLLFLLLLWLPDTTGEVQLLESGGGLVQPGGSLRLSCAASGFTFSYGSMY 154
  • the disclosure also includes nucleic acids (e.g., DNA or R A) encoding the polypeptides of the present disclosure (e.g., 5T4-binding polypeptides, 4-lBB-binding polypeptides, and/or multispecific binding proteins thereof) or one or more polypeptide chains of a polypeptide as described herein.
  • Nucleic acids of the disclosure include nucleic acids having a region that is substantially identical to a polynucleotide as listed in Tables 1 - 10, infra.
  • a nucleic acid in accordance with the present disclosure has at least 80%, typically at least about 90%, and more typically at least about 95% or at least about 98% identity to a polypeptide-encoding polynucleotide as listed in Tables 1 - 10, wherein the nucleic acid encodes a polypeptide that is a multispecific polypeptide in the format scFv-Fc-scFv and wherein the encoded polypeptide comprises one or more of (1) a Y to F substitution in the LCDR1 at position 99 of the anti-5T4 V L ; (2) a F to S substitution in the FR3 at position 148 of the anti-5T4 V L ; (3) a Y to H substitution in the HCDR1 at position 150 of the anti-4-lBB V H ; and (4) an R to H substitution in the FR3 at position 127 of the anti-4-lBB VH.
  • Nucleic acids of the disclosure also include complementary nucleic acids.
  • the sequences will be fully complementary (no mismatches) when aligned. In other instances, there can be up to about a 20% mismatch in the sequences.
  • nucleic acids encoding both first and second polypeptide chains of a bispecific protein of the disclosure are provided. The nucleic acid sequences provided herein can be exploited using codon optimization, degenerate sequence, silent mutations, and other DNA techniques to optimize expression in a particular host, and the present disclosure encompasses such sequence modifications.
  • the disclosure relates to an isolated nucleic acid molecule encoding polypeptides of the present disclosure (e.g., 5T4-binding polypeptides, 4-lBB-binding polypeptides, and/or multispecific binding proteins thereof), wherein said nucleic acid molecule comprises a nucleotide sequence selected from SEQ ID NOs: 109, 1 1 1 , 1 13, 1 15, 1 17, 1 19, 121 , 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 171, 173, and 175.
  • polypeptides of the present disclosure e.g., 5T4-binding polypeptides, 4-lBB-binding polypeptides, and/or multispecific binding proteins thereof
  • said nucleic acid molecule comprises a nucleotide sequence selected from SEQ ID NOs: 109, 1 1 1 , 1 13, 1 15, 1 17, 1 19, 121
  • Polynucleotide molecules comprising a desired polynucleotide sequence are propagated by placing the molecule in a vector.
  • Viral and non-viral vectors are used, including plasmids.
  • the choice of plasmid will depend on the type of cell in which propagation is desired and the purpose of propagation. Certain vectors are useful for amplifying and making large amounts of the desired DNA sequence.
  • Other vectors are suitable for expression in cells in culture.
  • Still other vectors are suitable for transfer and expression in cells in a whole animal or person. The choice of appropriate vector is well within the skill of the art. Many such vectors are available commercially.
  • the partial or full-length polynucleotide is inserted into a vector typically by means of DNA ligase attachment to a cleaved restriction enzyme site in the vector.
  • the desired nucleotide sequence can be inserted by homologous recombination in vivo. Typically this is accomplished by attaching regions of homology to the vector on the flanks of the desired nucleotide sequence. Regions of homology are added by ligation of oligonucleotides, or by polymerase chain reaction using primers comprising both the region of homology and a portion of the desired nucleotide sequence, for example.
  • an expression cassette or system may be employed.
  • a nucleic acid molecule encoding the polypeptide operably linked to regulatory sequences that control transcriptional expression in an expression vector, is introduced into a host cell.
  • expression vectors can include translational regulatory sequences and a marker gene which is suitable for selection of cells that carry the expression vector.
  • the gene product encoded by a polynucleotide of the disclosure is expressed in any convenient expression system, including, for example, bacterial, yeast, insect, amphibian and mammalian systems.
  • the polypeptide -encoding polynucleotide is linked to a regulatory sequence as appropriate to obtain the desired expression properties.
  • a regulatory sequence as appropriate to obtain the desired expression properties.
  • These can include promoters, enhancers, terminators, operators, repressors, and inducers.
  • the promoters can be regulated (e.g., the promoter from the steroid inducible pIND vector (Invitrogen)) or constitutive (e.g., promoters from CMV, SV40, Elongation Factor, or LTR sequences). These are linked to the desired nucleotide sequence using the techniques described above for linkage to vectors. Any techniques known in the art can be used.
  • the expression vector will generally provide a transcriptional and translational initiation region, which can be inducible or constitutive, where the coding region is operably linked under the transcriptional control of the transcriptional initiation region, and a transcriptional and translational termination region.
  • An expression cassette (“expression unit”) can be introduced into a variety of vectors, e.g., plasmid, BAC, YAC, bacteriophage such as lambda, PI, M13, etc., plant or animal viral vectors (e.g., retro viral-based vectors, adenovirus vectors), and the like, where the vectors are normally characterized by the ability to provide selection of cells comprising the expression vectors.
  • the vectors can provide for extrachromosomal maintenance, particularly as plasmids or viruses, or for integration into the host chromosome. Where extrachromosomal maintenance is desired, an origin sequence is provided for the replication of the plasmid, which can be low- or high copy-number.
  • markers are available for selection, particularly those which protect against toxins, more particularly against antibiotics.
  • the particular marker that is chosen is selected in accordance with the nature of the host, where, in some cases, complementation can be employed with auxotrophic hosts.
  • Introduction of the DNA construct can use any convenient method, including, e.g., conjugation, bacterial transformation, calcium-precipitated DNA, electroporation, fusion, transfection, infection with viral vectors, biolistics, and the like.
  • the disclosure relates to an expression vector comprising a nucleic acid segment, wherein said nucleic acid segment may comprise a nucleotide sequence selected from SEQ ID Os: 109, 11 1, 1 13, 115, 1 17, 1 19, 121 , 123, 125, 127, 129, 131, 133, 135, 137, 139, 141 , 143, 145, 147, 149, 151, 153, 155, 171, 173, and 175.
  • proteins for use within the present disclosure can be produced in genetically engineered host cells according to conventional techniques.
  • Suitable host cells are those cell types that can be transformed or transfected with exogenous DNA and grown in culture, and include bacteria, fungal cells, and cultured higher eukaryotic cells (including cultured cells of multicellular organisms), particularly cultured mammalian cells.
  • an expression vector will generally include a nucleic acid segment encoding the binding polypeptide, operably linked to a promoter.
  • the first and second polypeptide chains can be co-expressed from separate vectors in the host cell for expression of the entire heterodimeric protein.
  • the first and second polypeptide chains are co-expressed from separate expression units in the same vector in the host cell for expression of the entire heterodimeric protein.
  • the expression vector(s) are transferred to a host cell by conventional techniques, and the transfected cells are then cultured by conventional techniques to produce the encoded polypeptide(s) to produce the corresponding binding proteins (e.g., 5T4- binding polypeptides, 4-lBB-binding polypeptides, and/or multispecific binding proteins thereof).
  • binding proteins e.g., 5T4- binding polypeptides, 4-lBB-binding polypeptides, and/or multispecific binding proteins thereof.
  • a secretory signal sequence (also known as a leader sequence) is provided in the expression vector.
  • the secretory signal sequence can be that of the native form of the recombinant protein, or can be derived from another secreted protein or synthesized de novo.
  • the secretory signal sequence is operably linked to the polypeptide-encoding DNA sequence, i.e., the two sequences are joined in the correct reading frame and positioned to direct the newly synthesized polypeptide into the secretory pathway of the host cell.
  • Secretory signal sequences are commonly positioned 5' to the DNA sequence encoding the polypeptide of interest, although certain signal sequences can be positioned elsewhere in the DNA sequence of interest (see, e.g., U.S. Patent Nos. 5,037,743 and 5,143,830).
  • Cultured mammalian cells are suitable hosts for production of recombinant polypeptides and proteins of the present disclosure (e.g., 5T4-binding polypeptides, 4-1BB- binding polypeptides, and/or multispecific binding proteins thereof) for use within the present disclosure.
  • Methods for introducing exogenous DNA into mammalian host cells include calcium phosphate-mediated transfection (Wigler et al, Cell 14:725, 1978; Corsaro and Pearson, Somatic Cell Genetics 7:603, 1981 : Graham and Van der Eb, Virology 52:456, 1973), electroporation (Neumann et al, EMBO J.
  • suitable mammalian host cells include African green monkey kidney cells (Vero; ATCC CRL 1587), human embryonic kidney cells (293-HEK; ATCC CRL 1573), baby hamster kidney cells (BHK-21 , BHK-570; ATCC CRL 8544, ATCC CRL 10314), canine kidney cells (MDCK; ATCC CCL 34), Chinese hamster ovary cells (CHO-K1 ; ATCC CCL61 ; CHO DG44; CHO DXB 1 1 (Hyclone, Logan, UT); see also, e.g., Chasin et al, Som. Cell. Molec. Genet.
  • Vero African green monkey kidney cells
  • human embryonic kidney cells (293-HEK; ATCC CRL 1573
  • baby hamster kidney cells BHK-21 , BHK-570; ATCC CRL 8544, ATCC CRL 10314
  • canine kidney cells MDCK; ATCC CCL 34
  • Chinese hamster ovary cells CHO-K1
  • GH1 rat pituitary cells
  • H-4-II-E rat hepatoma cells
  • COS-1 SV40-transformed monkey kidney cells
  • IH-3T3 ATCC CRL 1658
  • Additional suitable cell lines are known in the art and available from public depositories such as the American Type Culture Collection, Manassas, Virginia. Strong transcription promoters can be used, such as promoters from SV-40 or cytomegalovirus. See, e.g., U.S . Patent No. 4,956,288.
  • Other suitable promoters include those from metallothionein genes (U.S. Patents Nos. 4,579,821 and 4,601 ,978) and the adenovirus major late promoter.
  • Drug selection is generally used to select for cultured mammalian cells into which foreign DNA has been inserted. Such cells are commonly referred to as “transfectants.” Cells that have been cultured in the presence of the selective agent and are able to pass the gene of interest to their progeny are referred to as “stable transfectants.”
  • Exemplary selectable markers include a gene encoding resistance to the antibiotic neomycin, which allows selection to be carried out in the presence of a neomycin-type drug, such as G-418 or the like; the gpt gene for xanthine- guanine phosphoribosyl transferase, which permits host cell growth in the presence of mycophenolic acid/xanthine; and markers that provide resistance to zeocin, bleomycin, blastocidin, and hygromycin (see, e.g., Gatignol et al., Mol.
  • Amplification is carried out by culturing transfectants in the presence of a low level of the selective agent and then increasing the amount of selective agent to select for cells that produce high levels of the products of the introduced genes.
  • An exemplary amplifiable selectable marker is dihydrofolate reductase, which confers resistance to methotrexate.
  • Other drug resistance genes e.g., hygromycin resistance, multi-drug resistance, puromycin acetyltransferase
  • drug resistance genes e.g., hygromycin resistance, multi-drug resistance, puromycin acetyltransferase
  • Other higher eukaryotic cells can also be used as hosts, including insect cells, plant cells and avian cells.
  • Agrobacterium rhizogenes as a vector for expressing genes in plant cells has been reviewed by Sinkar et al., J. Biosci. (Bangalore) 11 :47-58, 1987. Transformation of insect cells and production of foreign polypeptides therein is disclosed in U.S. Patent No. 5,162,222 and PCT Publication No. WO 94/06463.
  • Insect cells can be infected with recombinant baculovirus, commonly derived from Autographa californica nuclear polyhedrosis virus (AcNPV). See King and Possee, The Baculovirus Expression System: A Laboratory Guide (Chapman & Hall, London); O'Reilly et ai, Baculovirus Expression Vectors: A Laboratory Manual (Oxford University Press., New York 1994); and Baculovirus Expression Protocols. Methods in Molecular Biology (Richardson ed., Humana Press, Totowa, NJ, 1995). Recombinant baculovirus can also be produced through the use of a transposon-based system described by Luckow et al. (J. Virol.
  • This system which utilizes transfer vectors, is commercially available in kit form (BAC-TO-BAC kit; Life Technologies, Gaithersburg, MD).
  • the transfer vector e.g., PFASTBAC1 ; Life Technologies
  • the transfer vector contains a Tn7 transposon to move the DNA encoding the protein of interest into a baculovirus genome maintained in E. coli as a large plasmid called a "bacmid.” See Hill-Perkins and Possee, J. Gen. Virol. 71 :971-976, 1990; Bonning et al, J. Gen. Virol. 75:1551-1556, 1994; and Chazenbalk and Rapoport, J. Biol. Chem. 270: 1543-1549, 1995.
  • transfer vectors can include an in-frame fusion with DNA encoding a polypeptide extension or affinity tag as disclosed above.
  • a transfer vector containing a protein-encoding DNA sequence is transformed into E. coli host cells, and the cells are screened for bacmids which contain an interrupted lacZ gene indicative of recombinant baculovirus.
  • the bacmid DNA containing the recombinant baculovirus genome is isolated, using common techniques, and used to transfect Spodoptera frugiperda cells, such as Sf9 cells.
  • Recombinant virus that expresses the protein or interest is subsequently produced.
  • Recombinant viral stocks are made by methods commonly used in the art.
  • the recombinant virus is used to infect host cells, typically a cell line derived from the fall armyworm, Spodoptera frugiperda (e.g., Sf9 or Sf21 cells) or Trichoplusia ni (e.g., HIGH FIVETM cells; Invitrogen, Carlsbad, CA). See generally Glick and Pasternak, Molecular Biotechnology, Principles & Applications of Recombinant DNA (ASM Press, Washington, D.C., 1994). See also U.S. Patent No. 5,300,435. Serum-free media are used to grow and maintain the cells. Suitable media formulations are known in the art and can be obtained from commercial suppliers.
  • the cells are grown up from an inoculation density of approximately 2-5 x 10 5 cells to a density of 1 -2 x 10 6 cells, at which time a recombinant viral stock is added at a multiplicity of infection (MOI) of 0.1 to 10, more typically near 3.
  • MOI multiplicity of infection
  • Fungal cells including yeast cells, can also be used within the present disclosure to produce the polypeptides of the present disclosure (e.g., 5T4-binding polypeptides, 4-lBB-binding polypeptides, and/or multispecific binding proteins thereof).
  • Yeast species of in this regard include, e.g., Saccharomyces cerevisiae, Pichia pastoris, and Pichia methanolica. Methods for transforming S. cerevisiae cells with exogenous DNA and producing recombinant polypeptides therefrom are disclosed by, for example, U.S. Patent Nos. 4,599,311 ; 4,931,373; 4,870,008; 5,037,743; and 4,845,075.
  • Transformed cells are selected by phenotype determined by the selectable marker, commonly drug resistance or the ability to grow in the absence of a particular nutrient (e.g. , leucine).
  • An exemplary vector system for use in Saccharomyces cerevisiae is the POT1 vector system disclosed by Kawasaki et al. (U.S. Patent No. 4,931 ,373), which allows transformed cells to be selected by growth in glucose-containing media.
  • Suitable promoters and terminators foruse in yeast include those from glycolytic enzyme genes (see, e.g., U.S. Patent Nos. 4,599,311 ; 4,615,974; and 4,977,092) and alcohol dehydrogenase genes. See also U.S. Patents Nos.
  • Transformation systems for other yeasts including Hansenula polymorpha, Schizosaccharomyces pombe, Kluyveromyces lactis, Kluyveromyces fragilis, Ustilago maydis, Pichia pastoris, Pichia methanolica, Pichia guillermondii, and Candida maltosa are known in the art. See, e.g., Gleeson et al., J. Gen. Microbiol. 132:3459-3465, 1986; U.S. Patent No. 4,882,279; and Raymond et al, Yeast 14:1 1-23, 1998.
  • Aspergillus cells can be utilized according to the methods of McKnight et al., U.S. Patent No. 4,935,349. Methods for transforming Acremonium chrysogenum are disclosed by Sumino et al., U.S. Patent No. 5,162,228. Methods for transforming Neurospora are disclosed by Lambowitz, U.S. Patent No. 4,486,533. Production of recombinant proteins in Pichia methanolica is disclosed in U.S. Patents Nos. 5,716,808; 5,736,383; 5,854,039; and 5,888,768.
  • Prokaryotic host cells including strains of the bacteria Escherichia coli,
  • Bacillus, and other genera are also useful host cells within the present disclosure to produce, for example, 5T4-binding polypeptides, 4-lBB-binding polypeptides, and/or multispecific binding proteins thereof including anti-5T4 x anti-4-lBB molecules.
  • Techniques for transforming these hosts and expressing foreign DNA sequences cloned therein are well-known in the art (see, e.g., Sambrook and Russell, supra).
  • the protein When expressing a recombinant protein in bacteria such as E. coli, the protein can be retained in the cytoplasm, typically as insoluble granules, or can be directed to the periplasmic space by a bacterial secretion sequence.
  • the cells are lysed, and the granules are recovered and denatured using, for example, guanidine isothiocyanate or urea.
  • the denatured protein can then be refolded and dimerized by diluting the denaturant, such as by dialysis against a solution of urea and a combination of reduced and oxidized glutathione, followed by dialysis against a buffered saline solution.
  • the protein can be recovered from the cytoplasm in soluble form and isolated without the use of denaturants.
  • the protein is recovered from the cell as an aqueous extract in, for example, phosphate buffered saline.
  • the extract is applied directly to a chromatographic medium, such as an immobilized antibody or heparin-Sepharose column.
  • Secreted proteins can be recovered from the periplasmic space in a soluble and functional form by disrupting the cells (by, for example, sonication or osmotic shock) to release the contents of the periplasmic space and recovering the protein, thereby obviating the need for denaturation and refolding.
  • Antibodies including single- chain antibodies, can be produced in bacterial host cells according to known methods. See, e.g., Bird et al, Science 242:423-426, 1988; Huston et al, Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988; and Pantoliano et al., Biochem. 30: 10117-10125, 1991.
  • Transformed or transfected host cells to produce the polypeptides and proteins of the present disclosure are cultured according to conventional procedures in a culture medium containing nutrients and other components required for the growth of the chosen host cells.
  • suitable media including defined media and complex media, are known in the art and generally include a carbon source, a nitrogen source, essential amino acids, vitamins and minerals. Media can also contain such components as growth factors or serum, as required.
  • the growth medium will generally select for cells containing the exogenously added DNA by, for example, drug selection or deficiency in an essential nutrient which is complemented by the selectable marker carried on the expression vector or co-transfected into the host cell.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Cell Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Epidemiology (AREA)
  • Plant Pathology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/EP2018/069850 2017-07-20 2018-07-20 BINDING PROTEINS BINDING AT 5T4 AND 4-1BB, COMPOSITIONS AND METHODS RELATED THERETO Ceased WO2019016402A1 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
KR1020207004833A KR102649757B1 (ko) 2017-07-20 2018-07-20 5t4 및 4-1bb에 결합하는 항원 결합 단백질 및 관련 조성물 및 방법
NZ761636A NZ761636A (en) 2017-07-20 2018-07-20 Antigen binding proteins binding to 5t4 and 4-1bb and related compositions and methods
CN201880060362.6A CN111148763B (zh) 2017-07-20 2018-07-20 结合于5t4和4-1bb的抗原结合蛋白以及相关组合物和方法
IL272103A IL272103B2 (en) 2017-07-20 2018-07-20 Antigen binding proteins binding to 5T4 and 4-1BB and related compositions and methods of treating cancer
BR112020001180-0A BR112020001180A2 (pt) 2017-07-20 2018-07-20 proteínas de ligação a antígenos que se ligam a 5t4 e 4-1bb e composições e métodos relacionados
EP18750355.2A EP3655439A1 (en) 2017-07-20 2018-07-20 Antigen binding proteins binding to 5t4 and 4-1bb and related compositions and methods
US16/632,144 US11725060B2 (en) 2017-07-20 2018-07-20 Antigen binding proteins binding to 5T4 and 4-1BB and related compositions and methods
MX2020000583A MX2020000583A (es) 2017-07-20 2018-07-20 Proteínas de fijación al antígeno que se fijan a 5t4 y 4-1bb y composiciones y métodos relacionados.
SG11202000503QA SG11202000503QA (en) 2017-07-20 2018-07-20 Antigen binding proteins binding to 5t4 and 4-1bb and related compositions and methods
RU2020102289A RU2804458C2 (ru) 2017-07-20 2018-07-20 Антигенсвязывающие белки, связывающиеся с 5t4 и 4-1bb, и относящиеся к ним композиции и способы
JP2020503056A JP7369113B2 (ja) 2017-07-20 2018-07-20 癌胎児性抗原結合タンパク質、関連する化合物および方法
AU2018304585A AU2018304585B2 (en) 2017-07-20 2018-07-20 Antigen binding proteins binding to 5T4 and 4-1BB and related compositions and methods
CA3070272A CA3070272A1 (en) 2017-07-20 2018-07-20 Antigen binding proteins binding to 5t4 and 4-1bb and related compositions and methods
PH12020500137A PH12020500137A1 (en) 2017-07-20 2020-01-20 Antigen binding proteins binding to 5t4 and 4-1bb and related compositions and methods
CONC2020/0001654A CO2020001654A2 (es) 2017-07-20 2020-02-13 Proteínas de fijación al antígeno que se fijan a 5t4 y 4-1bb y composiciones y métodos relacionados
ZA2020/00961A ZA202000961B (en) 2017-07-20 2020-02-14 Antigen binding proteins binding to 5t4 and 4-1bb and related compositions and methods

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201762535107P 2017-07-20 2017-07-20
US62/535,107 2017-07-20
US201762575820P 2017-10-23 2017-10-23
US62/575,820 2017-10-23
US201862648072P 2018-03-26 2018-03-26
US62/648,072 2018-03-26

Publications (1)

Publication Number Publication Date
WO2019016402A1 true WO2019016402A1 (en) 2019-01-24

Family

ID=63113484

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2018/069850 Ceased WO2019016402A1 (en) 2017-07-20 2018-07-20 BINDING PROTEINS BINDING AT 5T4 AND 4-1BB, COMPOSITIONS AND METHODS RELATED THERETO

Country Status (16)

Country Link
US (3) US11725060B2 (https=)
EP (1) EP3655439A1 (https=)
JP (1) JP7369113B2 (https=)
KR (1) KR102649757B1 (https=)
CN (1) CN111148763B (https=)
AU (1) AU2018304585B2 (https=)
BR (1) BR112020001180A2 (https=)
CA (1) CA3070272A1 (https=)
CO (1) CO2020001654A2 (https=)
IL (1) IL272103B2 (https=)
MX (1) MX2020000583A (https=)
NZ (1) NZ761636A (https=)
PH (1) PH12020500137A1 (https=)
SG (1) SG11202000503QA (https=)
WO (1) WO2019016402A1 (https=)
ZA (1) ZA202000961B (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021020846A1 (en) * 2019-07-26 2021-02-04 Abl Bio Inc. Anti-her2/anti-4-1bb bispecific antibody and use thereof
WO2021020845A1 (en) * 2019-07-26 2021-02-04 Abl Bio Inc. Anti-egfr/anti-4-1bb bispecific antibody and use thereof
US11008399B2 (en) 2018-03-12 2021-05-18 Genmab A/S Antibodies
US11312786B2 (en) 2017-07-20 2022-04-26 Aptevo Research And Development Llc Oncofetal antigen binding proteins and related compositions and methods
JP2022545368A (ja) * 2019-08-12 2022-10-27 アプティーボ リサーチ アンド デベロップメント エルエルシー 4-1bbおよび0x40結合タンパク質ならびに関連する組成物および方法、4-1bbに対する抗体、0x40に対する抗体
RU2831838C2 (ru) * 2019-07-26 2024-12-16 Юхан Корпорейшн Биспецифическое антитело анти-HER2/анти-4-1BB и его применение

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3445788B1 (en) 2016-04-22 2022-01-19 Alligator Bioscience AB Novel bispecific polypeptides against cd137
KR20230166145A (ko) * 2017-03-15 2023-12-06 옥스포드 바이오메디카(유케이) 리미티드 방법
EP4155319A4 (en) * 2020-06-30 2024-06-12 Nona Biosciences (Suzhou) Co., Ltd. 4-1BB BINDING PROTEIN AND ITS USE
EP4297786A4 (en) * 2021-02-23 2025-01-22 Pandion Operations, Inc. PD-1 ANTIBODIES, POLYPEPTIDES AND USES THEREOF
EP4346890A4 (en) * 2021-05-28 2025-07-09 Xyone Therapeutics Inc MULTI-SPECIFIC ANTIBODY CONSTRUCTS AGAINST THE MUC1-C/EXTRACELLULAR DOMAIN (MUC1-C/ECD)

Citations (44)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4486533A (en) 1982-09-02 1984-12-04 St. Louis University Filamentous fungi functional replicating extrachromosomal element
US4579821A (en) 1981-11-23 1986-04-01 University Patents, Inc. Control of DNA sequence transcription
US4599311A (en) 1982-08-13 1986-07-08 Kawasaki Glenn H Glycolytic promotersfor regulated protein expression: protease inhibitor
US4601978A (en) 1982-11-24 1986-07-22 The Regents Of The University Of California Mammalian metallothionein promoter system
US4615974A (en) 1981-08-25 1986-10-07 Celltech Limited Yeast expression vectors
US4656134A (en) 1982-01-11 1987-04-07 Board Of Trustees Of Leland Stanford Jr. University Gene amplification in eukaryotic cells
US4661454A (en) 1983-02-28 1987-04-28 Collaborative Research, Inc. GAL1 yeast promoter linked to non galactokinase gene
US4713339A (en) 1983-01-19 1987-12-15 Genentech, Inc. Polycistronic expression vector construction
US4784950A (en) 1985-04-17 1988-11-15 Zymogenetics, Inc. Expression of factor VII activity in mammalian cells
US4845075A (en) 1985-02-25 1989-07-04 Zymogenetics, Inc. Biologically active B-chain homodimers
US4870008A (en) 1983-08-12 1989-09-26 Chiron Corporation Secretory expression in eukaryotes
US4882279A (en) 1985-10-25 1989-11-21 Phillips Petroleum Company Site selective genomic modification of yeast of the genus pichia
US4931373A (en) 1984-05-25 1990-06-05 Zymogenetics, Inc. Stable DNA constructs for expression of α-1 antitrypsin
US4935349A (en) 1986-01-17 1990-06-19 Zymogenetics, Inc. Expression of higher eucaryotic genes in aspergillus
US4956288A (en) 1988-04-22 1990-09-11 Biogen, Inc. Method for producing cells containing stably integrated foreign DNA at a high copy number, the cells produced by this method, and the use of these cells to produce the polypeptides coded for by the foreign DNA
US4977092A (en) 1985-06-26 1990-12-11 Amgen Expression of exogenous polypeptides and polypeptide products including hepatitis B surface antigen in yeast cells
US4990446A (en) 1984-12-06 1991-02-05 Labofina, S.A. Promoters for the expression of foreign genes in yeast, plasmids comprising them, and use thereof for the production of polypeptides
US5037743A (en) 1988-08-05 1991-08-06 Zymogenetics, Inc. BAR1 secretion signal
US5063154A (en) 1987-06-24 1991-11-05 Whitehead Institute For Biomedical Research Pheromone - inducible yeast promoter
US5139936A (en) 1983-02-28 1992-08-18 Collaborative Research, Inc. Use of the GAL1 yeast promoter
US5143830A (en) 1986-05-15 1992-09-01 Holland Ian B Process for the production of a polypeptide
US5162222A (en) 1989-07-07 1992-11-10 Guarino Linda A Use of baculovirus early promoters for expression of foreign genes in stably transformed insect cells or recombinant baculoviruses
US5162228A (en) 1988-12-28 1992-11-10 Takeda Chemical Industries, Ltd. Gylceraldehyde-3-phosphate dehydrogenase gene and promoter
US5283173A (en) 1990-01-24 1994-02-01 The Research Foundation Of State University Of New York System to detect protein-protein interactions
WO1994006463A1 (en) 1992-09-14 1994-03-31 Pfizer Inc Immortalized cells and uses therefor
US5300435A (en) 1991-09-16 1994-04-05 Boyce Thompson Institute For Plant Research, Inc. Trichoplusia ni cell line which supports replication of baculoviruses
WO1997009433A1 (en) 1995-09-06 1997-03-13 Icos Corporation Cell-cycle checkpoint genes
US5716808A (en) 1995-11-09 1998-02-10 Zymogenetics, Inc. Genetic engineering of pichia methanolica
US5736383A (en) 1996-08-26 1998-04-07 Zymogenetics, Inc. Preparation of Pichia methanolica auxotrophic mutants
US5854039A (en) 1996-07-17 1998-12-29 Zymogenetics, Inc. Transformation of pichia methanolica
US5888768A (en) 1996-08-26 1999-03-30 Zymogenetics, Inc. Compositions and methods for producing heterologous polypeptides in Pichia methanolica
US20060051844A1 (en) 2004-09-03 2006-03-09 Heavner George A Human EPO mimetic hinge core mimetibodies, compositions, methods and uses
US7166707B2 (en) 1998-10-23 2007-01-23 Amgen Inc. Modified peptides as therapeutic agents
US20070161080A1 (en) * 1999-11-18 2007-07-12 Oxford Biomedica (Uk) Limited Antibodies
WO2007146968A2 (en) 2006-06-12 2007-12-21 Trubion Pharmaceuticals, Inc. Single-chain multivalent binding proteins with effector function
WO2010003108A2 (en) 2008-07-02 2010-01-07 Trubion Pharmaceuticals, Inc. TNF-α ANTAGONIST MULTI-TARGET BINDING PROTEINS
WO2010040105A2 (en) 2008-10-02 2010-04-08 Trubion Pharmaceuticals, Inc. Cd86 antagonist multi-target binding proteins
WO2013041687A1 (en) * 2011-09-23 2013-03-28 Amgen Research (Munich) Gmbh Bispecific binding molecules for 5t4 and cd3
US20130095097A1 (en) 2009-12-29 2013-04-18 Emergent Product Development Seattle, Llc Polypeptide Heterodimers and Uses Thereof
US20130129723A1 (en) 2009-12-29 2013-05-23 Emergent Product Development Seattle, Llc Heterodimer Binding Proteins and Uses Thereof
WO2016094873A2 (en) 2014-12-12 2016-06-16 Emergent Product Development Seattle, Llc Receptor tyrosine kinase-like orphan receptor 1 binding proteins and related compositions and methods
WO2016185016A1 (en) 2015-05-21 2016-11-24 Alligator Bioscience Ab Novel polypeptides
WO2017053469A2 (en) 2015-09-21 2017-03-30 Aptevo Research And Development Llc Cd3 binding polypeptides
WO2017182672A1 (en) * 2016-04-22 2017-10-26 Alligator Bioscience Ab Novel bispecific polypeptides against cd137

Family Cites Families (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
SE459005B (sv) 1985-07-12 1989-05-29 Aake Rikard Lindahl Saett att framstaella sfaeriska polymerpartiklar
CA2192782C (en) 1995-12-15 2008-10-14 Nobuyuki Takechi Production of microspheres
WO2001056603A1 (en) 2000-02-01 2001-08-09 Tanox, Inc. Cd40-binding apc-activating molecules
JP2003531588A (ja) 2000-04-11 2003-10-28 ジェネンテック・インコーポレーテッド 多価抗体とその用途
SV2007002227A (es) 2004-09-10 2007-03-20 Wyeth Corp Anticuerpos anti-5t4 humanizados y conjugados anticuerpo anti-5t4/calicheamicina ref. 040000-0317637
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
DK2368914T3 (en) 2006-03-10 2019-03-04 Wyeth Llc Anti-5T4 antibodies and uses thereof
MX337040B (es) 2010-09-09 2016-02-09 Pfizer Moleculas de union a 4-1bb.
ES2692268T5 (en) 2011-03-29 2025-02-26 Roche Glycart Ag Antibody fc variants
WO2013026839A1 (en) 2011-08-23 2013-02-28 Roche Glycart Ag Bispecific antibodies specific for t-cell activating antigens and a tumor antigen and methods of use
CA2861491C (en) 2012-02-13 2020-08-25 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
WO2014116846A2 (en) 2013-01-23 2014-07-31 Abbvie, Inc. Methods and compositions for modulating an immune response
AU2015244814B2 (en) 2014-04-07 2020-12-24 Chugai Seiyaku Kabushiki Kaisha Immunoactivating antigen-binding molecule
US20150307620A1 (en) 2014-04-16 2015-10-29 University Of Connecticut Linked immunotherapeutic agonists that costimulate multiple pathways
CN105233291A (zh) 2014-07-09 2016-01-13 博笛生物科技有限公司 用于治疗癌症的联合治疗组合物和联合治疗方法
DK4074735T3 (da) 2014-08-28 2025-07-14 Bioatla Inc Betinget aktive kimæriske antigenreceptorer til modificerede t-celler
SI3242890T1 (sl) 2015-01-08 2020-01-31 BioNTech SE Agonistična sredstva, ki vežejo receptorje TNF
CA2973720A1 (en) 2015-01-14 2016-07-21 Compass Therapeutics Llc Multispecific immunomodulatory antigen-binding constructs
TWI614264B (zh) 2015-05-20 2018-02-11 免疫功坊股份有限公司 含胜肽核的多臂接合物及其應用
US9839687B2 (en) 2015-07-15 2017-12-12 Suzhou M-Conj Biotech Co., Ltd. Acetylenedicarboxyl linkers and their uses in specific conjugation of a cell-binding molecule
AU2018224094B2 (en) 2017-02-24 2025-04-17 Macrogenics, Inc. Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof
EP3655439A1 (en) 2017-07-20 2020-05-27 Aptevo Research and Development LLC Antigen binding proteins binding to 5t4 and 4-1bb and related compositions and methods

Patent Citations (46)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4615974A (en) 1981-08-25 1986-10-07 Celltech Limited Yeast expression vectors
US4579821A (en) 1981-11-23 1986-04-01 University Patents, Inc. Control of DNA sequence transcription
US4656134A (en) 1982-01-11 1987-04-07 Board Of Trustees Of Leland Stanford Jr. University Gene amplification in eukaryotic cells
US4599311A (en) 1982-08-13 1986-07-08 Kawasaki Glenn H Glycolytic promotersfor regulated protein expression: protease inhibitor
US4486533A (en) 1982-09-02 1984-12-04 St. Louis University Filamentous fungi functional replicating extrachromosomal element
US4601978A (en) 1982-11-24 1986-07-22 The Regents Of The University Of California Mammalian metallothionein promoter system
US4713339A (en) 1983-01-19 1987-12-15 Genentech, Inc. Polycistronic expression vector construction
US4661454A (en) 1983-02-28 1987-04-28 Collaborative Research, Inc. GAL1 yeast promoter linked to non galactokinase gene
US5139936A (en) 1983-02-28 1992-08-18 Collaborative Research, Inc. Use of the GAL1 yeast promoter
US4870008A (en) 1983-08-12 1989-09-26 Chiron Corporation Secretory expression in eukaryotes
US4931373A (en) 1984-05-25 1990-06-05 Zymogenetics, Inc. Stable DNA constructs for expression of α-1 antitrypsin
US4990446A (en) 1984-12-06 1991-02-05 Labofina, S.A. Promoters for the expression of foreign genes in yeast, plasmids comprising them, and use thereof for the production of polypeptides
US4845075A (en) 1985-02-25 1989-07-04 Zymogenetics, Inc. Biologically active B-chain homodimers
US4784950A (en) 1985-04-17 1988-11-15 Zymogenetics, Inc. Expression of factor VII activity in mammalian cells
US4977092A (en) 1985-06-26 1990-12-11 Amgen Expression of exogenous polypeptides and polypeptide products including hepatitis B surface antigen in yeast cells
US4882279A (en) 1985-10-25 1989-11-21 Phillips Petroleum Company Site selective genomic modification of yeast of the genus pichia
US4935349A (en) 1986-01-17 1990-06-19 Zymogenetics, Inc. Expression of higher eucaryotic genes in aspergillus
US5143830A (en) 1986-05-15 1992-09-01 Holland Ian B Process for the production of a polypeptide
US5063154A (en) 1987-06-24 1991-11-05 Whitehead Institute For Biomedical Research Pheromone - inducible yeast promoter
US4956288A (en) 1988-04-22 1990-09-11 Biogen, Inc. Method for producing cells containing stably integrated foreign DNA at a high copy number, the cells produced by this method, and the use of these cells to produce the polypeptides coded for by the foreign DNA
US5037743A (en) 1988-08-05 1991-08-06 Zymogenetics, Inc. BAR1 secretion signal
US5162228A (en) 1988-12-28 1992-11-10 Takeda Chemical Industries, Ltd. Gylceraldehyde-3-phosphate dehydrogenase gene and promoter
US5162222A (en) 1989-07-07 1992-11-10 Guarino Linda A Use of baculovirus early promoters for expression of foreign genes in stably transformed insect cells or recombinant baculoviruses
US5283173A (en) 1990-01-24 1994-02-01 The Research Foundation Of State University Of New York System to detect protein-protein interactions
US5468614A (en) 1990-01-24 1995-11-21 The Research Foundation Of State University Of New York System to detect protein-protein interactions
US5300435A (en) 1991-09-16 1994-04-05 Boyce Thompson Institute For Plant Research, Inc. Trichoplusia ni cell line which supports replication of baculoviruses
WO1994006463A1 (en) 1992-09-14 1994-03-31 Pfizer Inc Immortalized cells and uses therefor
WO1997009433A1 (en) 1995-09-06 1997-03-13 Icos Corporation Cell-cycle checkpoint genes
US5716808A (en) 1995-11-09 1998-02-10 Zymogenetics, Inc. Genetic engineering of pichia methanolica
US5854039A (en) 1996-07-17 1998-12-29 Zymogenetics, Inc. Transformation of pichia methanolica
US5736383A (en) 1996-08-26 1998-04-07 Zymogenetics, Inc. Preparation of Pichia methanolica auxotrophic mutants
US5888768A (en) 1996-08-26 1999-03-30 Zymogenetics, Inc. Compositions and methods for producing heterologous polypeptides in Pichia methanolica
US7166707B2 (en) 1998-10-23 2007-01-23 Amgen Inc. Modified peptides as therapeutic agents
US20070161080A1 (en) * 1999-11-18 2007-07-12 Oxford Biomedica (Uk) Limited Antibodies
US20060051844A1 (en) 2004-09-03 2006-03-09 Heavner George A Human EPO mimetic hinge core mimetibodies, compositions, methods and uses
WO2007146968A2 (en) 2006-06-12 2007-12-21 Trubion Pharmaceuticals, Inc. Single-chain multivalent binding proteins with effector function
US8409577B2 (en) 2006-06-12 2013-04-02 Emergent Product Development Seattle, Llc Single chain multivalent binding proteins with effector function
WO2010003108A2 (en) 2008-07-02 2010-01-07 Trubion Pharmaceuticals, Inc. TNF-α ANTAGONIST MULTI-TARGET BINDING PROTEINS
WO2010040105A2 (en) 2008-10-02 2010-04-08 Trubion Pharmaceuticals, Inc. Cd86 antagonist multi-target binding proteins
US20130095097A1 (en) 2009-12-29 2013-04-18 Emergent Product Development Seattle, Llc Polypeptide Heterodimers and Uses Thereof
US20130129723A1 (en) 2009-12-29 2013-05-23 Emergent Product Development Seattle, Llc Heterodimer Binding Proteins and Uses Thereof
WO2013041687A1 (en) * 2011-09-23 2013-03-28 Amgen Research (Munich) Gmbh Bispecific binding molecules for 5t4 and cd3
WO2016094873A2 (en) 2014-12-12 2016-06-16 Emergent Product Development Seattle, Llc Receptor tyrosine kinase-like orphan receptor 1 binding proteins and related compositions and methods
WO2016185016A1 (en) 2015-05-21 2016-11-24 Alligator Bioscience Ab Novel polypeptides
WO2017053469A2 (en) 2015-09-21 2017-03-30 Aptevo Research And Development Llc Cd3 binding polypeptides
WO2017182672A1 (en) * 2016-04-22 2017-10-26 Alligator Bioscience Ab Novel bispecific polypeptides against cd137

Non-Patent Citations (59)

* Cited by examiner, † Cited by third party
Title
"Affinity Chromatography: Principles & Methods", 1988, PHARMACIA LKB BIOTECHNOLOGY
"Baculovirus Expression Protocols. Methods in Molecular Biology", 1995, HUMANA PRESS
"Guidance for Industry: Clinical Trial Endpoints for the Approval of Cancer Drugs and Biologics", April 2005, CENTER FOR DRUG EVALUATION AND RESEARCH
"Remington's Pharmaceutical Sciences", 1995, MACK PUBLISHING COMPANY
AUSUBEL ET AL.: "Short Protocols in Molecular Biology", 1999, JOHN WILEY & SONS
BATZER ET AL., NUCLEIC ACID RES., vol. 19, 1991, pages 5081
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BONNING ET AL., J. GEN. VIROL., vol. 75, 1994, pages 1551 - 1556
BOYTON; ALTMANN, CLIN. EXP. IMMUNOL., vol. 149, 2007, pages 1 - 8
BROCHET ET AL., NUCL. ACIDS RES., vol. 36, 2008, pages W503 - 508
CHASIN ET AL., SOM. CELL. MOLEC. GENET., vol. 12, 1986, pages 555
CHAZENBALK; RAPOPORT, J. BIOL. CHEM., vol. 270, 1995, pages 1543 - 1549
CICCARONE ET AL., FOCUS, vol. 15, 1993, pages 80
CO ET AL., J IMMUNOL, vol. 148, 1992, pages 1149 - 1154
CO ET AL., PROC NATL ACAD SCI USA, vol. 88, 1991, pages 2869 - 2873
CORSARO; PEARSON, SOMATIC CELL GENETICS, vol. 7, 1981, pages 603
DROCOURT ET AL., NUCL. ACIDS RES., vol. 18, 1990, pages 4009
GATIGNOL ET AL., MOL. GEN. GENET., vol. 207, 1987, pages 342
GLEESON ET AL., J. GEN. MICROBIOL., vol. 132, 1986, pages 3459 - 3465
GLICK; PASTERNAK: "Molecular Biotechnology, Principles & Applications of Recombinant DNA", 1994, ASM PRESS
GRAHAM; VAN DER EB, VIROLOGY, vol. 52, 1973, pages 456
HAWLEY-NELSON ET AL., FOCUS, vol. 15, 1993, pages 73
HENNECKE ET AL., PROTEIN ENG., vol. 11, 1998, pages 405 - 410
HILL-PERKINS; POSSEE, J. GEN. VIROL., vol. 71, 1990, pages 971 - 976
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
JONES ET AL., NATURE, vol. 321, 1986, pages 522
KABAT: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KARLIN; ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, no. 12, 1993, pages 5873 - 5877
KING; POSSEE: "The Baculovirus Expression System: A Laboratory Guide", CHAPMAN & HALL
LEHNINGER: "Biochemistry", 1975, WORTH PUBLISHERS, INC., pages: 71 - 77
LEWIN: "Genes IV", 1990, OXFORD UNIVERSITY PRESS, NY AND CELL PRESS, pages: 8
LJUNGGREN; MALMBERG, NATURE REV. IMMUNOL., vol. 7, 2007, pages 329 - 339
LUCKOW ET AL., J. VIROL., vol. 67, 1993, pages 4566 - 4579
MARK ET AL.: "Cellular adhesion: molecular definition to therapeutic potential", 1994, PLENUM PRESS, article "Derivation of therapeutically active humanized and veneered anti- CD18 antibodies", pages: 291 - 312
MARLONJ HINNER ET AL: "Costimulatory T cell engagement via a novel bispecific anti-CD137 /anti-HER2 protein", JOURNAL FOR IMMUNOTHERAPY OF CANCER, BIOMED CENTRAL LTD, LONDON, UK, vol. 3, no. 2, 4 November 2015 (2015-11-04), pages 1, XP021235241, DOI: 10.1186/2051-1426-3-S2-P187 *
MARVIN; ZHU, ACTA PHARMACOLOGICA SINICA, vol. 26, 2005, pages 649 - 58
NEUMANN ET AL., EMBO J., vol. 1, 1982, pages 841 - 845
OHTSUKA ET AL., J. BIOL. CHEM., vol. 260, 1985, pages 2605 - 2608
O'REILLY ET AL.: "Baculovirus Expression Vectors: A Laboratory Manual", 1994, OXFORD UNIVERSITY PRESS
PADLAN, MOL. IMMUNOL., vol. 31, 1994, pages 169 - 217
PANTOLIANO ET AL., BIOCHEM., vol. 30, 1991, pages 10117 - 10125
PUTNAM: "The Plasma Proteins", vol. V, 1987, ACADEMIC PRESS, INC., pages: 49 - 140
QUEEN ET AL., PROC NATL ACAD SCI USA, vol. 86, 1989, pages 10029 - 10033
RAVETCH ET AL., ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 92
RAYMOND ET AL., YEAST, vol. 14, 1998, pages 11 - 23
RIDGWAY ET AL., PROTEIN ENGINEERING, vol. 9, 1966, pages 617 - 21
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 337
ROSSOLINI ET AL., MOL. CELL. PROBES, vol. 8, 1994, pages 91 - 98
SAMBROOK; RUSSELL: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
SCATCHARD ET AL., ANN. N.Y. ACAD. SCI., vol. 51, 1949, pages 660
SCOPES: "Protein Purification: Principles and Practice", 1994, SPRINGER-VERLAG
SINKAR ET AL., J. BIOSCI. (BANGALORE, vol. 11, 1987, pages 47 - 58
TANG ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 15682 - 15686
TEMPEST ET AL., BIO/TECHNOL, vol. 9, 1991, pages 266 - 271
THERASSE ET AL., J. NATL. CANCER INST., vol. 92, 2000, pages 205 - 216
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536
VON SCHANTZ: "Screening, Optimization and Characterization of a Novel 4-1BB x 5T4 ADAPTIR(TM) Bispecific Antibody", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, 4 May 2018 (2018-05-04), United States, pages 1 - 1, XP055511291, Retrieved from the Internet <URL:https://alligatorbioscience.se/wp-content/uploads/2018/05/180502_PEGS-Boston-ALGAPV527-Poster_Final.pdf> [retrieved on 20181001], DOI: 10.1073/pnas.1719905115 *
WARD ET AL., THERAP. IMMUNOL., vol. 2, 1995, pages 77 - 94
WIGLER ET AL., CELL, vol. 14, 1978, pages 725

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11312786B2 (en) 2017-07-20 2022-04-26 Aptevo Research And Development Llc Oncofetal antigen binding proteins and related compositions and methods
US11725060B2 (en) 2017-07-20 2023-08-15 Aptevo Reserch and Development LLC Antigen binding proteins binding to 5T4 and 4-1BB and related compositions and methods
US11970544B2 (en) 2018-03-12 2024-04-30 Genmab A/S Antibodies
US11008399B2 (en) 2018-03-12 2021-05-18 Genmab A/S Antibodies
US11130819B2 (en) 2018-03-12 2021-09-28 Genmab A/S Antibodies
RU2831838C2 (ru) * 2019-07-26 2024-12-16 Юхан Корпорейшн Биспецифическое антитело анти-HER2/анти-4-1BB и его применение
CN114206941A (zh) * 2019-07-26 2022-03-18 Abl生物公司 抗her2/抗4-1bb双特异性抗体及其用途
WO2021020845A1 (en) * 2019-07-26 2021-02-04 Abl Bio Inc. Anti-egfr/anti-4-1bb bispecific antibody and use thereof
WO2021020846A1 (en) * 2019-07-26 2021-02-04 Abl Bio Inc. Anti-her2/anti-4-1bb bispecific antibody and use thereof
RU2831836C2 (ru) * 2019-07-26 2024-12-16 ЭйБиЭл БИО ИНК. Биспецифическое антитело анти-egfr/анти-4-1вв и его применение
US12168690B2 (en) 2019-07-26 2024-12-17 Abl Bio Inc. Anti-EGFR/anti-4-1BB bispecific antibody
US12240913B2 (en) 2019-07-26 2025-03-04 Abl Bio Inc. Anti-HER2/anti-4-1BB bispecific antibody and use thereof
JP2022545368A (ja) * 2019-08-12 2022-10-27 アプティーボ リサーチ アンド デベロップメント エルエルシー 4-1bbおよび0x40結合タンパク質ならびに関連する組成物および方法、4-1bbに対する抗体、0x40に対する抗体
JP7691138B2 (ja) 2019-08-12 2025-06-11 アプティーボ リサーチ アンド デベロップメント エルエルシー 4-1bbおよび0x40結合タンパク質ならびに関連する組成物および方法、4-1bbに対する抗体、0x40に対する抗体

Also Published As

Publication number Publication date
IL272103B1 (en) 2024-06-01
US20200223933A1 (en) 2020-07-16
MX2020000583A (es) 2020-09-10
KR102649757B1 (ko) 2024-03-21
CA3070272A1 (en) 2019-01-24
NZ761636A (en) 2023-07-28
KR20200037288A (ko) 2020-04-08
IL272103A (en) 2020-03-31
IL272103B2 (en) 2024-10-01
PH12020500137A1 (en) 2020-11-09
US20190382503A1 (en) 2019-12-19
US10239949B2 (en) 2019-03-26
CO2020001654A2 (es) 2020-08-10
JP7369113B2 (ja) 2023-10-25
ZA202000961B (en) 2024-06-26
US20190016816A1 (en) 2019-01-17
AU2018304585B2 (en) 2023-07-06
JP2020530770A (ja) 2020-10-29
RU2020102289A3 (https=) 2022-01-17
US11725060B2 (en) 2023-08-15
AU2018304585A1 (en) 2020-02-27
SG11202000503QA (en) 2020-02-27
RU2020102289A (ru) 2021-08-24
EP3655439A1 (en) 2020-05-27
US11312786B2 (en) 2022-04-26
CN111148763B (zh) 2023-11-03
CN111148763A (zh) 2020-05-12
BR112020001180A2 (pt) 2020-09-08

Similar Documents

Publication Publication Date Title
US11312786B2 (en) Oncofetal antigen binding proteins and related compositions and methods
US11939392B2 (en) CD123 binding proteins and related compositions and methods
JP7002446B2 (ja) Cd3結合ポリペプチド
EP3464367B1 (en) Bispecific binding proteins binding an immunomodulatory protein and a tumor antigen
AU2012245260B2 (en) Prostate-specific membrane antigen binding proteins and related compositions and methods
JP7087107B2 (ja) Ctla-4に結合する抗体およびその使用
WO2016094873A2 (en) Receptor tyrosine kinase-like orphan receptor 1 binding proteins and related compositions and methods
JP2018531000A6 (ja) Cd3結合ポリペプチド
CN115461366A (zh) 抗ox40抗体及其用途
EP4646442A2 (en) Bispecific pd-l1 and cd40 binding molecules and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18750355

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3070272

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020503056

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020001180

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: NC2020/0001654

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 20207004833

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018750355

Country of ref document: EP

Effective date: 20200220

ENP Entry into the national phase

Ref document number: 2018304585

Country of ref document: AU

Date of ref document: 20180720

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: NC2020/0001654

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112020001180

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20200118

WWG Wipo information: grant in national office

Ref document number: NC2020/0001654

Country of ref document: CO

WWG Wipo information: grant in national office

Ref document number: MX/A/2020/000583

Country of ref document: MX