WO2018236986A1 - Récepteurs de lymphocytes t modifiés et méthodes d'utilisation correspondantes - Google Patents
Récepteurs de lymphocytes t modifiés et méthodes d'utilisation correspondantes Download PDFInfo
- Publication number
- WO2018236986A1 WO2018236986A1 PCT/US2018/038478 US2018038478W WO2018236986A1 WO 2018236986 A1 WO2018236986 A1 WO 2018236986A1 US 2018038478 W US2018038478 W US 2018038478W WO 2018236986 A1 WO2018236986 A1 WO 2018236986A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cell
- polynucleotide
- antigen
- cells
- vector
- Prior art date
Links
- 108091008874 T cell receptors Proteins 0.000 title claims abstract description 163
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 title claims abstract description 152
- 238000000034 method Methods 0.000 title claims abstract description 127
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 70
- 201000010099 disease Diseases 0.000 claims abstract description 60
- 208000015122 neurodegenerative disease Diseases 0.000 claims abstract description 29
- 206010061218 Inflammation Diseases 0.000 claims abstract description 27
- 230000004054 inflammatory process Effects 0.000 claims abstract description 25
- 210000004027 cell Anatomy 0.000 claims description 442
- 239000000427 antigen Substances 0.000 claims description 285
- 108091007433 antigens Proteins 0.000 claims description 285
- 102000036639 antigens Human genes 0.000 claims description 285
- 102000040430 polynucleotide Human genes 0.000 claims description 181
- 108091033319 polynucleotide Proteins 0.000 claims description 181
- 239000002157 polynucleotide Substances 0.000 claims description 181
- 239000013598 vector Substances 0.000 claims description 167
- 108090000623 proteins and genes Proteins 0.000 claims description 114
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 102
- 230000027455 binding Effects 0.000 claims description 79
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 68
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 66
- 239000000203 mixture Substances 0.000 claims description 61
- 102000004127 Cytokines Human genes 0.000 claims description 60
- 108090000695 Cytokines Proteins 0.000 claims description 60
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims description 59
- 230000004044 response Effects 0.000 claims description 54
- 230000014509 gene expression Effects 0.000 claims description 52
- 241000282414 Homo sapiens Species 0.000 claims description 46
- 229920001184 polypeptide Polymers 0.000 claims description 40
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 37
- 239000012634 fragment Substances 0.000 claims description 32
- 230000006870 function Effects 0.000 claims description 31
- 230000028993 immune response Effects 0.000 claims description 30
- 210000000265 leukocyte Anatomy 0.000 claims description 30
- 230000004068 intracellular signaling Effects 0.000 claims description 29
- 230000001105 regulatory effect Effects 0.000 claims description 29
- -1 4- I BB Proteins 0.000 claims description 28
- 239000003550 marker Substances 0.000 claims description 27
- 241001529936 Murinae Species 0.000 claims description 26
- 210000003289 regulatory T cell Anatomy 0.000 claims description 24
- 241000282324 Felis Species 0.000 claims description 22
- 241000282465 Canis Species 0.000 claims description 21
- 230000004770 neurodegeneration Effects 0.000 claims description 21
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 claims description 20
- 208000023275 Autoimmune disease Diseases 0.000 claims description 19
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 19
- 208000018737 Parkinson disease Diseases 0.000 claims description 19
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 19
- 230000000139 costimulatory effect Effects 0.000 claims description 19
- 230000001939 inductive effect Effects 0.000 claims description 19
- 102000005962 receptors Human genes 0.000 claims description 19
- 108020003175 receptors Proteins 0.000 claims description 19
- 108090000174 Interleukin-10 Proteins 0.000 claims description 18
- 206010028980 Neoplasm Diseases 0.000 claims description 18
- 150000001875 compounds Chemical class 0.000 claims description 18
- 230000003247 decreasing effect Effects 0.000 claims description 18
- 230000001404 mediated effect Effects 0.000 claims description 18
- 230000000770 proinflammatory effect Effects 0.000 claims description 18
- 230000001177 retroviral effect Effects 0.000 claims description 18
- 230000028709 inflammatory response Effects 0.000 claims description 17
- 230000003110 anti-inflammatory effect Effects 0.000 claims description 16
- 230000000694 effects Effects 0.000 claims description 16
- 210000003071 memory t lymphocyte Anatomy 0.000 claims description 16
- 239000013603 viral vector Substances 0.000 claims description 15
- 230000004913 activation Effects 0.000 claims description 14
- 239000003623 enhancer Substances 0.000 claims description 14
- 230000001965 increasing effect Effects 0.000 claims description 14
- 230000001717 pathogenic effect Effects 0.000 claims description 14
- 108091033409 CRISPR Proteins 0.000 claims description 13
- 102100028976 HLA class I histocompatibility antigen, B alpha chain Human genes 0.000 claims description 12
- 108090001012 Transforming Growth Factor beta Proteins 0.000 claims description 12
- 102000004887 Transforming Growth Factor beta Human genes 0.000 claims description 12
- 230000004048 modification Effects 0.000 claims description 12
- 238000012986 modification Methods 0.000 claims description 12
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 claims description 12
- 230000003612 virological effect Effects 0.000 claims description 12
- 201000011510 cancer Diseases 0.000 claims description 11
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 claims description 11
- 238000010362 genome editing Methods 0.000 claims description 11
- 238000000338 in vitro Methods 0.000 claims description 11
- 239000003937 drug carrier Substances 0.000 claims description 10
- 239000012636 effector Substances 0.000 claims description 10
- 239000013612 plasmid Substances 0.000 claims description 10
- 238000010354 CRISPR gene editing Methods 0.000 claims description 9
- 102100028972 HLA class I histocompatibility antigen, A alpha chain Human genes 0.000 claims description 9
- 102100028971 HLA class I histocompatibility antigen, C alpha chain Human genes 0.000 claims description 9
- 108010075704 HLA-A Antigens Proteins 0.000 claims description 9
- 108010058607 HLA-B Antigens Proteins 0.000 claims description 9
- 108010052199 HLA-C Antigens Proteins 0.000 claims description 9
- 239000003112 inhibitor Substances 0.000 claims description 9
- 238000000746 purification Methods 0.000 claims description 9
- 230000001225 therapeutic effect Effects 0.000 claims description 9
- 102100028967 HLA class I histocompatibility antigen, alpha chain G Human genes 0.000 claims description 8
- 108010024164 HLA-G Antigens Proteins 0.000 claims description 8
- 206010020751 Hypersensitivity Diseases 0.000 claims description 8
- 102000013691 Interleukin-17 Human genes 0.000 claims description 8
- 108050003558 Interleukin-17 Proteins 0.000 claims description 8
- 108090001005 Interleukin-6 Proteins 0.000 claims description 8
- 101710150875 TAR DNA-binding protein 43 Proteins 0.000 claims description 8
- 102100040347 TAR DNA-binding protein 43 Human genes 0.000 claims description 8
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 8
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 claims description 8
- 208000026935 allergic disease Diseases 0.000 claims description 8
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 claims description 8
- 208000024827 Alzheimer disease Diseases 0.000 claims description 7
- 102100027207 CD27 antigen Human genes 0.000 claims description 7
- 108010058597 HLA-DR Antigens Proteins 0.000 claims description 7
- 102000006354 HLA-DR Antigens Human genes 0.000 claims description 7
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 7
- 239000002245 particle Substances 0.000 claims description 7
- 125000006850 spacer group Chemical group 0.000 claims description 7
- 230000001629 suppression Effects 0.000 claims description 7
- 230000007815 allergy Effects 0.000 claims description 6
- 230000001506 immunosuppresive effect Effects 0.000 claims description 6
- 102000013498 tau Proteins Human genes 0.000 claims description 6
- 238000010361 transduction Methods 0.000 claims description 6
- 230000026683 transduction Effects 0.000 claims description 6
- 206010012289 Dementia Diseases 0.000 claims description 5
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 claims description 5
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 claims description 5
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 claims description 5
- 102000003810 Interleukin-18 Human genes 0.000 claims description 5
- 102000013264 Interleukin-23 Human genes 0.000 claims description 5
- 108010065637 Interleukin-23 Proteins 0.000 claims description 5
- 108090000848 Ubiquitin Proteins 0.000 claims description 5
- 102000044159 Ubiquitin Human genes 0.000 claims description 5
- 230000001580 bacterial effect Effects 0.000 claims description 5
- 230000031990 negative regulation of inflammatory response Effects 0.000 claims description 5
- 102000009410 Chemokine receptor Human genes 0.000 claims description 4
- 108050000299 Chemokine receptor Proteins 0.000 claims description 4
- 108091006020 Fc-tagged proteins Proteins 0.000 claims description 4
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 claims description 4
- 108010010378 HLA-DP Antigens Proteins 0.000 claims description 4
- 102000015789 HLA-DP Antigens Human genes 0.000 claims description 4
- 108090000172 Interleukin-15 Proteins 0.000 claims description 4
- 101800003050 Interleukin-16 Proteins 0.000 claims description 4
- 206010052779 Transplant rejections Diseases 0.000 claims description 4
- 230000001399 anti-metabolic effect Effects 0.000 claims description 4
- 238000012258 culturing Methods 0.000 claims description 4
- 230000002708 enhancing effect Effects 0.000 claims description 4
- 230000002538 fungal effect Effects 0.000 claims description 4
- 239000003862 glucocorticoid Substances 0.000 claims description 4
- 108010074108 interleukin-21 Proteins 0.000 claims description 4
- 230000000813 microbial effect Effects 0.000 claims description 4
- 239000003053 toxin Substances 0.000 claims description 4
- 231100000765 toxin Toxicity 0.000 claims description 4
- 108700012359 toxins Proteins 0.000 claims description 4
- 229940122739 Calcineurin inhibitor Drugs 0.000 claims description 3
- 102100024123 Calcineurin-binding protein cabin-1 Human genes 0.000 claims description 3
- 101710192106 Calcineurin-binding protein cabin-1 Proteins 0.000 claims description 3
- 102100028966 HLA class I histocompatibility antigen, alpha chain F Human genes 0.000 claims description 3
- 102100036241 HLA class II histocompatibility antigen, DQ beta 1 chain Human genes 0.000 claims description 3
- 108010067148 HLA-DQbeta antigen Proteins 0.000 claims description 3
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 claims description 3
- 101000986080 Homo sapiens HLA class I histocompatibility antigen, alpha chain F Proteins 0.000 claims description 3
- 108090000978 Interleukin-4 Proteins 0.000 claims description 3
- 108090001007 Interleukin-8 Proteins 0.000 claims description 3
- 108060008682 Tumor Necrosis Factor Proteins 0.000 claims description 3
- 229940124302 mTOR inhibitor Drugs 0.000 claims description 3
- 239000003628 mammalian target of rapamycin inhibitor Substances 0.000 claims description 3
- 230000035772 mutation Effects 0.000 claims description 3
- 102100037334 E3 ubiquitin-protein ligase CHIP Human genes 0.000 claims description 2
- 102100028970 HLA class I histocompatibility antigen, alpha chain E Human genes 0.000 claims description 2
- 108010062347 HLA-DQ Antigens Proteins 0.000 claims description 2
- 102210029654 HLA-DRB1*07:01 Human genes 0.000 claims description 2
- 101000879619 Homo sapiens E3 ubiquitin-protein ligase CHIP Proteins 0.000 claims description 2
- 101000986085 Homo sapiens HLA class I histocompatibility antigen, alpha chain E Proteins 0.000 claims description 2
- 229940123333 Phosphodiesterase 5 inhibitor Drugs 0.000 claims description 2
- 102100040247 Tumor necrosis factor Human genes 0.000 claims description 2
- 239000002590 phosphodiesterase V inhibitor Substances 0.000 claims description 2
- 101150048775 CDI gene Proteins 0.000 claims 1
- 108010002352 Interleukin-1 Proteins 0.000 claims 1
- 108091014765 tau protein binding proteins Proteins 0.000 claims 1
- 230000009258 tissue cross reactivity Effects 0.000 abstract description 11
- 230000008685 targeting Effects 0.000 abstract description 3
- 102000004169 proteins and genes Human genes 0.000 description 57
- 210000001519 tissue Anatomy 0.000 description 57
- 235000018102 proteins Nutrition 0.000 description 53
- 235000001014 amino acid Nutrition 0.000 description 43
- 229940024606 amino acid Drugs 0.000 description 38
- 150000001413 amino acids Chemical class 0.000 description 38
- 230000011664 signaling Effects 0.000 description 29
- 150000007523 nucleic acids Chemical class 0.000 description 23
- 230000001363 autoimmune Effects 0.000 description 20
- 125000003729 nucleotide group Chemical group 0.000 description 19
- 241000894007 species Species 0.000 description 19
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 18
- 238000005516 engineering process Methods 0.000 description 17
- 208000011580 syndromic disease Diseases 0.000 description 17
- 238000011282 treatment Methods 0.000 description 17
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 16
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 15
- 230000008827 biological function Effects 0.000 description 15
- 239000003795 chemical substances by application Substances 0.000 description 15
- 210000002865 immune cell Anatomy 0.000 description 15
- 239000002773 nucleotide Substances 0.000 description 15
- 108700028369 Alleles Proteins 0.000 description 14
- 230000002757 inflammatory effect Effects 0.000 description 14
- 108020004999 messenger RNA Proteins 0.000 description 14
- 102000039446 nucleic acids Human genes 0.000 description 14
- 108020004707 nucleic acids Proteins 0.000 description 14
- 230000002829 reductive effect Effects 0.000 description 14
- 241000699670 Mus sp. Species 0.000 description 13
- 241000700159 Rattus Species 0.000 description 13
- 241000700605 Viruses Species 0.000 description 13
- 210000003719 b-lymphocyte Anatomy 0.000 description 13
- 238000011161 development Methods 0.000 description 13
- 230000018109 developmental process Effects 0.000 description 13
- 230000009467 reduction Effects 0.000 description 13
- 238000002560 therapeutic procedure Methods 0.000 description 13
- 241000282412 Homo Species 0.000 description 12
- 210000000349 chromosome Anatomy 0.000 description 12
- 230000001684 chronic effect Effects 0.000 description 12
- 210000004698 lymphocyte Anatomy 0.000 description 12
- 208000024891 symptom Diseases 0.000 description 12
- 241000283073 Equus caballus Species 0.000 description 11
- 238000003556 assay Methods 0.000 description 11
- 230000000670 limiting effect Effects 0.000 description 11
- 241000725303 Human immunodeficiency virus Species 0.000 description 10
- 230000001154 acute effect Effects 0.000 description 10
- 238000013459 approach Methods 0.000 description 10
- 238000002659 cell therapy Methods 0.000 description 10
- 208000035475 disorder Diseases 0.000 description 10
- 238000001727 in vivo Methods 0.000 description 10
- 230000003834 intracellular effect Effects 0.000 description 10
- 210000000822 natural killer cell Anatomy 0.000 description 10
- 206010018364 Glomerulonephritis Diseases 0.000 description 9
- 108060003951 Immunoglobulin Proteins 0.000 description 9
- 206010003246 arthritis Diseases 0.000 description 9
- 208000010668 atopic eczema Diseases 0.000 description 9
- 230000006378 damage Effects 0.000 description 9
- 102000018358 immunoglobulin Human genes 0.000 description 9
- 230000008595 infiltration Effects 0.000 description 9
- 238000001764 infiltration Methods 0.000 description 9
- 239000000463 material Substances 0.000 description 9
- 238000004806 packaging method and process Methods 0.000 description 9
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 8
- 102000043129 MHC class I family Human genes 0.000 description 8
- 108091054437 MHC class I family Proteins 0.000 description 8
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 8
- 231100000433 cytotoxic Toxicity 0.000 description 8
- 230000001472 cytotoxic effect Effects 0.000 description 8
- 238000012546 transfer Methods 0.000 description 8
- 208000002267 Anti-neutrophil cytoplasmic antibody-associated vasculitis Diseases 0.000 description 7
- 241000702421 Dependoparvovirus Species 0.000 description 7
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 7
- 230000000172 allergic effect Effects 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 206010025135 lupus erythematosus Diseases 0.000 description 7
- 238000004519 manufacturing process Methods 0.000 description 7
- 210000000056 organ Anatomy 0.000 description 7
- 230000008569 process Effects 0.000 description 7
- 239000000047 product Substances 0.000 description 7
- 238000013518 transcription Methods 0.000 description 7
- 230000035897 transcription Effects 0.000 description 7
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 6
- 108091012583 BCL2 Proteins 0.000 description 6
- 108020004414 DNA Proteins 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 108020005004 Guide RNA Proteins 0.000 description 6
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 6
- 102100039897 Interleukin-5 Human genes 0.000 description 6
- 102000043131 MHC class II family Human genes 0.000 description 6
- 108091054438 MHC class II family Proteins 0.000 description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 description 6
- 239000002585 base Substances 0.000 description 6
- 210000004369 blood Anatomy 0.000 description 6
- 239000008280 blood Substances 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 238000009396 hybridization Methods 0.000 description 6
- 230000006872 improvement Effects 0.000 description 6
- 230000003993 interaction Effects 0.000 description 6
- 208000032839 leukemia Diseases 0.000 description 6
- 239000000546 pharmaceutical excipient Substances 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 230000006641 stabilisation Effects 0.000 description 6
- 238000011105 stabilization Methods 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 235000000346 sugar Nutrition 0.000 description 6
- 150000008163 sugars Chemical class 0.000 description 6
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 208000031212 Autoimmune polyendocrinopathy Diseases 0.000 description 5
- 102000000844 Cell Surface Receptors Human genes 0.000 description 5
- 108010001857 Cell Surface Receptors Proteins 0.000 description 5
- 108091035707 Consensus sequence Proteins 0.000 description 5
- 101150082328 DRB5 gene Proteins 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 5
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 5
- 108010002616 Interleukin-5 Proteins 0.000 description 5
- 101100117569 Oryza sativa subsp. japonica DRB6 gene Proteins 0.000 description 5
- 208000002193 Pain Diseases 0.000 description 5
- 108010029485 Protein Isoforms Proteins 0.000 description 5
- 102000001708 Protein Isoforms Human genes 0.000 description 5
- 201000004681 Psoriasis Diseases 0.000 description 5
- 206010047115 Vasculitis Diseases 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 238000011467 adoptive cell therapy Methods 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 238000004113 cell culture Methods 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 230000001086 cytosolic effect Effects 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- 229940088598 enzyme Drugs 0.000 description 5
- 230000004927 fusion Effects 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 210000000987 immune system Anatomy 0.000 description 5
- 238000011534 incubation Methods 0.000 description 5
- 208000015181 infectious disease Diseases 0.000 description 5
- 210000002540 macrophage Anatomy 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 244000005700 microbiome Species 0.000 description 5
- 201000006417 multiple sclerosis Diseases 0.000 description 5
- 206010028417 myasthenia gravis Diseases 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 108010026424 tau Proteins Proteins 0.000 description 5
- 230000014616 translation Effects 0.000 description 5
- 208000030507 AIDS Diseases 0.000 description 4
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 4
- 108091079001 CRISPR RNA Proteins 0.000 description 4
- 201000004624 Dermatitis Diseases 0.000 description 4
- 241000713730 Equine infectious anemia virus Species 0.000 description 4
- 241000713800 Feline immunodeficiency virus Species 0.000 description 4
- 241000713813 Gibbon ape leukemia virus Species 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 108010066979 Interleukin-27 Proteins 0.000 description 4
- 208000029523 Interstitial Lung disease Diseases 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- 201000009906 Meningitis Diseases 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 241000713869 Moloney murine leukemia virus Species 0.000 description 4
- 241000713862 Moloney murine sarcoma virus Species 0.000 description 4
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- 206010029164 Nephrotic syndrome Diseases 0.000 description 4
- 102000015636 Oligopeptides Human genes 0.000 description 4
- 108010038807 Oligopeptides Proteins 0.000 description 4
- 206010034277 Pemphigoid Diseases 0.000 description 4
- 241000288906 Primates Species 0.000 description 4
- 108020004511 Recombinant DNA Proteins 0.000 description 4
- 241000714474 Rous sarcoma virus Species 0.000 description 4
- 241000713311 Simian immunodeficiency virus Species 0.000 description 4
- 241000713880 Spleen focus-forming virus Species 0.000 description 4
- 206010046851 Uveitis Diseases 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 208000038016 acute inflammation Diseases 0.000 description 4
- 230000006022 acute inflammation Effects 0.000 description 4
- 239000002671 adjuvant Substances 0.000 description 4
- 230000000735 allogeneic effect Effects 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 4
- 230000030741 antigen processing and presentation Effects 0.000 description 4
- 208000006673 asthma Diseases 0.000 description 4
- 150000001720 carbohydrates Chemical class 0.000 description 4
- 235000014633 carbohydrates Nutrition 0.000 description 4
- 206010009887 colitis Diseases 0.000 description 4
- 230000021615 conjugation Effects 0.000 description 4
- 230000007423 decrease Effects 0.000 description 4
- 239000003085 diluting agent Substances 0.000 description 4
- VYFYYTLLBUKUHU-UHFFFAOYSA-N dopamine Chemical compound NCCC1=CC=C(O)C(O)=C1 VYFYYTLLBUKUHU-UHFFFAOYSA-N 0.000 description 4
- 108010078428 env Gene Products Proteins 0.000 description 4
- 230000001900 immune effect Effects 0.000 description 4
- 229940072221 immunoglobulins Drugs 0.000 description 4
- 208000027866 inflammatory disease Diseases 0.000 description 4
- 208000014674 injury Diseases 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 210000004379 membrane Anatomy 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 210000001616 monocyte Anatomy 0.000 description 4
- 201000008383 nephritis Diseases 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 229920001282 polysaccharide Polymers 0.000 description 4
- 208000002574 reactive arthritis Diseases 0.000 description 4
- 206010039073 rheumatoid arthritis Diseases 0.000 description 4
- 230000008961 swelling Effects 0.000 description 4
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 4
- 238000013519 translation Methods 0.000 description 4
- 230000009385 viral infection Effects 0.000 description 4
- 206010001052 Acute respiratory distress syndrome Diseases 0.000 description 3
- 208000009137 Behcet syndrome Diseases 0.000 description 3
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 3
- 206010008609 Cholangitis sclerosing Diseases 0.000 description 3
- 208000002691 Choroiditis Diseases 0.000 description 3
- 208000006344 Churg-Strauss Syndrome Diseases 0.000 description 3
- 208000015943 Coeliac disease Diseases 0.000 description 3
- 206010011715 Cyclitis Diseases 0.000 description 3
- 206010011878 Deafness Diseases 0.000 description 3
- 206010012442 Dermatitis contact Diseases 0.000 description 3
- 208000018428 Eosinophilic granulomatosis with polyangiitis Diseases 0.000 description 3
- 206010016654 Fibrosis Diseases 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 208000024869 Goodpasture syndrome Diseases 0.000 description 3
- 201000005569 Gout Diseases 0.000 description 3
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 3
- 102000008100 Human Serum Albumin Human genes 0.000 description 3
- 108091006905 Human Serum Albumin Proteins 0.000 description 3
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 3
- 102100034353 Integrase Human genes 0.000 description 3
- 102100037850 Interferon gamma Human genes 0.000 description 3
- 108010074328 Interferon-gamma Proteins 0.000 description 3
- 108010065805 Interleukin-12 Proteins 0.000 description 3
- 102100033105 Interleukin-17C Human genes 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- 206010025280 Lymphocytosis Diseases 0.000 description 3
- 206010025323 Lymphomas Diseases 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 241000714177 Murine leukemia virus Species 0.000 description 3
- 201000011152 Pemphigus Diseases 0.000 description 3
- 108010033276 Peptide Fragments Proteins 0.000 description 3
- 102000007079 Peptide Fragments Human genes 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 208000034189 Sclerosis Diseases 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 201000009594 Systemic Scleroderma Diseases 0.000 description 3
- 206010042953 Systemic sclerosis Diseases 0.000 description 3
- 230000005867 T cell response Effects 0.000 description 3
- 102000040945 Transcription factor Human genes 0.000 description 3
- 108091023040 Transcription factor Proteins 0.000 description 3
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 3
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 3
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 3
- 208000036142 Viral infection Diseases 0.000 description 3
- 208000027418 Wounds and injury Diseases 0.000 description 3
- 238000010521 absorption reaction Methods 0.000 description 3
- 210000000612 antigen-presenting cell Anatomy 0.000 description 3
- 201000008937 atopic dermatitis Diseases 0.000 description 3
- 230000005784 autoimmunity Effects 0.000 description 3
- 125000000852 azido group Chemical group *N=[N+]=[N-] 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 230000033228 biological regulation Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 208000037976 chronic inflammation Diseases 0.000 description 3
- 230000006020 chronic inflammation Effects 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 206010014599 encephalitis Diseases 0.000 description 3
- 201000002491 encephalomyelitis Diseases 0.000 description 3
- 210000003979 eosinophil Anatomy 0.000 description 3
- 201000001155 extrinsic allergic alveolitis Diseases 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 102000054766 genetic haplotypes Human genes 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 150000004676 glycans Chemical class 0.000 description 3
- 208000016354 hearing loss disease Diseases 0.000 description 3
- 208000006454 hepatitis Diseases 0.000 description 3
- 208000022098 hypersensitivity pneumonitis Diseases 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 238000007913 intrathecal administration Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 230000002147 killing effect Effects 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 201000005328 monoclonal gammopathy of uncertain significance Diseases 0.000 description 3
- 150000002772 monosaccharides Chemical class 0.000 description 3
- 210000000581 natural killer T-cell Anatomy 0.000 description 3
- 208000008795 neuromyelitis optica Diseases 0.000 description 3
- 238000007899 nucleic acid hybridization Methods 0.000 description 3
- 229920001542 oligosaccharide Polymers 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 208000033808 peripheral neuropathy Diseases 0.000 description 3
- 239000005017 polysaccharide Substances 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 230000002062 proliferating effect Effects 0.000 description 3
- 208000009954 pyoderma gangrenosum Diseases 0.000 description 3
- 238000011808 rodent model Methods 0.000 description 3
- 208000010157 sclerosing cholangitis Diseases 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 208000017520 skin disease Diseases 0.000 description 3
- 210000000130 stem cell Anatomy 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 3
- 241001430294 unidentified retrovirus Species 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- SBZDIRMBQJDCLB-UHFFFAOYSA-N 5-azidopentanoic acid Chemical compound OC(=O)CCCCN=[N+]=[N-] SBZDIRMBQJDCLB-UHFFFAOYSA-N 0.000 description 2
- 241000251468 Actinopterygii Species 0.000 description 2
- 208000009746 Adult T-Cell Leukemia-Lymphoma Diseases 0.000 description 2
- 208000016683 Adult T-cell leukemia/lymphoma Diseases 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 208000032671 Allergic granulomatous angiitis Diseases 0.000 description 2
- 201000004384 Alopecia Diseases 0.000 description 2
- 241000710929 Alphavirus Species 0.000 description 2
- 206010001889 Alveolitis Diseases 0.000 description 2
- 208000035939 Alveolitis allergic Diseases 0.000 description 2
- 206010002198 Anaphylactic reaction Diseases 0.000 description 2
- 244000105975 Antidesma platyphyllum Species 0.000 description 2
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 206010003267 Arthritis reactive Diseases 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 201000002909 Aspergillosis Diseases 0.000 description 2
- 208000036641 Aspergillus infections Diseases 0.000 description 2
- 208000004300 Atrophic Gastritis Diseases 0.000 description 2
- 208000032116 Autoimmune Experimental Encephalomyelitis Diseases 0.000 description 2
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 2
- 108091008875 B cell receptors Proteins 0.000 description 2
- 101150076800 B2M gene Proteins 0.000 description 2
- 208000006373 Bell palsy Diseases 0.000 description 2
- 241000167854 Bourreria succulenta Species 0.000 description 2
- 241000713704 Bovine immunodeficiency virus Species 0.000 description 2
- 102100036301 C-C chemokine receptor type 7 Human genes 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 241000713756 Caprine arthritis encephalitis virus Species 0.000 description 2
- 208000031976 Channelopathies Diseases 0.000 description 2
- 206010008909 Chronic Hepatitis Diseases 0.000 description 2
- 244000089742 Citrus aurantifolia Species 0.000 description 2
- 235000008733 Citrus aurantifolia Nutrition 0.000 description 2
- 101710094648 Coat protein Proteins 0.000 description 2
- 208000011231 Crohn disease Diseases 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- 208000006313 Delayed Hypersensitivity Diseases 0.000 description 2
- 208000016192 Demyelinating disease Diseases 0.000 description 2
- 206010012434 Dermatitis allergic Diseases 0.000 description 2
- 206010012438 Dermatitis atopic Diseases 0.000 description 2
- 206010051392 Diapedesis Diseases 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 208000005373 Dyshidrotic Eczema Diseases 0.000 description 2
- 102220482141 Endothelial differentiation-related factor 1_S87A_mutation Human genes 0.000 description 2
- 206010014950 Eosinophilia Diseases 0.000 description 2
- 206010015150 Erythema Diseases 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 2
- 206010018634 Gouty Arthritis Diseases 0.000 description 2
- 102100029966 HLA class II histocompatibility antigen, DP alpha 1 chain Human genes 0.000 description 2
- 208000018565 Hemochromatosis Diseases 0.000 description 2
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 description 2
- 206010019939 Herpes gestationis Diseases 0.000 description 2
- 101000716065 Homo sapiens C-C chemokine receptor type 7 Proteins 0.000 description 2
- 101001100327 Homo sapiens RNA-binding protein 45 Proteins 0.000 description 2
- 206010020649 Hyperkeratosis Diseases 0.000 description 2
- 208000000038 Hypoparathyroidism Diseases 0.000 description 2
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 2
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 description 2
- 208000010159 IgA glomerulonephritis Diseases 0.000 description 2
- 206010021263 IgA nephropathy Diseases 0.000 description 2
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 2
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 2
- 206010022941 Iridocyclitis Diseases 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- 201000010743 Lambert-Eaton myasthenic syndrome Diseases 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 108010020246 Leucine-Rich Repeat Serine-Threonine Protein Kinase-2 Proteins 0.000 description 2
- 102100032693 Leucine-rich repeat serine/threonine-protein kinase 2 Human genes 0.000 description 2
- 201000001779 Leukocyte adhesion deficiency Diseases 0.000 description 2
- 208000009829 Lewy Body Disease Diseases 0.000 description 2
- 201000002832 Lewy body dementia Diseases 0.000 description 2
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 208000003250 Mixed connective tissue disease Diseases 0.000 description 2
- 208000010190 Monoclonal Gammopathy of Undetermined Significance Diseases 0.000 description 2
- 101100273832 Mus musculus Cds1 gene Proteins 0.000 description 2
- 206010028424 Myasthenic syndrome Diseases 0.000 description 2
- 201000002481 Myositis Diseases 0.000 description 2
- 206010028665 Myxoedema Diseases 0.000 description 2
- 206010029240 Neuritis Diseases 0.000 description 2
- 208000009668 Neurobehavioral Manifestations Diseases 0.000 description 2
- 208000005225 Opsoclonus-Myoclonus Syndrome Diseases 0.000 description 2
- 206010033645 Pancreatitis Diseases 0.000 description 2
- 208000008223 Pemphigoid Gestationis Diseases 0.000 description 2
- 241000721454 Pemphigus Species 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 206010065159 Polychondritis Diseases 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 206010036105 Polyneuropathy Diseases 0.000 description 2
- 208000003971 Posterior uveitis Diseases 0.000 description 2
- 101150111533 Prkn gene Proteins 0.000 description 2
- 102100038823 RNA-binding protein 45 Human genes 0.000 description 2
- 108091030071 RNAI Proteins 0.000 description 2
- 208000033464 Reiter syndrome Diseases 0.000 description 2
- 208000007400 Relapsing-Remitting Multiple Sclerosis Diseases 0.000 description 2
- 208000013616 Respiratory Distress Syndrome Diseases 0.000 description 2
- 208000025747 Rheumatic disease Diseases 0.000 description 2
- 206010039085 Rhinitis allergic Diseases 0.000 description 2
- 108091028664 Ribonucleotide Proteins 0.000 description 2
- 206010040047 Sepsis Diseases 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 206010042033 Stevens-Johnson syndrome Diseases 0.000 description 2
- 206010072148 Stiff-Person syndrome Diseases 0.000 description 2
- 241000193996 Streptococcus pyogenes Species 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- 208000032859 Synucleinopathies Diseases 0.000 description 2
- 230000024932 T cell mediated immunity Effects 0.000 description 2
- 238000010459 TALEN Methods 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 2
- 102000006601 Thymidine Kinase Human genes 0.000 description 2
- 108020004440 Thymidine kinase Proteins 0.000 description 2
- 235000011941 Tilia x europaea Nutrition 0.000 description 2
- 241000723873 Tobacco mosaic virus Species 0.000 description 2
- 108020004566 Transfer RNA Proteins 0.000 description 2
- 208000024780 Urticaria Diseases 0.000 description 2
- 206010047124 Vasculitis necrotising Diseases 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- 241000713325 Visna/maedi virus Species 0.000 description 2
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 210000000577 adipose tissue Anatomy 0.000 description 2
- 201000006966 adult T-cell leukemia Diseases 0.000 description 2
- 201000010105 allergic rhinitis Diseases 0.000 description 2
- 231100000360 alopecia Toxicity 0.000 description 2
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000036783 anaphylactic response Effects 0.000 description 2
- 208000003455 anaphylaxis Diseases 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- 201000004612 anterior uveitis Diseases 0.000 description 2
- 239000004599 antimicrobial Substances 0.000 description 2
- 208000002399 aphthous stomatitis Diseases 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 230000000599 auto-anti-genic effect Effects 0.000 description 2
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 description 2
- 208000027625 autoimmune inner ear disease Diseases 0.000 description 2
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 2
- 230000002567 autonomic effect Effects 0.000 description 2
- 208000002479 balanitis Diseases 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 238000009227 behaviour therapy Methods 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000008512 biological response Effects 0.000 description 2
- 238000007413 biotinylation Methods 0.000 description 2
- 230000006287 biotinylation Effects 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 235000019693 cherries Nutrition 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 208000016644 chronic atrophic gastritis Diseases 0.000 description 2
- 208000024376 chronic urticaria Diseases 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 208000010247 contact dermatitis Diseases 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000004940 costimulation Effects 0.000 description 2
- 201000003278 cryoglobulinemia Diseases 0.000 description 2
- 210000004748 cultured cell Anatomy 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 230000016396 cytokine production Effects 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- GHVNFZFCNZKVNT-UHFFFAOYSA-N decanoic acid Chemical compound CCCCCCCCCC(O)=O GHVNFZFCNZKVNT-UHFFFAOYSA-N 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 201000001981 dermatomyositis Diseases 0.000 description 2
- 206010012601 diabetes mellitus Diseases 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 229960003638 dopamine Drugs 0.000 description 2
- 210000003162 effector t lymphocyte Anatomy 0.000 description 2
- 230000002124 endocrine Effects 0.000 description 2
- 208000030172 endocrine system disease Diseases 0.000 description 2
- 206010014801 endophthalmitis Diseases 0.000 description 2
- 108700004025 env Genes Proteins 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 230000004761 fibrosis Effects 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 201000005206 focal segmental glomerulosclerosis Diseases 0.000 description 2
- 231100000854 focal segmental glomerulosclerosis Toxicity 0.000 description 2
- 230000005021 gait Effects 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000012239 gene modification Methods 0.000 description 2
- 230000009368 gene silencing by RNA Effects 0.000 description 2
- 238000001415 gene therapy Methods 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 230000005017 genetic modification Effects 0.000 description 2
- 235000013617 genetically modified food Nutrition 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- KWIUHFFTVRNATP-UHFFFAOYSA-N glycine betaine Chemical compound C[N+](C)(C)CC([O-])=O KWIUHFFTVRNATP-UHFFFAOYSA-N 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 235000009424 haa Nutrition 0.000 description 2
- 230000010370 hearing loss Effects 0.000 description 2
- 231100000888 hearing loss Toxicity 0.000 description 2
- 210000002443 helper t lymphocyte Anatomy 0.000 description 2
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 2
- 208000007475 hemolytic anemia Diseases 0.000 description 2
- 231100000283 hepatitis Toxicity 0.000 description 2
- 239000000833 heterodimer Substances 0.000 description 2
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 2
- 230000004727 humoral immunity Effects 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 239000001257 hydrogen Substances 0.000 description 2
- 229910052739 hydrogen Inorganic materials 0.000 description 2
- 208000003532 hypothyroidism Diseases 0.000 description 2
- 238000011493 immune profiling Methods 0.000 description 2
- 230000006058 immune tolerance Effects 0.000 description 2
- 230000000984 immunochemical effect Effects 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 208000036971 interstitial lung disease 2 Diseases 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 201000002364 leukopenia Diseases 0.000 description 2
- 239000004571 lime Substances 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 201000008350 membranous glomerulonephritis Diseases 0.000 description 2
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 2
- 230000007659 motor function Effects 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 208000037890 multiple organ injury Diseases 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 208000003786 myxedema Diseases 0.000 description 2
- 210000004296 naive t lymphocyte Anatomy 0.000 description 2
- 230000000926 neurological effect Effects 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 201000001119 neuropathy Diseases 0.000 description 2
- 230000007823 neuropathy Effects 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- 238000007481 next generation sequencing Methods 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 230000000474 nursing effect Effects 0.000 description 2
- WWZKQHOCKIZLMA-UHFFFAOYSA-N octanoic acid Chemical compound CCCCCCCC(O)=O WWZKQHOCKIZLMA-UHFFFAOYSA-N 0.000 description 2
- 238000002515 oligonucleotide synthesis Methods 0.000 description 2
- 150000002482 oligosaccharides Chemical class 0.000 description 2
- 208000005963 oophoritis Diseases 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 201000005737 orchitis Diseases 0.000 description 2
- 210000003463 organelle Anatomy 0.000 description 2
- 201000008482 osteoarthritis Diseases 0.000 description 2
- 208000012111 paraneoplastic syndrome Diseases 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000000816 peptidomimetic Substances 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- 239000008194 pharmaceutical composition Substances 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 210000004180 plasmocyte Anatomy 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 201000006292 polyarteritis nodosa Diseases 0.000 description 2
- 230000007824 polyneuropathy Effects 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 230000035935 pregnancy Effects 0.000 description 2
- 230000002335 preservative effect Effects 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 206010063401 primary progressive multiple sclerosis Diseases 0.000 description 2
- 201000000742 primary sclerosing cholangitis Diseases 0.000 description 2
- 208000005069 pulmonary fibrosis Diseases 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 125000002652 ribonucleotide group Chemical group 0.000 description 2
- 102200033501 rs387907005 Human genes 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 201000000306 sarcoidosis Diseases 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 201000009890 sinusitis Diseases 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 210000002325 somatostatin-secreting cell Anatomy 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 150000005846 sugar alcohols Chemical class 0.000 description 2
- 239000013589 supplement Substances 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 229940113082 thymine Drugs 0.000 description 2
- 210000001541 thymus gland Anatomy 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 230000007704 transition Effects 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 239000000811 xylitol Substances 0.000 description 2
- 235000010447 xylitol Nutrition 0.000 description 2
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 2
- 229960002675 xylitol Drugs 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- HKZAAJSTFUZYTO-LURJTMIESA-N (2s)-2-[[2-[[2-[[2-[(2-aminoacetyl)amino]acetyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoic acid Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O HKZAAJSTFUZYTO-LURJTMIESA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- PLRACCBDVIHHLZ-UHFFFAOYSA-N 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine Chemical compound C1N(C)CCC(C=2C=CC=CC=2)=C1 PLRACCBDVIHHLZ-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- 125000001917 2,4-dinitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C(=C1*)[N+]([O-])=O)[N+]([O-])=O 0.000 description 1
- JEPVUMTVFPQKQE-AAKCMJRZSA-N 2-[(1s,2s,3r,4s)-1,2,3,4,5-pentahydroxypentyl]-1,3-thiazolidine-4-carboxylic acid Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C1NC(C(O)=O)CS1 JEPVUMTVFPQKQE-AAKCMJRZSA-N 0.000 description 1
- TWJNQYPJQDRXPH-UHFFFAOYSA-N 2-cyanobenzohydrazide Chemical compound NNC(=O)C1=CC=CC=C1C#N TWJNQYPJQDRXPH-UHFFFAOYSA-N 0.000 description 1
- BXRLWGXPSRYJDZ-UHFFFAOYSA-N 3-cyanoalanine Chemical compound OC(=O)C(N)CC#N BXRLWGXPSRYJDZ-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 102100033051 40S ribosomal protein S19 Human genes 0.000 description 1
- SJQRQOKXQKVJGJ-UHFFFAOYSA-N 5-(2-aminoethylamino)naphthalene-1-sulfonic acid Chemical compound C1=CC=C2C(NCCN)=CC=CC2=C1S(O)(=O)=O SJQRQOKXQKVJGJ-UHFFFAOYSA-N 0.000 description 1
- ODHCTXKNWHHXJC-VKHMYHEASA-N 5-oxo-L-proline Chemical compound OC(=O)[C@@H]1CCC(=O)N1 ODHCTXKNWHHXJC-VKHMYHEASA-N 0.000 description 1
- 102100031126 6-phosphogluconolactonase Human genes 0.000 description 1
- 108010029731 6-phosphogluconolactonase Proteins 0.000 description 1
- 102210042961 A*03:01 Human genes 0.000 description 1
- 239000013607 AAV vector Substances 0.000 description 1
- 206010000234 Abortion spontaneous Diseases 0.000 description 1
- 241000604451 Acidaminococcus Species 0.000 description 1
- 206010000748 Acute febrile neutrophilic dermatosis Diseases 0.000 description 1
- 206010001076 Acute sinusitis Diseases 0.000 description 1
- 208000026872 Addison Disease Diseases 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 241000702423 Adeno-associated virus - 2 Species 0.000 description 1
- 241001164825 Adeno-associated virus - 8 Species 0.000 description 1
- 206010001257 Adenoviral conjunctivitis Diseases 0.000 description 1
- 201000010000 Agranulocytosis Diseases 0.000 description 1
- 101500002116 Agrotis ipsilon Tachykinin-related peptide 6 Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 208000035285 Allergic Seasonal Rhinitis Diseases 0.000 description 1
- 206010027654 Allergic conditions Diseases 0.000 description 1
- 206010001766 Alopecia totalis Diseases 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 102100026882 Alpha-synuclein Human genes 0.000 description 1
- 208000024985 Alport syndrome Diseases 0.000 description 1
- 206010001881 Alveolar proteinosis Diseases 0.000 description 1
- 206010001935 American trypanosomiasis Diseases 0.000 description 1
- 206010002412 Angiocentric lymphomas Diseases 0.000 description 1
- 108010032595 Antibody Binding Sites Proteins 0.000 description 1
- 208000032467 Aplastic anaemia Diseases 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- 108010011485 Aspartame Proteins 0.000 description 1
- 206010003487 Aspergilloma Diseases 0.000 description 1
- 206010003591 Ataxia Diseases 0.000 description 1
- 206010003594 Ataxia telangiectasia Diseases 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 208000012657 Atopic disease Diseases 0.000 description 1
- 206010003645 Atopy Diseases 0.000 description 1
- 206010003694 Atrophy Diseases 0.000 description 1
- 206010003805 Autism Diseases 0.000 description 1
- 208000020706 Autistic disease Diseases 0.000 description 1
- 206010071576 Autoimmune aplastic anaemia Diseases 0.000 description 1
- 206010064539 Autoimmune myocarditis Diseases 0.000 description 1
- 206010055128 Autoimmune neutropenia Diseases 0.000 description 1
- 108010012919 B-Cell Antigen Receptors Proteins 0.000 description 1
- 102000019260 B-Cell Antigen Receptors Human genes 0.000 description 1
- 102100027203 B-cell antigen receptor complex-associated protein beta chain Human genes 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- NTTIDCCSYIDANP-UHFFFAOYSA-N BCCP Chemical compound BCCP NTTIDCCSYIDANP-UHFFFAOYSA-N 0.000 description 1
- 206010004078 Balanoposthitis Diseases 0.000 description 1
- 208000027496 Behcet disease Diseases 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 101710201279 Biotin carboxyl carrier protein Proteins 0.000 description 1
- 101710180532 Biotin carboxyl carrier protein of acetyl-CoA carboxylase Proteins 0.000 description 1
- 208000033932 Blackfan-Diamond anemia Diseases 0.000 description 1
- 201000004569 Blindness Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 201000006474 Brain Ischemia Diseases 0.000 description 1
- 102100038078 CD276 antigen Human genes 0.000 description 1
- 210000004366 CD4-positive T-lymphocyte Anatomy 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 201000007155 CD40 ligand deficiency Diseases 0.000 description 1
- 102100035793 CD83 antigen Human genes 0.000 description 1
- 201000002829 CREST Syndrome Diseases 0.000 description 1
- 101100454808 Caenorhabditis elegans lgg-2 gene Proteins 0.000 description 1
- 208000004434 Calcinosis Diseases 0.000 description 1
- 101150109517 Camlg gene Proteins 0.000 description 1
- 208000020119 Caplan syndrome Diseases 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 239000005632 Capric acid (CAS 334-48-5) Substances 0.000 description 1
- 239000005635 Caprylic acid (CAS 124-07-2) Substances 0.000 description 1
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 244000040944 Carpobrotus aequilaterus Species 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 206010057250 Cell-mediated cytotoxicity Diseases 0.000 description 1
- 231100000023 Cell-mediated cytotoxicity Toxicity 0.000 description 1
- 208000025985 Central nervous system inflammatory disease Diseases 0.000 description 1
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 1
- 208000018152 Cerebral disease Diseases 0.000 description 1
- 206010008120 Cerebral ischaemia Diseases 0.000 description 1
- 208000024699 Chagas disease Diseases 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 241000251730 Chondrichthyes Species 0.000 description 1
- 206010008748 Chorea Diseases 0.000 description 1
- 206010008874 Chronic Fatigue Syndrome Diseases 0.000 description 1
- 208000008818 Chronic Mucocutaneous Candidiasis Diseases 0.000 description 1
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 description 1
- 208000030939 Chronic inflammatory demyelinating polyneuropathy Diseases 0.000 description 1
- 206010009137 Chronic sinusitis Diseases 0.000 description 1
- 102100025567 Citron Rho-interacting kinase Human genes 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 208000010007 Cogan syndrome Diseases 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 102000000503 Collagen Type II Human genes 0.000 description 1
- 108010041390 Collagen Type II Proteins 0.000 description 1
- 208000027932 Collagen disease Diseases 0.000 description 1
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 1
- 206010053138 Congenital aplastic anaemia Diseases 0.000 description 1
- 206010010619 Congenital rubella infection Diseases 0.000 description 1
- 206010056370 Congestive cardiomyopathy Diseases 0.000 description 1
- 102100031673 Corneodesmosin Human genes 0.000 description 1
- 241000938605 Crocodylia Species 0.000 description 1
- 208000014311 Cushing syndrome Diseases 0.000 description 1
- 206010011686 Cutaneous vasculitis Diseases 0.000 description 1
- 102100026398 Cyclic AMP-responsive element-binding protein 3 Human genes 0.000 description 1
- 101710128029 Cyclic AMP-responsive element-binding protein 3 Proteins 0.000 description 1
- 201000003883 Cystic fibrosis Diseases 0.000 description 1
- GUBGYTABKSRVRQ-CUHNMECISA-N D-Cellobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-CUHNMECISA-N 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- QWIZNVHXZXRPDR-UHFFFAOYSA-N D-melezitose Natural products O1C(CO)C(O)C(O)C(O)C1OC1C(O)C(CO)OC1(CO)OC1OC(CO)C(O)C(O)C1O QWIZNVHXZXRPDR-UHFFFAOYSA-N 0.000 description 1
- 210000001086 DN3 alpha-beta immature T lymphocyte Anatomy 0.000 description 1
- 210000001570 DN4 alpha-beta immature T lymphocyte Anatomy 0.000 description 1
- 208000019505 Deglutition disease Diseases 0.000 description 1
- 208000001490 Dengue Diseases 0.000 description 1
- 206010012310 Dengue fever Diseases 0.000 description 1
- 206010012455 Dermatitis exfoliative Diseases 0.000 description 1
- 206010012468 Dermatitis herpetiformis Diseases 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 201000004449 Diamond-Blackfan anemia Diseases 0.000 description 1
- 101100278318 Dictyostelium discoideum dohh-2 gene Proteins 0.000 description 1
- 201000003066 Diffuse Scleroderma Diseases 0.000 description 1
- SHIBSTMRCDJXLN-UHFFFAOYSA-N Digoxigenin Natural products C1CC(C2C(C3(C)CCC(O)CC3CC2)CC2O)(O)C2(C)C1C1=CC(=O)OC1 SHIBSTMRCDJXLN-UHFFFAOYSA-N 0.000 description 1
- 201000010046 Dilated cardiomyopathy Diseases 0.000 description 1
- 208000006926 Discoid Lupus Erythematosus Diseases 0.000 description 1
- 208000003556 Dry Eye Syndromes Diseases 0.000 description 1
- 206010013774 Dry eye Diseases 0.000 description 1
- 208000001708 Dupuytren contracture Diseases 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 206010014201 Eczema nummular Diseases 0.000 description 1
- 206010014561 Emphysema Diseases 0.000 description 1
- 206010060742 Endocrine ophthalmopathy Diseases 0.000 description 1
- 201000009273 Endometriosis Diseases 0.000 description 1
- 208000037487 Endotoxemia Diseases 0.000 description 1
- 208000004232 Enteritis Diseases 0.000 description 1
- 206010014952 Eosinophilia myalgia syndrome Diseases 0.000 description 1
- 206010014954 Eosinophilic fasciitis Diseases 0.000 description 1
- 206010015084 Episcleritis Diseases 0.000 description 1
- 206010015108 Epstein-Barr virus infection Diseases 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 206010015153 Erythema annulare Diseases 0.000 description 1
- 206010055035 Erythema dyschromicum perstans Diseases 0.000 description 1
- 206010015218 Erythema multiforme Diseases 0.000 description 1
- 206010015226 Erythema nodosum Diseases 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 206010015251 Erythroblastosis foetalis Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 208000030644 Esophageal Motility disease Diseases 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 208000009386 Experimental Arthritis Diseases 0.000 description 1
- 102100034003 FAU ubiquitin-like and ribosomal protein S30 Human genes 0.000 description 1
- 208000027445 Farmer Lung Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 208000028387 Felty syndrome Diseases 0.000 description 1
- 208000001640 Fibromyalgia Diseases 0.000 description 1
- 206010016952 Food poisoning Diseases 0.000 description 1
- 208000019331 Foodborne disease Diseases 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 108091006027 G proteins Proteins 0.000 description 1
- 102000030782 GTP binding Human genes 0.000 description 1
- 108091000058 GTP-Binding Proteins 0.000 description 1
- 101710177291 Gag polyprotein Proteins 0.000 description 1
- 208000036495 Gastritis atrophic Diseases 0.000 description 1
- 208000018522 Gastrointestinal disease Diseases 0.000 description 1
- 206010056740 Genital discharge Diseases 0.000 description 1
- 208000007465 Giant cell arteritis Diseases 0.000 description 1
- 101100118916 Gibbon ape leukemia virus env gene Proteins 0.000 description 1
- 206010018366 Glomerulonephritis acute Diseases 0.000 description 1
- 206010018367 Glomerulonephritis chronic Diseases 0.000 description 1
- 206010018372 Glomerulonephritis membranous Diseases 0.000 description 1
- 108010018962 Glucosephosphate Dehydrogenase Proteins 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- 229930186217 Glycolipid Natural products 0.000 description 1
- 208000009329 Graft vs Host Disease Diseases 0.000 description 1
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 206010018691 Granuloma Diseases 0.000 description 1
- 201000005708 Granuloma Annulare Diseases 0.000 description 1
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 1
- 208000003807 Graves Disease Diseases 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 101710143544 Griffithsin Proteins 0.000 description 1
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 1
- 102100040505 HLA class II histocompatibility antigen, DR alpha chain Human genes 0.000 description 1
- 102100040482 HLA class II histocompatibility antigen, DR beta 3 chain Human genes 0.000 description 1
- 102100028640 HLA class II histocompatibility antigen, DR beta 5 chain Human genes 0.000 description 1
- 101150118346 HLA-A gene Proteins 0.000 description 1
- 102210042925 HLA-A*02:01 Human genes 0.000 description 1
- 101150035071 HLA-C gene Proteins 0.000 description 1
- 108010093061 HLA-DPA1 antigen Proteins 0.000 description 1
- 101150084225 HLA-DPA1 gene Proteins 0.000 description 1
- 102210053890 HLA-DQB1*03:01 Human genes 0.000 description 1
- 108010067802 HLA-DR alpha-Chains Proteins 0.000 description 1
- 108010047214 HLA-DRB1*03:01 antigen Proteins 0.000 description 1
- 108010061311 HLA-DRB3 Chains Proteins 0.000 description 1
- 108010016996 HLA-DRB5 Chains Proteins 0.000 description 1
- 208000008899 Habitual abortion Diseases 0.000 description 1
- 206010018910 Haemolysis Diseases 0.000 description 1
- 208000031071 Hamman-Rich Syndrome Diseases 0.000 description 1
- 208000001204 Hashimoto Disease Diseases 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 206010019755 Hepatitis chronic active Diseases 0.000 description 1
- 206010019860 Hereditary angioedema Diseases 0.000 description 1
- 208000007514 Herpes zoster Diseases 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000756632 Homo sapiens Actin, cytoplasmic 1 Proteins 0.000 description 1
- 101000914491 Homo sapiens B-cell antigen receptor complex-associated protein beta chain Proteins 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 1
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 description 1
- 101000856200 Homo sapiens Citron Rho-interacting kinase Proteins 0.000 description 1
- 101000732045 Homo sapiens FAU ubiquitin-like and ribosomal protein S30 Proteins 0.000 description 1
- 101000864089 Homo sapiens HLA class II histocompatibility antigen, DP alpha 1 chain Proteins 0.000 description 1
- 101000930802 Homo sapiens HLA class II histocompatibility antigen, DQ alpha 1 chain Proteins 0.000 description 1
- 101000968032 Homo sapiens HLA class II histocompatibility antigen, DR beta 3 chain Proteins 0.000 description 1
- 101000998146 Homo sapiens Interleukin-17A Proteins 0.000 description 1
- 101001043807 Homo sapiens Interleukin-7 Proteins 0.000 description 1
- 101000617823 Homo sapiens Solute carrier organic anion transporter family member 6A1 Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000598171 Human adenovirus sp. Species 0.000 description 1
- 208000023105 Huntington disease Diseases 0.000 description 1
- 208000004454 Hyperalgesia Diseases 0.000 description 1
- 208000035154 Hyperesthesia Diseases 0.000 description 1
- 206010020631 Hypergammaglobulinaemia benign monoclonal Diseases 0.000 description 1
- 206010020850 Hyperthyroidism Diseases 0.000 description 1
- 208000035795 Hypocalcemic vitamin D-dependent rickets Diseases 0.000 description 1
- 206010058359 Hypogonadism Diseases 0.000 description 1
- 206010021067 Hypopituitarism Diseases 0.000 description 1
- 208000016300 Idiopathic chronic eosinophilic pneumonia Diseases 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 208000004575 Infectious Arthritis Diseases 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 102100033461 Interleukin-17A Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 206010022557 Intermediate uveitis Diseases 0.000 description 1
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- UETNIIAIRMUTSM-UHFFFAOYSA-N Jacareubin Natural products CC1(C)OC2=CC3Oc4c(O)c(O)ccc4C(=O)C3C(=C2C=C1)O UETNIIAIRMUTSM-UHFFFAOYSA-N 0.000 description 1
- 208000009388 Job Syndrome Diseases 0.000 description 1
- 208000012659 Joint disease Diseases 0.000 description 1
- 208000012528 Juvenile dermatomyositis Diseases 0.000 description 1
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 1
- 208000011200 Kawasaki disease Diseases 0.000 description 1
- 206010023335 Keratitis interstitial Diseases 0.000 description 1
- 208000009319 Keratoconjunctivitis Sicca Diseases 0.000 description 1
- 208000001126 Keratosis Diseases 0.000 description 1
- LKDRXBCSQODPBY-AMVSKUEXSA-N L-(-)-Sorbose Chemical compound OCC1(O)OC[C@H](O)[C@@H](O)[C@@H]1O LKDRXBCSQODPBY-AMVSKUEXSA-N 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- WTDRDQBEARUVNC-UHFFFAOYSA-N L-Dopa Natural products OC(=O)C(N)CC1=CC=C(O)C(O)=C1 WTDRDQBEARUVNC-UHFFFAOYSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- DGYHPLMPMRKMPD-UHFFFAOYSA-N L-propargyl glycine Natural products OC(=O)C(N)CC#C DGYHPLMPMRKMPD-UHFFFAOYSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 208000001913 Lamellar ichthyosis Diseases 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 206010024229 Leprosy Diseases 0.000 description 1
- 206010024305 Leukaemia monocytic Diseases 0.000 description 1
- 208000034624 Leukocytoclastic Cutaneous Vasculitis Diseases 0.000 description 1
- 208000032514 Leukocytoclastic vasculitis Diseases 0.000 description 1
- 208000007820 Lichen Sclerosus et Atrophicus Diseases 0.000 description 1
- 206010024434 Lichen sclerosus Diseases 0.000 description 1
- 206010024436 Lichen spinulosus Diseases 0.000 description 1
- 208000001244 Linear IgA Bullous Dermatosis Diseases 0.000 description 1
- 208000004883 Lipoid Nephrosis Diseases 0.000 description 1
- 208000019693 Lung disease Diseases 0.000 description 1
- 206010025102 Lung infiltration Diseases 0.000 description 1
- 208000005777 Lupus Nephritis Diseases 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 229920002774 Maltodextrin Polymers 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 208000019695 Migraine disease Diseases 0.000 description 1
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 1
- 206010028080 Mucocutaneous candidiasis Diseases 0.000 description 1
- 208000034486 Multi-organ failure Diseases 0.000 description 1
- 208000010718 Multiple Organ Failure Diseases 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 101000822667 Mus musculus Something about silencing protein 10 Proteins 0.000 description 1
- 101000946846 Mus musculus T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 1
- 101001135571 Mus musculus Tyrosine-protein phosphatase non-receptor type 2 Proteins 0.000 description 1
- 208000029549 Muscle injury Diseases 0.000 description 1
- 208000021642 Muscular disease Diseases 0.000 description 1
- 208000000112 Myalgia Diseases 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 208000003926 Myelitis Diseases 0.000 description 1
- 102100031789 Myeloid-derived growth factor Human genes 0.000 description 1
- 208000009525 Myocarditis Diseases 0.000 description 1
- 235000021360 Myristic acid Nutrition 0.000 description 1
- TUNFSRHWOTWDNC-UHFFFAOYSA-N Myristic acid Natural products CCCCCCCCCCCCCC(O)=O TUNFSRHWOTWDNC-UHFFFAOYSA-N 0.000 description 1
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 1
- 206010051606 Necrotising colitis Diseases 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 241000588649 Neisseria lactamica Species 0.000 description 1
- 241000772415 Neovison vison Species 0.000 description 1
- 206010065673 Nephritic syndrome Diseases 0.000 description 1
- 208000028389 Nerve injury Diseases 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 201000009053 Neurodermatitis Diseases 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 208000029067 Neuromyelitis optica spectrum disease Diseases 0.000 description 1
- 244000061176 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 241001195348 Nusa Species 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 206010029888 Obliterative bronchiolitis Diseases 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 235000021314 Palmitic acid Nutrition 0.000 description 1
- 206010033661 Pancytopenia Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 101001051524 Parabuthus granulatus Toxin PgKL2 Proteins 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 241000701945 Parvoviridae Species 0.000 description 1
- 208000008071 Parvoviridae Infections Diseases 0.000 description 1
- 206010057343 Parvovirus infection Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 208000026433 Pemphigus erythematosus Diseases 0.000 description 1
- 208000027086 Pemphigus foliaceus Diseases 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 208000008469 Peptic Ulcer Diseases 0.000 description 1
- 206010034620 Peripheral sensory neuropathy Diseases 0.000 description 1
- 101001053873 Phyllomedusa sauvagei Dermaseptin-S1 Proteins 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 206010036030 Polyarthritis Diseases 0.000 description 1
- 101710182846 Polyhedrin Proteins 0.000 description 1
- 208000007048 Polymyalgia Rheumatica Diseases 0.000 description 1
- 206010036242 Post vaccination syndrome Diseases 0.000 description 1
- 206010036297 Postpartum hypopituitarism Diseases 0.000 description 1
- 206010036631 Presenile dementia Diseases 0.000 description 1
- 208000002500 Primary Ovarian Insufficiency Diseases 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 206010036697 Primary hypothyroidism Diseases 0.000 description 1
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 229940096437 Protein S Drugs 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 208000003251 Pruritus Diseases 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 206010037549 Purpura Diseases 0.000 description 1
- 241001672981 Purpura Species 0.000 description 1
- 206010037575 Pustular psoriasis Diseases 0.000 description 1
- 206010037596 Pyelonephritis Diseases 0.000 description 1
- MUPFEKGTMRGPLJ-RMMQSMQOSA-N Raffinose Natural products O(C[C@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O[C@@]2(CO)[C@H](O)[C@@H](O)[C@@H](CO)O2)O1)[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 MUPFEKGTMRGPLJ-RMMQSMQOSA-N 0.000 description 1
- 206010071141 Rasmussen encephalitis Diseases 0.000 description 1
- 208000004160 Rasmussen subacute encephalitis Diseases 0.000 description 1
- 101001074199 Rattus norvegicus Glycerol kinase Proteins 0.000 description 1
- 208000012322 Raynaud phenomenon Diseases 0.000 description 1
- 208000021329 Refractory celiac disease Diseases 0.000 description 1
- 206010038422 Renal cortical necrosis Diseases 0.000 description 1
- 206010063897 Renal ischaemia Diseases 0.000 description 1
- 206010063837 Reperfusion injury Diseases 0.000 description 1
- 208000037656 Respiratory Sounds Diseases 0.000 description 1
- 101710088998 Response regulator inhibitor for tor operon Proteins 0.000 description 1
- 206010038748 Restrictive cardiomyopathy Diseases 0.000 description 1
- 241001303601 Rosacea Species 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 101100010928 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) tuf gene Proteins 0.000 description 1
- 206010039705 Scleritis Diseases 0.000 description 1
- 206010039710 Scleroderma Diseases 0.000 description 1
- 206010039793 Seborrhoeic dermatitis Diseases 0.000 description 1
- 241000710961 Semliki Forest virus Species 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 208000032384 Severe immune-mediated enteropathy Diseases 0.000 description 1
- 201000009895 Sheehan syndrome Diseases 0.000 description 1
- 201000010001 Silicosis Diseases 0.000 description 1
- 241000710960 Sindbis virus Species 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 108020004688 Small Nuclear RNA Proteins 0.000 description 1
- 102000039471 Small Nuclear RNA Human genes 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 101100166144 Staphylococcus aureus cas9 gene Proteins 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 231100000168 Stevens-Johnson syndrome Toxicity 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 206010042342 Subcorneal pustular dermatosis Diseases 0.000 description 1
- 206010061373 Sudden Hearing Loss Diseases 0.000 description 1
- 208000010265 Sweet syndrome Diseases 0.000 description 1
- 206010042674 Swelling Diseases 0.000 description 1
- 208000027522 Sydenham chorea Diseases 0.000 description 1
- 206010042742 Sympathetic ophthalmia Diseases 0.000 description 1
- 102000019355 Synuclein Human genes 0.000 description 1
- 108050006783 Synuclein Proteins 0.000 description 1
- 208000031673 T-Cell Cutaneous Lymphoma Diseases 0.000 description 1
- 208000000389 T-cell leukemia Diseases 0.000 description 1
- 208000028530 T-cell lymphoblastic leukemia/lymphoma Diseases 0.000 description 1
- 101150001810 TEAD1 gene Proteins 0.000 description 1
- 101150074253 TEF1 gene Proteins 0.000 description 1
- 206010043189 Telangiectasia Diseases 0.000 description 1
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 1
- 102100036407 Thioredoxin Human genes 0.000 description 1
- 206010043561 Thrombocytopenic purpura Diseases 0.000 description 1
- 201000009365 Thymic carcinoma Diseases 0.000 description 1
- 206010043781 Thyroiditis chronic Diseases 0.000 description 1
- 206010043784 Thyroiditis subacute Diseases 0.000 description 1
- 206010044223 Toxic epidermal necrolysis Diseases 0.000 description 1
- 231100000087 Toxic epidermal necrolysis Toxicity 0.000 description 1
- 206010044248 Toxic shock syndrome Diseases 0.000 description 1
- 231100000650 Toxic shock syndrome Toxicity 0.000 description 1
- 206010044314 Tracheobronchitis Diseases 0.000 description 1
- GYDJEQRTZSCIOI-UHFFFAOYSA-N Tranexamic acid Chemical compound NCC1CCC(C(O)=O)CC1 GYDJEQRTZSCIOI-UHFFFAOYSA-N 0.000 description 1
- 102100029898 Transcriptional enhancer factor TEF-1 Human genes 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 208000003441 Transfusion reaction Diseases 0.000 description 1
- 206010051446 Transient acantholytic dermatosis Diseases 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 101000816965 Trypanosoma brucei rhodesiense Trypanin Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 208000006391 Type 1 Hyper-IgM Immunodeficiency Syndrome Diseases 0.000 description 1
- 206010070517 Type 2 lepra reaction Diseases 0.000 description 1
- MUPFEKGTMRGPLJ-UHFFFAOYSA-N UNPD196149 Natural products OC1C(O)C(CO)OC1(CO)OC1C(O)C(O)C(O)C(COC2C(C(O)C(O)C(CO)O2)O)O1 MUPFEKGTMRGPLJ-UHFFFAOYSA-N 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 208000036826 VIIth nerve paralysis Diseases 0.000 description 1
- 206010047112 Vasculitides Diseases 0.000 description 1
- 208000014926 Vesiculobullous Skin disease Diseases 0.000 description 1
- 206010047642 Vitiligo Diseases 0.000 description 1
- 108010031318 Vitronectin Proteins 0.000 description 1
- 108091093126 WHP Posttrascriptional Response Element Proteins 0.000 description 1
- 208000006110 Wiskott-Aldrich syndrome Diseases 0.000 description 1
- 201000001696 X-linked hyper IgM syndrome Diseases 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 208000037855 acute anterior uveitis Diseases 0.000 description 1
- 208000026816 acute arthritis Diseases 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 231100000851 acute glomerulonephritis Toxicity 0.000 description 1
- 201000004073 acute interstitial pneumonia Diseases 0.000 description 1
- 229960002964 adalimumab Drugs 0.000 description 1
- 210000005006 adaptive immune system Anatomy 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 230000001070 adhesive effect Effects 0.000 description 1
- 208000011341 adult acute respiratory distress syndrome Diseases 0.000 description 1
- 201000000028 adult respiratory distress syndrome Diseases 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 208000002029 allergic contact dermatitis Diseases 0.000 description 1
- 208000030961 allergic reaction Diseases 0.000 description 1
- 201000010435 allergic urticaria Diseases 0.000 description 1
- 208000004631 alopecia areata Diseases 0.000 description 1
- 108010050122 alpha 1-Antitrypsin Proteins 0.000 description 1
- 102000015395 alpha 1-Antitrypsin Human genes 0.000 description 1
- 229940024142 alpha 1-antitrypsin Drugs 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 108090000185 alpha-Synuclein Proteins 0.000 description 1
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 230000006229 amino acid addition Effects 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 206010002022 amyloidosis Diseases 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 229940124599 anti-inflammatory drug Drugs 0.000 description 1
- 230000001064 anti-interferon Effects 0.000 description 1
- 230000001775 anti-pathogenic effect Effects 0.000 description 1
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 230000009831 antigen interaction Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 206010003119 arrhythmia Diseases 0.000 description 1
- 230000006793 arrhythmia Effects 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 206010003230 arteritis Diseases 0.000 description 1
- 201000009361 ascariasis Diseases 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- IAOZJIPTCAWIRG-QWRGUYRKSA-N aspartame Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(=O)OC)CC1=CC=CC=C1 IAOZJIPTCAWIRG-QWRGUYRKSA-N 0.000 description 1
- 239000000605 aspartame Substances 0.000 description 1
- 235000010357 aspartame Nutrition 0.000 description 1
- 229960003438 aspartame Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 230000001977 ataxic effect Effects 0.000 description 1
- 238000000594 atomic force spectroscopy Methods 0.000 description 1
- 230000037444 atrophy Effects 0.000 description 1
- 208000001974 autoimmune enteropathy Diseases 0.000 description 1
- 230000006472 autoimmune response Effects 0.000 description 1
- 208000010928 autoimmune thyroid disease Diseases 0.000 description 1
- 201000004982 autoimmune uveitis Diseases 0.000 description 1
- 230000001042 autoregulative effect Effects 0.000 description 1
- 201000000751 autosomal recessive congenital ichthyosis Diseases 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- 230000037429 base substitution Effects 0.000 description 1
- 210000003651 basophil Anatomy 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 229960003237 betaine Drugs 0.000 description 1
- 238000010256 biochemical assay Methods 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 208000015440 bird fancier lung Diseases 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000003995 blood forming stem cell Anatomy 0.000 description 1
- 230000036772 blood pressure Effects 0.000 description 1
- 230000008993 bowel inflammation Effects 0.000 description 1
- 210000000133 brain stem Anatomy 0.000 description 1
- 210000005013 brain tissue Anatomy 0.000 description 1
- 201000003848 bronchiolitis obliterans Diseases 0.000 description 1
- 208000023367 bronchiolitis obliterans with obstructive pulmonary disease Diseases 0.000 description 1
- 206010006451 bronchitis Diseases 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- SNPPWIUOZRMYNY-UHFFFAOYSA-N bupropion Chemical compound CC(C)(C)NC(C)C(=O)C1=CC=CC(Cl)=C1 SNPPWIUOZRMYNY-UHFFFAOYSA-N 0.000 description 1
- 229960001058 bupropion Drugs 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 238000002619 cancer immunotherapy Methods 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000005890 cell-mediated cytotoxicity Effects 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 230000030570 cellular localization Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 208000010353 central nervous system vasculitis Diseases 0.000 description 1
- 208000025434 cerebellar degeneration Diseases 0.000 description 1
- 206010008118 cerebral infarction Diseases 0.000 description 1
- 229960003115 certolizumab pegol Drugs 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 150000005829 chemical entities Chemical class 0.000 description 1
- 239000012707 chemical precursor Substances 0.000 description 1
- 201000010415 childhood type dermatomyositis Diseases 0.000 description 1
- 108700010039 chimeric receptor Proteins 0.000 description 1
- 102000021178 chitin binding proteins Human genes 0.000 description 1
- 108091011157 chitin binding proteins Proteins 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 201000004709 chorioretinitis Diseases 0.000 description 1
- 201000009323 chronic eosinophilic pneumonia Diseases 0.000 description 1
- 208000030949 chronic idiopathic urticaria Diseases 0.000 description 1
- 201000005795 chronic inflammatory demyelinating polyneuritis Diseases 0.000 description 1
- 230000012085 chronic inflammatory response Effects 0.000 description 1
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 1
- 208000027157 chronic rhinosinusitis Diseases 0.000 description 1
- 206010072757 chronic spontaneous urticaria Diseases 0.000 description 1
- 230000007882 cirrhosis Effects 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000003501 co-culture Methods 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 208000008609 collagenous colitis Diseases 0.000 description 1
- 238000012777 commercial manufacturing Methods 0.000 description 1
- 235000009508 confectionery Nutrition 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 210000003792 cranial nerve Anatomy 0.000 description 1
- 201000007241 cutaneous T cell lymphoma Diseases 0.000 description 1
- 208000004921 cutaneous lupus erythematosus Diseases 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 231100000895 deafness Toxicity 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 208000025729 dengue disease Diseases 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 1
- SHIBSTMRCDJXLN-KCZCNTNESA-N digoxigenin Chemical compound C1([C@@H]2[C@@]3([C@@](CC2)(O)[C@H]2[C@@H]([C@@]4(C)CC[C@H](O)C[C@H]4CC2)C[C@H]3O)C)=CC(=O)OC1 SHIBSTMRCDJXLN-KCZCNTNESA-N 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- MHUWZNTUIIFHAS-CLFAGFIQSA-N dioleoyl phosphatidic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC(COP(O)(O)=O)OC(=O)CCCCCCC\C=C/CCCCCCCC MHUWZNTUIIFHAS-CLFAGFIQSA-N 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 208000032625 disorder of ear Diseases 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 210000003317 double-positive, alpha-beta immature T lymphocyte Anatomy 0.000 description 1
- 230000002222 downregulating effect Effects 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 229960003722 doxycycline Drugs 0.000 description 1
- XQTWDDCIUJNLTR-CVHRZJFOSA-N doxycycline monohydrate Chemical compound O.O=C1C2=C(O)C=CC=C2[C@H](C)[C@@H]2C1=C(O)[C@]1(O)C(=O)C(C(N)=O)=C(O)[C@@H](N(C)C)[C@@H]1[C@H]2O XQTWDDCIUJNLTR-CVHRZJFOSA-N 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 201000011191 dyskinesia of esophagus Diseases 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 206010014665 endocarditis Diseases 0.000 description 1
- 201000010048 endomyocardial fibrosis Diseases 0.000 description 1
- 101150030339 env gene Proteins 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000002327 eosinophilic effect Effects 0.000 description 1
- 208000021373 epidemic keratoconjunctivitis Diseases 0.000 description 1
- 206010015037 epilepsy Diseases 0.000 description 1
- 231100000321 erythema Toxicity 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 201000009320 ethmoid sinusitis Diseases 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 208000004526 exfoliative dermatitis Diseases 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 208000022195 farmer lung disease Diseases 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 208000001031 fetal erythroblastosis Diseases 0.000 description 1
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 230000022244 formylation Effects 0.000 description 1
- 238000006170 formylation reaction Methods 0.000 description 1
- 201000006916 frontal sinusitis Diseases 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 229960002963 ganciclovir Drugs 0.000 description 1
- IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 229960001743 golimumab Drugs 0.000 description 1
- 230000002710 gonadal effect Effects 0.000 description 1
- 208000024908 graft versus host disease Diseases 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000014951 hematologic disease Diseases 0.000 description 1
- 230000008588 hemolysis Effects 0.000 description 1
- 208000003215 hereditary nephritis Diseases 0.000 description 1
- 239000008241 heterogeneous mixture Substances 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 102000052622 human IL7 Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 208000014796 hyper-IgE recurrent infection syndrome 1 Diseases 0.000 description 1
- 206010051040 hyper-IgE syndrome Diseases 0.000 description 1
- 208000026095 hyper-IgM syndrome type 1 Diseases 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 230000003463 hyperproliferative effect Effects 0.000 description 1
- 230000009610 hypersensitivity Effects 0.000 description 1
- 201000006362 hypersensitivity vasculitis Diseases 0.000 description 1
- 230000002989 hypothyroidism Effects 0.000 description 1
- 206010021198 ichthyosis Diseases 0.000 description 1
- 210000002861 immature t-cell Anatomy 0.000 description 1
- 210000001822 immobilized cell Anatomy 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000005931 immune cell recruitment Effects 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 102000027596 immune receptors Human genes 0.000 description 1
- 108091008915 immune receptors Proteins 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 229940125721 immunosuppressive agent Drugs 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 201000006747 infectious mononucleosis Diseases 0.000 description 1
- 208000000509 infertility Diseases 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 231100000535 infertility Toxicity 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 230000004968 inflammatory condition Effects 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 238000002664 inhalation therapy Methods 0.000 description 1
- 208000030603 inherited susceptibility to asthma Diseases 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 230000000266 injurious effect Effects 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 1
- 229960000367 inositol Drugs 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 201000006904 interstitial keratitis Diseases 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 230000009249 intrinsic sympathomimetic activity Effects 0.000 description 1
- 201000004614 iritis Diseases 0.000 description 1
- 239000002085 irritant Substances 0.000 description 1
- 231100000021 irritant Toxicity 0.000 description 1
- 208000001875 irritant dermatitis Diseases 0.000 description 1
- 208000012947 ischemia reperfusion injury Diseases 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 208000018937 joint inflammation Diseases 0.000 description 1
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 description 1
- 208000005430 kidney cortex necrosis Diseases 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 101150066555 lacZ gene Proteins 0.000 description 1
- 239000000832 lactitol Substances 0.000 description 1
- 235000010448 lactitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-JVCRWLNRSA-N lactitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-JVCRWLNRSA-N 0.000 description 1
- 229960003451 lactitol Drugs 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 208000001921 latent autoimmune diabetes in adults Diseases 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 231100001022 leukopenia Toxicity 0.000 description 1
- 229960004502 levodopa Drugs 0.000 description 1
- 206010024428 lichen nitidus Diseases 0.000 description 1
- 201000011486 lichen planus Diseases 0.000 description 1
- 230000002197 limbic effect Effects 0.000 description 1
- 208000029631 linear IgA Dermatosis Diseases 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 201000003265 lymphadenitis Diseases 0.000 description 1
- 230000000527 lymphocytic effect Effects 0.000 description 1
- 210000003738 lymphoid progenitor cell Anatomy 0.000 description 1
- 208000006116 lymphomatoid granulomatosis Diseases 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 238000002826 magnetic-activated cell sorting Methods 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 239000000845 maltitol Substances 0.000 description 1
- 235000010449 maltitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-WUJBLJFYSA-N maltitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-WUJBLJFYSA-N 0.000 description 1
- 229940035436 maltitol Drugs 0.000 description 1
- 229960001855 mannitol Drugs 0.000 description 1
- 201000008836 maxillary sinusitis Diseases 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- QWIZNVHXZXRPDR-WSCXOGSTSA-N melezitose Chemical compound O([C@@]1(O[C@@H]([C@H]([C@@H]1O[C@@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)O)CO)CO)[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O QWIZNVHXZXRPDR-WSCXOGSTSA-N 0.000 description 1
- 231100000855 membranous nephropathy Toxicity 0.000 description 1
- 210000001806 memory b lymphocyte Anatomy 0.000 description 1
- 229960005108 mepolizumab Drugs 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 108091070501 miRNA Proteins 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 239000002679 microRNA Substances 0.000 description 1
- 208000008275 microscopic colitis Diseases 0.000 description 1
- 206010063344 microscopic polyangiitis Diseases 0.000 description 1
- 206010027599 migraine Diseases 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 201000006894 monocytic leukemia Diseases 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 208000001725 mucocutaneous lymph node syndrome Diseases 0.000 description 1
- 206010065579 multifocal motor neuropathy Diseases 0.000 description 1
- 201000005895 multinodular goiter Diseases 0.000 description 1
- 208000029744 multiple organ dysfunction syndrome Diseases 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- 208000029766 myalgic encephalomeyelitis/chronic fatigue syndrome Diseases 0.000 description 1
- 201000005962 mycosis fungoides Diseases 0.000 description 1
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 1
- 201000003631 narcolepsy Diseases 0.000 description 1
- 208000004995 necrotizing enterocolitis Diseases 0.000 description 1
- 208000009928 nephrosis Diseases 0.000 description 1
- 231100001027 nephrosis Toxicity 0.000 description 1
- 230000008764 nerve damage Effects 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000003955 neuronal function Effects 0.000 description 1
- 208000002040 neurosyphilis Diseases 0.000 description 1
- 239000002581 neurotoxin Substances 0.000 description 1
- 231100000618 neurotoxin Toxicity 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 230000006780 non-homologous end joining Effects 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 125000003835 nucleoside group Chemical group 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 229960002446 octanoic acid Drugs 0.000 description 1
- 208000028780 ocular motility disease Diseases 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 230000008816 organ damage Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 230000003071 parasitic effect Effects 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 201000001976 pemphigus vulgaris Diseases 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 208000011906 peptic ulcer disease Diseases 0.000 description 1
- 201000006195 perinatal necrotizing enterocolitis Diseases 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 208000029308 periodic paralysis Diseases 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 108010089520 pol Gene Products Proteins 0.000 description 1
- 208000030428 polyarticular arthritis Diseases 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 208000005987 polymyositis Diseases 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 208000006473 polyradiculopathy Diseases 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 201000011461 pre-eclampsia Diseases 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- 206010036601 premature menopause Diseases 0.000 description 1
- 208000017942 premature ovarian failure 1 Diseases 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 208000025638 primary cutaneous T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 201000009395 primary hyperaldosteronism Diseases 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 201000003489 pulmonary alveolar proteinosis Diseases 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 201000009732 pulmonary eosinophilia Diseases 0.000 description 1
- 201000004537 pyelitis Diseases 0.000 description 1
- 206010061928 radiculitis Diseases 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- MUPFEKGTMRGPLJ-ZQSKZDJDSA-N raffinose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)O)O1 MUPFEKGTMRGPLJ-ZQSKZDJDSA-N 0.000 description 1
- 206010037833 rales Diseases 0.000 description 1
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 210000003370 receptor cell Anatomy 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 239000013074 reference sample Substances 0.000 description 1
- 238000002310 reflectometry Methods 0.000 description 1
- 230000012121 regulation of immune response Effects 0.000 description 1
- 210000002707 regulatory b cell Anatomy 0.000 description 1
- 208000009169 relapsing polychondritis Diseases 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 230000010410 reperfusion Effects 0.000 description 1
- 230000001718 repressive effect Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 201000006845 reticulosarcoma Diseases 0.000 description 1
- 208000029922 reticulum cell sarcoma Diseases 0.000 description 1
- 230000002207 retinal effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 230000000552 rheumatic effect Effects 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- 229940043267 rhodamine b Drugs 0.000 description 1
- 108020004418 ribosomal RNA Proteins 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 201000004700 rosacea Diseases 0.000 description 1
- 235000002020 sage Nutrition 0.000 description 1
- 208000001076 sarcopenia Diseases 0.000 description 1
- 230000037390 scarring Effects 0.000 description 1
- 201000004409 schistosomiasis Diseases 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 210000003786 sclera Anatomy 0.000 description 1
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 1
- 208000008742 seborrheic dermatitis Diseases 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 201000005572 sensory peripheral neuropathy Diseases 0.000 description 1
- 201000001223 septic arthritis Diseases 0.000 description 1
- 208000013223 septicemia Diseases 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 208000002491 severe combined immunodeficiency Diseases 0.000 description 1
- 201000006476 shipyard eye Diseases 0.000 description 1
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 1
- 229960002930 sirolimus Drugs 0.000 description 1
- 239000010454 slate Substances 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000008279 sol Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 201000006923 sphenoid sinusitis Diseases 0.000 description 1
- 208000020431 spinal cord injury Diseases 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 208000000995 spontaneous abortion Diseases 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 230000003068 static effect Effects 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 230000003335 steric effect Effects 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 201000007497 subacute thyroiditis Diseases 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- NCEXYHBECQHGNR-QZQOTICOSA-N sulfasalazine Chemical compound C1=C(O)C(C(=O)O)=CC(\N=N\C=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-QZQOTICOSA-N 0.000 description 1
- 229960001940 sulfasalazine Drugs 0.000 description 1
- NCEXYHBECQHGNR-UHFFFAOYSA-N sulfasalazine Natural products C1=C(O)C(C(=O)O)=CC(N=NC=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-UHFFFAOYSA-N 0.000 description 1
- 230000019635 sulfation Effects 0.000 description 1
- 238000005670 sulfation reaction Methods 0.000 description 1
- 150000003457 sulfones Chemical class 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 201000004595 synovitis Diseases 0.000 description 1
- 208000002025 tabes dorsalis Diseases 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 208000009056 telangiectasis Diseases 0.000 description 1
- 206010043207 temporal arteritis Diseases 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- JGVWCANSWKRBCS-UHFFFAOYSA-N tetramethylrhodamine thiocyanate Chemical compound [Cl-].C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=C(SC#N)C=C1C(O)=O JGVWCANSWKRBCS-UHFFFAOYSA-N 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- 108060008226 thioredoxin Proteins 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 206010043554 thrombocytopenia Diseases 0.000 description 1
- 206010043778 thyroiditis Diseases 0.000 description 1
- 208000005057 thyrotoxicosis Diseases 0.000 description 1
- 208000037816 tissue injury Diseases 0.000 description 1
- 230000003614 tolerogenic effect Effects 0.000 description 1
- 235000013619 trace mineral Nutrition 0.000 description 1
- 239000011573 trace mineral Substances 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 208000016367 transient hypogammaglobulinemia of infancy Diseases 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 230000008733 trauma Effects 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 208000033584 type 1 vitamin D-dependent rickets Diseases 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 210000001745 uvea Anatomy 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 230000006492 vascular dysfunction Effects 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- OPUPHQHVRPYOTC-UHFFFAOYSA-N vgf3hm1rrf Chemical compound C1=NC(C(=O)C=2C3=CC=CN=2)=C2C3=NC=CC2=C1 OPUPHQHVRPYOTC-UHFFFAOYSA-N 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 230000037314 wound repair Effects 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/462—Cellular immunotherapy characterized by the effect or the function of the cells
- A61K39/4621—Cellular immunotherapy characterized by the effect or the function of the cells immunosuppressive or immunotolerising
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4632—T-cell receptors [TCR]; antibody T-cell receptor constructs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/46432—Nervous system antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/46433—Antigens related to auto-immune diseases; Preparations to induce self-tolerance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2833—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/32—Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
Definitions
- Hits disclosure relates to novel polynucleotides, cells, and compositions, and methods of their use.
- a polynucleotide encoding an engineered T-cell receptor comprising, consisting of. or alternatively consisting essentially of: (a) an extracellular antigen binding domain, (b) a transmembrane domain, and (c) an intracellular signaling domain, wherein the extracellular antigen binding domain binds an antigen that binds an MHC molecule, wherein the antigen binds to the MHC molecule with high affinity, and/or wherein the antigen induces a specific cytokine response, optionally an 1L-17. IFNy, and/or IL-5 response.
- the antigen is bound to the MHC molecule.
- the engineered T-cell receptor is a modified T-cell receptor. In other aspects, the engineered T-cell receptor is a chimeric antigen receptor (CAR). In certain aspects, the extracellular antigen binding domain binds both the antigen and the MHC molecule. Also provided herein are the expression product(s) of the polynucleotide encoding an engineered T-cell receptor.
- the antigen comprises all or part of an epitope derived from an antigen of the group of: a microbial antigen, a viral antigen, a bacterial antigen, a fungal antigen, a protozoan antigen, an antigen involved in autoimmune disease, an auloanligcn, an allergy antigen, a graft rejection antigen, a neurodegenerative disease or disorder, a tumor antigen, or a cancer antigen.
- the antigen comprises all or part of a toxin.
- the antigen is an antigen involved in the etiology of autoimmune disease.
- the disclosure relates to a vector comprising the polynucleotide according to any of the embodiments disclosed herein, optionally operatively linked to a promoter.
- the vector further comprises an enhancer, a polynucleotide encoding FoxP3 optionally operatively linked to a promoter, a polynucleotide encoding IL-10 optionally operatively linked to a promoter, a suicide gene optionally operatively linked to a promoter, a ubiquitin binding domain, and/or STUB1 optionally operatively linked to a promoter.
- the vector is from the group of: a plasmid, a retroviral vector, a lentiviral vector, an adenoviral vector, or an adeno-associated viral vector. Also provided herein are the expression producl(s) of the vector comprising the polynucleotide encoding an engineered T-cell receptor.
- the disclosure relates to a cell comprising or expressing the polynucleotide or vector according to any one of the embodiments disclosed herein.
- the cell comprises two or more distinct polynucleotides or two or more distinct vectors according to the embodiments disclosed herein, and wherein the engineered T-cell receptors encoded by the two or more polynucleotides or two or more vectors bind distinct antigens.
- the cell is an isolated cell.
- the cell is a leukocyte, a T-cell, or an NK cell.
- the cell is a regulatory T-ccll, a regulatory memory T-cell, a central memory T-cell, an effector memory T-cell, a CD4+ T-cell, or a CD8+ T-cell.
- a cell comprising the expression product(s) of the polynucleotide or vector encoding an engineered T-cell receptor.
- the engineered T-cell receptor is expressed on the surface of the cell.
- the disclosure provides a non-human animal comprising one or more of a polynucleotide, and/or vector, and/or cell, and/or a population of cells according to any of the embodiments described herein.
- the non-human animal comprises two or more polynucleotides, two or more vectors, two or more cells, or two or more populations of cells that encode distinct engineered T-cell receptors that bind distinct antigen targets.
- composition comprising a carrier and one or more of: a polynucleotide, vector, engineered T cell receptor, cell, modified cell, or population comprising said cells or modified cells according to any of the embodiments described herein.
- Engineered T- ccll receptors described herein may comprise, consist of, or alternatively consist essentially of: (a) an extracellular antigen binding domain, (b) a transmembrane domain, and (c) an intracellular signaling domain, wherein the extracellular antigen binding domain binds an antigen that binds an MHC molecule, wherein the antigen binds to the MHC molecule with high affinity, and/or wherein the antigen induces a specific cytokine response, optionally an IL-17, IFNy, and/or IL-5 response.
- the engineered T-cell receptor is a modified T-cell receptor.
- the engineered T-ccll receptor is a chimeric antigen receptor (CAR).
- the extracellular antigen binding domain binds both the antigen and the MHC molecule.
- the polynucleotide or vector encodes the engineered T cell receptor.
- the cell or modified cell expresses the polynucleotide or vector and/or comprises an engineered T cell receptor on a surface of the cell or modified cell.
- the disclosure provides a kit comprising a composition according to any of the embodiments described herein and instructions for use.
- step (i) comprises CRISPR mediated gene editing.
- the cell is a leukocyte, a T-ccll, or an NK cell.
- the cell is a regulatory T-cell, a regulatory memory T-cell, a central memory T-cell, an effector memory T-ccll, a CD4+ T-ccll, or a CD8+ T-ccll.
- the method further comprises inducing a regulatory T-cell phenotype or a memory regulatory T-cell phenotype in the cell or subpopulatiun of modified cells by inducing FoxP3 expression.
- the method further comprises introducing a polynucleotide encoding IL-10 and/or a suicide gene to the cell or subpopulation of modified cells.
- the method further comprises contacting the cell or subpopulation of modified cells with activation-induced soluble anti-lFNy antibody and/or anli-IL-5 antibody. Also provided are the cells prepared by these methods, that are optionally isolated.
- Engineered T-cell receptors described herein may comprise, consist of, or alternatively consist essentially of: (a) an extracellular antigen binding domain, (b) a transmembrane domain, and (c) an intracellular signaling domain, wherein the extracellular antigen binding domain binds an antigen that binds an MHC molecule, wherein the antigen binds to the MHC molecule with high affinity, and/or wherein the antigen induces a specific cytokine response, optionally an IL-17. IFNy, and/or II .-5 response.
- the engineered T-cell receptor is a modified T-cell receptor.
- the engineered T-ccll receptor is a chimeric antigen receptor (CAR).
- the extracellular antigen binding domain binds both the antigen and the MHC molecule.
- the polynucleotide or vector encodes the engineered T cell receptor.
- the cell or modified cell expresses the polynucleotide or vector and/or comprises an engineered T cell receptor on a surface of the cell or modified cell.
- the composition comprises one or more of the polynucleotide, vector, engineered T cell receptor, cell, modified cell, population comprising said cells or modified cells and, optionally, a carrier, such as but not limited to a pharmaceutically acceptable carrier.
- the response is characterized by suppression of pathogenic T- cells.
- the response is characterized by decreased expression of one or more proinflammatory cytokines in the cell, tissue, or subject, and optionally wherein the one or more proinflammatory cytokines comprise ⁇ .- ⁇ . TNF- ⁇ . IFN- ⁇ . II.-8. II. -6, II.- 12, II.- 15, II. -16, ⁇ .- ⁇ 7, IL-18, GM-CSF, IL-21. IL-23, IL-27, and/or TGF- ⁇ .
- the response is characterized by increased expression of one or more anti-inflammatory cytokines in the cell, tissue, or subject, and optionally wherein the one or more anti-inflammatory cytokines comprise TGF-P.
- IL-IRa 1L-4. IL-6, lL-10, IL-11, IL-13. IL-3S, and/or INF-a.
- the subject is murine, canine, feline, simian, equine, rat or human.
- a method of inducing an antiinflammatory response, mediating an immune response, or mediating an inflammatory response in a subject in need thereof comprising administering an effective amount of a polynucleotide, vector, engineered T cell receptor, cell, modified cell, population comprising said cells or modified cells, or composition according to any of the embodiments described herein, linginecrcd 1 -cell receptors described herein may comprise, consist of.
- the engineered T-ccll receptor is a modified T-ccII receptor.
- the engineered T-cell receptor is a chimeric antigen receptor (CAR).
- the extracellular antigen binding domain binds both the antigen and the MHC molecule.
- the polynucleotide or vector encodes the engineered T cell receptor.
- the cell or modified cell expresses the polynucleotide or vector and/or comprises an engineered T cell receptor on a surface of the cell or modified cell.
- the composition comprises one or more of the polynucleotide, vector, engineered T cell receptor, cell, modified cell, population comprising said cells or modified cells and, optionally, a carrier, such as but not limited to a pharmaceutically acceptable carrier.
- the response is characterized by suppression of pathogenic T-cells.
- the response is characterized by decreased expression of one or more pro-inflammatory cytokines in the cell, tissue, or subject, and optionally wherein the one or more pro-inflammatory cytokines comprise II.- IB, TNF-o, IFN- ⁇ , IL-8. IL-6, IL-12, IL-15, IL-16. IL-17, IL-18. GM-CSF. IL-21. IL-23, IL-27. and/or TGF- ⁇ .
- the response is characterized by increased expression of one or more antiinflammatory cytokines in the cell, tissue, or subject, and optionally wherein the one or more antiinflammatory cytokines comprise TGF- ⁇ , II.-I Ra, II.-4. II.-6, 11.
- the subject is murine, canine, feline, simian, equine, rat or human.
- Engineered T-cell receptors described herein may comprise, consist of, or alternatively consist essentially of: (a) an extracellular antigen binding domain, (b) a transmembrane domain, and (c) an intracellular signaling domain, wherein the extracellular antigen binding domain binds an antigen that binds an MI IC molecule, wherein the antigen binds to the MI IC molecule with high affinity, and/or wherein the antigen induces a specific cytokine response, optionally an 1L-17, ⁇ , and/or 1L-5 response.
- the engineered T-cell receptor is a modified T-cell receptor.
- the engineered T-ccll receptor is a chimeric antigen receptor (CAR).
- the extracellular antigen binding domain hinds both the antigen and the MHC molecule.
- the polynucleotide or vector encodes the engineered T cell receptor.
- the cell or modified cell expresses the polynucleotide or vector and/or comprises an engineered T cell receptor on a surface of the cell or modified cell.
- the composition comprises one or more of the polynucleotide, vector, engineered T cell receptor, cell, modified cell, population comprising said cells or modified cells and. optionally, a carrier, such as but not limited to a pharmaceutically acceptable carrier.
- the enhanced activity of the regulatory T-cell or memory regulatory T-cell is characterized by increased expression of IL- 10.
- the administration is to a cell or tissue.
- Administration to a cell or tissue may be in vivo, ex vivo, or in vitro.
- the administration is to a subject.
- the subject is murine, canine, feline, simian, or human.
- Another aspect of this disclosure relates to a method of treating a disease or condition involving an inflammatory 1 response or related to inflammation in a subject in need thereof, comprising administering to the subject an clTcclivc amount of a polynucleotide, vector, engineered T-cell receptor, cell, modified cell, population comprising said cells or modified cells, or composition according to any of the embodiments described herein.
- Engineered T-ccll receptors described herein may comprise, consist of.
- the engineered T-cell receptor is a modified T-cell receptor. In other aspects, the engineered T-cell receptor is a chimeric antigen receptor (CAR).
- CAR chimeric antigen receptor
- the extracellular antigen binding domain binds both the antigen and the MHC molecule.
- the polynucleotide or vector encodes the engineered T cell receptor.
- the cell or modified cell expresses the polynucleotide or vector and/or comprises an engineered T cell receptor on a surface of the cell or modified cell.
- the composition comprises one or more of the polynucleotide, vector, engineered T cell receptor, cell, modified cell, population comprising said cells or modified cells and. optionally, a carrier, such as hut not limited to a pharmaceutically acceptable carrier.
- the subject is murine, canine, feline, simian, equine, rat or human.
- a method of treating a neurodegenerative disease or disorder in a subject in need thereof comprising administering to the subject an cITcctivc amount of a polynucleotide, vector, engineered T cell receptor, cell, modified cell, population comprising said cells or modified cells, or composition according to any of the embodiments described herein.
- Engineered T-cell receptors described herein may comprise, consist of.
- the engineered T-ccll receptor is a modified T-ccll receptor.
- the engineered T-cell receptor is a chimeric antigen receptor (CAR).
- the extracellular antigen binding domain binds both the antigen and the MHC molecule.
- the polynucleotide or vector encodes the engineered T cell receptor.
- the cell or modified cell expresses the polynucleotide or vector and/or comprises an engineered T cell receptor on a surface of the cell or modified cell.
- the composition comprises one or more of the polynucleotide, vector, engineered T cell receptor, cell, modified cell, population comprising said cells or modified cells and. optionally, a carrier, such as but not limited to a pharmaceutically acceptable carrier.
- the neurodegenerative disease or disorder is a-synucleinopathy. Parkinson's disease.
- the method further comprises administering to the subject an effective amount of one or more immunosuppressive therapeutic compounds, optionally wherein the compounds are selected from calcineurin inhibitor, chemokine receptor inhibitor, a glucocorticoid, an mTOR inhibitor, an anti-metabolic compound, a phosphodiesterase- 5 inhibitor, an antibody, or a leukocyte function antigen-3/Fc fusion protein.
- the subject is murine, canine, feline, simian, equine, rat or human.
- Ihe cell, modified cell, or population comprising said cell or modified cell is autologous to the subject being treated.
- the cull is allogeneic to the subject.
- the cell can be from any appropriate species, e.g., mammalian, canine, feline, murine, rat, equine or human.
- the term "4- IBB costimulatory signaling region" refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%. or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the 4- 1 BB costimulatory signaling region sequence as shown herein.
- the example sequence of the 4- IBB costimulatory signaling region is provided in U.S. Pub. No. US20130266551 ⁇ 1.
- the sequence of the 4- IBB costimulatory signaling region associated disclosed in the U.S. Pub. No. US20130266551A1 is set forth herein as SEQ ID NO: 1 KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL.
- the term "about” is used to indicate that a value includes the standard deviation of error for the device or method being employed to determine the value.
- AAV adeno-associaled virus
- AAV refers to a member of the class of viruses belonging to the genus dependoparvovirus, family Parvoviridae. Multiple serotypes of this virus arc known to be suitable for gene delivery; all known serotypes can infect cells from various tissue types. At least 1 1 sequentially numbered, AAV serotypes are known in the art.
- Non-limiting exemplary serotypes useful in the methods disclosed herein include any of the 1 1 serotypes, e.g., AAV2, AAV8, AAV9. or variant serotypes. e.g., AAV-DJ.
- Nonlimiting exemplary AAV vectors arc disclosed in U.S. Pub. Nos. US20070036760A1, US20120I37379A1, and US20130195801 Al.
- administer and “administering” are used to mean introducing the therapeutic agent (e.g. polynucleotide, vector, cell, modified cell, population) into a subject.
- the therapeutic administration of this substance serves to attenuate any symptom, or prevent additional symptoms from arising.
- administration is for the purposes of preventing or reducing the likelihood of developing an autoimmune disease or disorder, the substance is provided in advance of any visible or detectable symptom.
- Routes of administration include, but are not limited to, oral (such as a tablet, capsule or suspension), topical, transdermal, intranasal. vaginal, rectal, subcutaneous intravenous, intraarterial, intramuscular, intraosseous, intraperitoneal, epidural and intrathecal.
- affinity refers to the strength of the reversible biomolccular interaction between two molecules.
- affinity refers to the interaction between the MHC molecule (or the antigen binding domain (e.g. peptide binding cleft) of an MHC molecule) and an antigen, antigen fragment, peptide, or epitope.
- affinity refers to the interaction between the ' ICR's variable domain regions and an antigen or antigen-MHC complex. Affinity is determined by calculating the equilibrium dissociation constant (KD) using a known method (e.g.
- antigen-MHC affinities reported herein reflect Kn and were calculated according to the method disclosed in Sidney, J. et al. J. Immunol. 185: 4189-4198 (2010). Affinity and KD are inversely related - the smaller the Kn value, the greater the binding affinity.
- high affinity refers to a KD of less than or equal to 1000 nM. Antigens bound to MHC with intermediate high affinity exhibit a Kn of between 10-100 nM. Antigens bound to MHC with very high affinity exhibit a KD of less than or equal to 10 nM.
- animal refers to living multi-cellular vertebrate organisms, a category that includes, for example, mammals and birds.
- mamal includes both human and non-human mammals.
- antibody collectively refers to immunoglobulins (or “Ig”) or immunoglobnlin-like molecules including hut not limited to antibodies of the following isolypes: IgM, IgA, IgD, IgE, IgG, and combinations thereof.
- Immunoglobulin-like molecules include but are not limited to similar molecules produced during an immune response in a vertebrate, for example, in mammals such as humans, rats, goats, rabbits and mice, as well as non-mammalian species, such as shark immunoglobulins (see Feige, M. et al. Proc. Nat. Ac. Sci. 41(22): 8155-60 (2014)).
- the term “antibody” includes intact immunoglobulins and "antibody fragments” or "antigen binding fragments” that specifically bind to a molecule of interest (or a group of highly similar molecules of interest) to the substantial exclusion of binding to other molecules (for example, antibodies and antibody fragments that have a binding constant for the molecule of interest that is at least 10 3 M' 1 greater, at least 10 4 M' 1 greater or at least 10* M " ' greater than a binding constant for other molecules in a biological sample).
- the term “antibody” also includes genetically engineered forms such as chimeric antibodies (for example, humanized murine antibodies), heteroconjugate antibodies (such as. bispecific antibodies). See also. Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, III.); Kuby, J., Immunology, 3 rf Ed., W.H. Freeman & Co., New York, 1997.
- the general structure of an antibody is comprised of heavy (H) chains and light (I .) chains connected by disulfide bonds.
- the structure can also comprise glycans attached at conserved amino acid residues.
- Each heavy and light chain contains a constant region and a variable region (also known as "domains").
- the constant regions of the heavy chain also contribute to the effector function of the antibody molecule.
- Antibodies comprising the heavy chains ⁇ , ⁇ , ⁇ 3, ⁇ , ol, ⁇ 2, ⁇ 4.
- ⁇ , and ⁇ 2 result in the following isotypes: IgM, IgD. Ig03, IgGI, IgAI. lgG2, IgG4, IgF, and lgA2. respectively.
- An IgY isotype. related to mammalian IgU. is found in reptiles and birds.
- An IgW isotype. related to mammalian IgD. is found in cartilaginous fish.
- Class switching is the process by which the constant region of an immunoglobulin heavy chain is replaced with a different immunoglobulin heavy chain through recombination of the heavy chain locus of a B-cell to produce an antibody of a different isotype.
- Antibodies may exist as monomers (e.g. IgG), dimcrs (e.g. IgA), tetramcrs (e.g. fish IgM), pentamers (e.g. mammalian IgM). and/or in complexes with other molecules.
- antibodies can be bound to the surface of a cell or secreted by a cell.
- the variable regions of the immunoglobulin heavy and the light chains specifically bind the antigen.
- the 'Tramework” region is a portion of the Fab that acts as a scaffold Tor three hypervariable regions called “complementarity-determining regions” (CDRs).
- CDRs complementarity-determining regions
- a set of CDRs is known as a paratope.
- the framework regions ⁇ difTcrcnl light or heavy chains are relatively conserved within a species.
- the combined framework region of an antibody (comprising regions from both light and heavy chains), largely adopts a ⁇ -shccl conformation and the CDRs form loops which connect, and in some cases form part of. the ⁇ -sheet structure.
- framework regions act to position the CDRs in correct orientation by inter-chain, non-covalent interactions.
- the framework region and CDRs for numerous antibodies have been defined and are available in a database maintained online (Rabat et ai. Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991).
- ITic CDRs of the variable regions of heavy and light chains (Vn and VL) arc responsible for binding to an epitope of an antigen.
- a limited number of amino acid positions within the CDRs arc directly involved in antigen binding. These positions within the CDRs arc called specificity determining residues (SDRs).
- the CDRs of a heavy or light chain are numbered sequentially starting from the N-lcrminal end (i.e. CDR1, CDR2, and CDR3). l or example, a Vi.CDR3 is the middle CDR located in the variable domain of the light chain of an antibody.
- a VH CDR I is the first CDR in the variable domain of a heavy chain of an antibody.
- An antibody that binds a specific antigen will have specific VH and VL region sequences, and thus specific CDR sequences.
- Antibodies with different specificities i.e. dilTcrcnt combining sites for different antigens) have different CDRs.
- an "antigen-binding fragment” refers to the regions of an antibody corresponding to two of the three fragments produced by papain digestion.
- the Fab fragment comprises the region that binds to an antigen and is composed of one variable region and one constant region from both a heavy chain and a light chain.
- An F(ab')2 fragment refers to a fragment of an antibody digested by pepsin or the enzyme IdeS (immunoglobulin degrading enzyme from S. pyogenes) comprising two Fab regions connected by disulfide bonds.
- a single chain variable fragment (“scFv”) refers to a fusion protein comprising at least one Vn and at least one VL region connected by a linker of between 5 to 30 amino acids. Methods and techniques of developing scFv that bind to specific antigens are known in the art (see. e.g. Ahmad, Z. A. et al.. Clinical and Developmental Immunology, 2012: 980250 (2012)).
- the term "antigen” refers to a compound, composition, or substance that may be specifically bound and/or recognized by the products of specific humoral or cellular immunity and antigen recognition molecules, including but not limited to an antibody molecule, single-chain variable fragment (scFv), cell surface immunoglobulin receptor, B-ccll receptor (DCR), T-cell receptor (TCR), engineered TCR, modified TCR. or CAR.
- scFv single-chain variable fragment
- DCR B-ccll receptor
- TCR T-cell receptor
- engineered TCR modified TCR.
- CAR CAR
- epitopope refers to an antigen or a fragment, region, site, or domain of an antigen that is recognized by an antigen recognition molecule.
- Antigens can be any type of molecule including but not limited to peptides, proteins, lipids, phospholipids haptens, simple intermediary metabolites, sugars (e.g., monosaccharides or oligosaccharides), hormones, and macromolecules such as complex carbohydrates (e.g., polysaccharides).
- Common categories of antigens include, but are not limited to microbial antigens such as viral antigens, bacterial antigens, fungal antigens, protozoa, and other parasitic antigens, antigens involved in autoimmune disease (including autoantigens), allergy, and graft rejection, tumor antigens, toxins, and other miscellaneous antigens.
- antigen binding domain refers to any protein or polypeptide domain that can specifically bind to an antigen target (including target complexes of antigens and MHC molecules).
- autologous in reference to cells, tissue, and/or grafts refers to cells, tissue, and/or grafts dial arc isolated from and then and administered back into the same subject, patient, recipient, and/or host.
- Allogeneic refers to non-autologous cells, tissue, and/or grafts.
- B cell refers to a type of lymphocyte in the humoral immunity of the adaptive immune system. D cells principally function to make antibodies, serve as antigen presenting cells, release cytokines, and develop memory B cells after activation by antigen interaction. B cells are distinguished from other lymphocytes, such as T cells, by the presence of a B-cell receptor on the cell surface. B cells may either be isolated or obtained from a commercially available source. Non-limiting examples of commercially available B cell lines include lines AHH-1 (ATCC® CRL-8146 ,M ).
- BC-1 (ATCC® CRL-2230TM), BC-2 (A ICC® CRL-2231 '"), BC-3 (ATCCtt CRL-2277TM), CA46 (ATCC® CRL-1648TM), DG-75 [D.G.-75] (ATCC® CRL- 2625 ,M ), DS-I (ATCC® CRL-1 1 102 IM ), EB-3 [BB3] (ATCC® CCL-85 rM ), Z-138 (ATCC #CRL-300I ).
- DB (ATCC CRL-2289).
- Toledo (ATCC CRL-2631 ), PfifTer( ATCC CRL-2632), SR (ATCC CRL-2262), JM-I (ATCC CRL-I042 I ).
- NFS-5 C-l (ATCC CRL-1693); NFS-70 CIO (ATCC CRL-1694), NFS-25 C-3 (ATCC CRL-1695), AND SUP-B15 (ATCC CRL-1929).
- Further examples include but are not limited to cell lines derived from anaplastic and large cell lymphomas, e.g., DEL, DL-40.
- FE-PD JB6.
- ATCC American Type Culture Collection
- ATCC www.atcc.org/
- German Collection of Microorganisms and Cell Cultures https://www.dsmz.de/).
- Cas9 reruns to a CRISPR associated cndonuclease referred to by this name.
- Non-limiting exemplary Cas9s include Staphylococcus aureus Cas9, nuclease dead C&s9, and orthologs and biological equivalents each thereof.
- Urthologs include but are not limited to Streptococcus pyogenes Cas9 ("spCas9 ,, ) I Cas 9 from Streptococcus thermophiles. Uglonella pneumophilia. Neisseria lactamica.
- CD3 zeta signaling domain or ⁇ 03 ⁇ refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% ammo acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD3 zeta signaling domain sequence as shown herein.
- Non-limiting exemplary sequences of the CD3 zeta signaling domain arc provided in U.S. Pub. No. US 2013/0266SS 1 A 1.
- An example oia CD3 zeta signaling domain sequence is set forth herein as SEQ ID NO: 2 RVKFSRSADAPAYQOGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEG LYNELQKDKMAEAYStlGMKGERRRGKGHDGLYQGLSTA l KDl YDALHMQALPPR.
- CD8 u hinge domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD8 a hinge domain sequence as shown herein.
- the example sequences of CD8 a hinge domain for human, mouse, and other species arc provided in Pinto, R.D. el al. (2006) Vet. Immunol. Immunopalhol. 1 10: 169- 177.
- Non-limiting examples of such sequences include: I luman CD8 alpha hinge domain set forth herein as SEQ ID NO: 3:
- PAKPTTTPAPRPPTPAPTIASQPLSI.RPEACRPAAGGAVIITRGI.DFACDIY Mouse CDS alpha hinge domain set forth herein as SEQ ID NO: 4: KVNSTTTKPVI.RTPSPVIIPTCiTSQPQRPEDCRPRGSVKGTGLDFACDIY, and Cat CDS alpha hinge domain set forth herein as SEQ ID NO: 5: PVKPTTTPAPRPPTQAPITTSQRVSLRPGTCQPSAGSTVEASGLDLSCDIY.
- CD8 u transmembrane domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CDS a transmembrane domain sequence as shown herein, llic fragment sequences associated with the amino acid positions 183 to 203 of the human T-cell surface glycoprotein CD8 alpha chain (NCRI Reference Sequence: NP_001759.3), or the amino acid positions 197 to 217 of the mouse T-cell surface glycoprotein CD8 alpha chain (NCBI Reference Sequence: NP_00l 074579.1 ), and the amino acid positions 190 to 210 of the rat T-ccll surface glycoprotein CD8 alpha chain(NCBI Reference Sequence: NP_ 1 13726.1 ) provide additional example sequences of the CD8 a transmembrane domain.
- sequences associated with each of the listed NCBI arc provided as follows: Human CD8 alpha transmembrane domain set forth herein as SF.Q ID NO: 6: lYIWAPLAGTCGVLLLSLVIT; Mouse CDS alpha transmembrane domain set forth herein as SF.Q ID NO: 7: IWAPI.AGICVAI.I.I.SI.IITI.I; Rat CD8 alpha transmembrane domain set forth herein as SEQ ID NO: 8: IWAPLAGICAVLLLSLVITLI.
- CD28 costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% ammo acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD28 costimulatory signaling region sequence shown herein.
- Exemplary CD28 costimulatory signaling domains are provided in U.S. Pat. No. 5,686,281 ; Geiger. T. L. et al.. Blood 98: 2364-2371 (2001 ); Hombach, A. et al.. J Immunol 167: 6123-6131 (2001 ): Maher, J. et al.
- Non-limiting examples include residues 1 14-220 of the CD28 Sequence set forth herein as SEQ ID NO: 9: MLRLLLALNL FPS1QVTGNK ILVKQSPMLV AYDNAVNLSC KYSYNLFSRE FRASLHKGLDSAVEVCVVYG NYSQQLQVYS KTGFNCDGKL GNESVTFYLQ NLYVNQTDIY FCKIEVMYPPPYLDNEKSNG TIII1VKGK1IL CPSPLFPGPS KPFVWLVVVG GVLACYSLLVTVAFIIFWVR SKRSRLLHSD YMNMTPRRPG PTRKHYQPYA PPRDFAAYRS, and equivalents thereof.
- CD28 transmembrane domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%. or alternatively at least 80% amino acid sequence identity, at least 90% sequence identity, or alternatively at least 95% sequence identity with the CD28 transmembrane domain sequence as shown herein.
- the fragment sequences associated with the NCDI Accession Nos: XM_006712862.2 and XM_009444056.1 provide additional, non-limiting, example sequences of the CD28 transmembrane domain.
- the sequences associated with each of the listed accession numbers are incorporated herein as SEQ ID NO: 10 and SEQ ID NO: 1 1, respectively.
- chimera intends that the sequence contains is comprised of at least one substiiutcnt unit (e.g. fragment, region, portion, domain, polynucleotide, or polypeptide) that is derived from, obtained or isolated from, or based upon other distinct physical or chemical entities.
- a chimera of two or more dilTcrcnl proteins may comprise the sequence of a variable region domain from an antibody fused to the transmembrane domain of a cell signaling molecule.
- a chimera intends that the sequence is comprised of sequences from at least two distinct species.
- chimeric antigen receptor refers to a fused protein comprising an extracellular domain capable of binding to an antigen, a transmembrane domain derived from a polypeptide different from a polypeptide from which the extracellular domain is derived, and at least one intracellular domain.
- the "chimeric antigen receptor (CAR)” is also known as a “T-body”, “chimeric receptor”, or “chimeric immune receptor (CIR).”
- the "extracellular domain capable of binding to an antigen” means any oligopeptide or polypeptide that can bind to a certain antigen.
- the "intracellular domain” means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell.
- the intracellular domain may comprise, alternatively consist essentially of, or yet further comprise one or more costimulatory signaling domains in addition to the primary signaling domain.
- the "transmembrane domain” means any oligopeptide or polypeptide known to span the cell membrane and that can function to link the extracellular and signaling domains.
- a chimeric antigen receptor may optionally comprise a "hinge domain" which serves as a linker between the extracellular and transmembrane domains.
- Non-limiting exemplary polynucleotide sequences that encode for components of each domain are disclosed herein, e.g.: Hinge domain: IgGl heavy chain hinge sequence set forth herein as SEQ ID NO: 12: CTCGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCG; Transmembrane domain: CD28 transmembrane region set forth herein as SEQ ID NO: 13: TTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACA GTGGCCTTTATTATTTTCTGGGTG; Intracellular domain: 4- IBB co-stimulatory signaling region set forth herein as SEQ ID NO: 14: AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGT ACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAG GAGGATGTGAACTG; Intracellular domain: CD28 co-stimulatory signaling region
- each exemplary domain component include other proteins that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the proteins encoded by the above disclosed nucleic acid sequences. Further, non- limiting examples of such domains are provided herein.
- composition typically intends a combination of the active agent, e.g., an engineered T-cell receptor, a modified T-cell receptor, a chimeric antigen receptor, a cell comprising an engineered T-cell receptor, a CAR T cell or a CAR NK cell, an antibody, a compound or composition, and a naturally-occurring or non-naturally-occurring carrier, inert (for example, a detectable agent or label) or active, such as an adjuvant, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like and include pharmaceutically acceptable carriers.
- the active agent e.g., an engineered T-cell receptor, a modified T-cell receptor, a chimeric antigen receptor, a cell comprising an engineered T-cell receptor, a CAR T cell or a CAR NK cell, an antibody, a compound or composition, and a naturally-occurring or non-naturally-occur
- Carriers also include pharmaceutical excipients and additives proteins, peptides, amino acids, lipids, and carbohydrates ⁇ e.g., sugars, including monosaccharides, di-, tri-, tetra- oligosaccharides, and oligosaccharides; derivatized sugars such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in combination I -99.99% by weight or volume.
- Exemplary protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rllA), gelatin, casein, and the like.
- amino acid/antibody components which can also function in a buffering capacity, include alanine, arginine, glycine, arginine. betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like.
- Carbohydrate excipients are also intended within the scope of this technology, examples of which include but are not limited to monosaccharides such as fructose, maltose, galactose, glucose, D-mannose.
- disaccharides such as lactose, sucrose, trehalose, cellobiose, and the like: polysaccharides, such as raffinose, melezitose. maltodextrins, dextrans, starches, and the like: and alditols, such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol) and myoinositol.
- disaccharides such as lactose, sucrose, trehalose, cellobiose, and the like
- polysaccharides such as raffinose, melezitose. maltodextrins, dextrans, starches, and the like
- alditols such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol) and my
- compositions and methods that include the recited elements, but not excluding others.
- Consisting essentially of when used to define compositions and methods shall mean excluding other elements of any essential significance to the combination for the stated purpose.
- a composition consisting essentially of the elements as defined herein would not exclude other materials or steps that do not materially affect the basic and novel characteristic(s) of the claimed disclosure, such as compositions for treating or preventing an autoimmune disease or disorder, a neurodegerative disease or disorder, such as Parkinson's disease .
- Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps. Embodiments defined by each of these transition terms are within the scope of this disclosure.
- consensus sequence refers to an amino acid or nucleic acid sequence that is determined by aligning a series of multiple sequences and that defines an idealized sequence that represents the predominant choice of amino acid or base at each corresponding position of the multiple sequences.
- the consensus sequence for the series can differ from each of the sequences by zero. one. a few. or more substitutions. Also, depending on the sequences of the series of multiple sequences, more than one consensus sequence may be determined for the series. The generation of consensus sequences has been subjected to intensive mathematical analysis. Various software programs can be used to determine a consensus sequence.
- CKISI'K refers to a technique of sequence specific genetic manipulation relying on the clustered regularly interspaced short palindromic repeats pathway.
- C'KISI'R can be used to perform gene editing and/or gene regulation, as well as to simply target proteins to a specific genomic location.
- Gene editing refers to a type of genetic engineering in which the nucleotide sequence of a target polynucleotide is changed through introduction of deletions, insertions, single stranded or double stranded breaks, or base substitutions to the polynucleotide sequence.
- CRISPR-mcdiatcd gene editing utilizes the pathways of nonhomologous end-joining (NHFJ) or homologous recombination to perform the edits.
- Gene regulation refers to increasing or decreasing the production of specific gene products such as protein or RNA.
- cytotoxic cdl intends a cell that is capable of killing other cells or microbes.
- cytotoxic cells include but are not limited to CD8+ T cells, natural-killer (NK) cells, NKT cells, and neutrophils, which cells are capable of mediating cytotoxicity responses.
- the term "detectable marker” refers to at least one marker capable of directly or indirectly, producing a detectable signal.
- a non-exhaustive list of this marker includes enzymes which produce a detectable signal, for example by colorimctry, fluorescence, luminescence, such as horseradish peroxidase, alkaline phosphatase, ⁇ -galaclosidase, glucose-6- phosphate dehydrogenase, chromophorcs such as fluorescent, luminescent dyes, groups with electron density detected by electron microscopy or by their electrical property such as conductivity, ampcromcU), voltammctry, impedance, detectable groups, for example whose molecules are of sufficient size to induce detectable modifications in their physical and/or chemical properties, such detection may be accomplished by optical methods such as diffraction, surface plasmon resonance, surface variation, the contact angle change or physical methods such as atomic force spectroscopy, tunnel effect, or radioactive molecules such as 32 P, 35 S or
- disease-relevant antigen refers to an antigen, epitope, or fragment thereof involved in the disease process or mechanism.
- an inflammation-relevant antigen is an antigen or fragment thereof that, when presented, produces an immune response. An inflammation-relevant antigen producing such an effect is selected to treat the inflammation.
- an autoimmunity-related antigen is an antigen that is relevant to an autoimmune disease and would not be selected for the treatment of a disorder or disease other than autoimmunity, e.g., cancer.
- Non-limiting, exemplary disease-relevant antigens are disclosed herein and further, such antigens may be determined for a particular disease based on the epitope screening techniques, mechanisms, and methods described herein.
- an effective amount or “efficacious amount” is an amount sufficient to achieve the intended purpose, non-limiting examples of such include: initiation of the immune response, modulation of the immune response, suppression of an inflammatory response and modulation of T cell activity or T cell populations.
- the effective amount is one that functions to achieve a stated therapeutic purpose, e.g., a therapeutically effective amount.
- the effective amount, or dosage depends on the purpose and the composition, and can be determined according to the present disclosure.
- nucleic acid sequences refers to a polynucleotide which is said to "encode” an KNA or polypeptide if. in its native state or when manipulated by methods well known to those skilled in the art, the nucleic acid can be transcribed and/or translated to produce a functional KNA (e.g. miRNA, siRNA, RNAi. tRNA. rRNA. snRNA. etc), an mRNA, or a polypeptide and/or a fragment thereof.
- the anliscnse strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
- an engineered T-cell receptor refers to a molecule comprising the elements of (a) an extracellular antigen binding domain, (b) a transmembrane domain, and (c) an intracellular signaling domain.
- an engineered T-cell receptor is a genetically modified I CR, a modified I CR, a recombinant I CR. a transgenic ICR, a partial I CR, a chimeric fusion protein, a CAR, a first generation CAR, a second generation CAR, a third generation CAR, or a fourth generation TRUCK.
- the engineered T-cell receptor comprises an antibody or a fragment of an antibody.
- the engineered T-cell receptor is a genetically modified I CR or a CAR.
- denotes regulatory sequence elements that augment, improve or ameliorate transcription of a nucleic acid sequence irrespective of its location and orientation in relation to the nucleic acid sequence to be expressed.
- An enhancer may enhance transcription from a single promoter or simultaneously from more than one promoter.
- any truncated, mutated or otherwise modified variants of a wild- type enhancer sequence are also within the above definition.
- the term "equivalent” or “biological equivalent” of an antibody means the ability of the antibody to selectively bind its epitope protein or fragment thereof as measured by ELISA or other suitable methods.
- Biologically equivalent antibodies include, but arc not limited to. those antibodies, peptides, antibody fragments, antibody variant, antibody derivative and antibody mimctics that bind to the same epitope as the reference antibody. It is to be inferred without explicit recitation and unless otherwise intended, that when the present disclosure relates to a polypeptide, protein, polynucleotide or antibody, an equivalent or a biologically equivalent of such is intended within the scope of this disclosure.
- biological equivalent thereof is intended to be synonymous with "equivalent thereof when referring to a reference protein, antibody, polypeptide or nucleic acid, intends those having minimal homology while still maintaining desired structure or functionality. Unless specifically recited herein, it is contemplated that any polynucleotide, polypeptide or protein mentioned herein also includes equivalents thereof. For example, an equivalent intends at least about 70% homology or identity, or at least 80 % homology or identity and alternatively, or at least about 85 %, or alternatively at least about 90 %. or alternatively at least about 95 %. or alternatively 98 % percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid.
- an equivalent thereof is a polynucleotide that hybridizes under stringent conditions to the reference polynucleotide or its complement.
- the term "equivalent” also includes but is not limited to a sub-sequence, portion, homologuc, variant or derivative thereof.
- the term "expression” refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.
- the expression level of a gene may be determined by measuring the amount of mRNA or protein in a cell or tissue sample.
- the expression level of a gene from one sample may be directly compared to the expression level of that gene from a control or reference sample.
- the expression level of a gene from one sample may be directly compared to the expression level of that gene from the same sample following administration of a compound.
- a “first generation CAR” refers to a CAR comprising an extracellular domain capable of binding to an antigen, a transmembrane domain derived from a polypeptide different from a polypeptide from which the extracellular domain is derived, and at least one intracellular domain.
- a “second generation CAR” refers to a first generation CAR further comprising one costimulation domain (e.g. 4-1 BB or CD28).
- a “third generation CAR” refers to a first generation CAR further comprising two costimulation domains (e.g. CD27, CD28, 1COS, 4-1 BB. or OX40).
- a "fourth generation CAR” (also known as a “TRUCK”) refers to a CAR T- ccll further engineered to secrete an additional factor (e.g. proinflammatory cytokine 1L-12).
- gRNA or "guide RNA” as used herein refers to guide RNA sequences used to target specific polynucleotide sequences for gene editing employing the CRISPR technique.
- Techniques of designing gRNAs and donor therapeutic polynucleotides for target specificity are well known in the art. For example, Doench, J., el al. Nature biotechnology 2014; 32( 12): 1262-7, Mohr, S. et al. (2016) FEBS Journal 283: 3232-38, and Graham, D., etal. Genome Biol. 20 IS; 16: 260.
- gRNA comprises or alternatively consists essentially of, or yet further consists of a fusion polynucleotide comprising CRISPR RNA (crRNA) and trans-activating CRIPSPR RNA (tracrRNA); or a polynucleotide comprising CRISPR RNA (crRNA) and trans-activating CRIPSPR RNA (tracrRNA).
- a gRNA is synthetic (Kelley. M. et al. (2016) J of Biotechnology 233 (2016) 74-83).
- HLA-A refers to an MHC class I cell surface receptor associated with this name and any other molecules that have analogous biological function that share at least 80% amino acid sequence identity, preferably 90% sequence identity, or alternatively at least 95% sequence identity with any HLA-A variant, including but not limited to any one of its several variants, including but not limited to IILA-A serotypes A I to A69.
- the gene locus of HLA-A is located at chromosome 6p21.3 (mRNA: NM_001242758, included herein as SEQ ID NO: 18, and NM_0021 16 included herein as SEQ ID NO: 19 ).
- ⁇ _ ⁇ microglobulin is encoded by the B2M gene located at chromosome 15:44.71-44.72 in humans and chromosome 2: 122.15 in mice (mRNA: NM_004048 included herein as SEQ ID NO: 20).
- IILA-A sequences are known in the art and a non-limited example is IILA- A*03:01:0:01 precursor set forth herein as SEQ ID NO: 17: MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFV RFDSDAASQRMEPRAPWIEQEGPEYWDQE ' I RNVKAQSQl DRVDLGl LRGY YNQSEAG SIITIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRICWE AAHEAEQLRAYLDG TCVEWLRRYLENGKETLQR TDPPK MM THHP1SDHEA I LRCWAL GFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHn GLPKPLI LRWELSSQP riPlVGIIAGLV
- a I type I diabetes
- A2 spontaneous abortion
- A3 hemochromatosis, myasthenia gravis, and multiple sclerosis
- a 1 1 papilloma virus susceptibility
- A24 ankylosing spondylitis, type I diabetes, and myasthenia gravis
- A26 adult T-cell leukemia
- ⁇ 30 myasthenia gravis
- ⁇ 68 adult T-cell leukemia
- ⁇ . ⁇ - ⁇ refers to an MHC class I cell surface receptor associated with this name and any other molecules that have analogous biological function that share at least 80% amino acid sequence identity, preferably 90% sequence identity, or alternatively at least 95% sequence identity with any HLA-B variant, including but not limited to any one of its several variants, including but not limited to IILA-B serotypes Bl to B83.
- the gene locus of HLA-B is located at chromosome 6:31.35-36 (mRNA: NM_005514 included herein as SEQ ID NO: 21 ).
- HLA-B is a heterodimer composed of an a chain (encoded by the I ILA-B gene) and a p chain.
- the ⁇ chain ( H ffe microglobulin") is encoded by the B2M gene located at chromosome 15:44.71 -44.72 in humans and chromosome 2: 122.15 in mice (mRNA: NM_004048, SEQ ID NO: 20).
- HLA-B sequences arc known in the art and a non-limited example of an HLA-B protein sequence is provided herein as SEQ 10 NO: 23: MLVMAPRTVLLLLSAALALTETWAGSIISMRYFYTSVSRPGRGEPRFISVGYVDDTQFV RFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGS I ITLQSMYGCDVGPDGRLLRG1 IDQYAYDGKDYI ALNEDLRSWTAADTAAQITQRKWEA AREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHP1SDHEATLRCWALG FYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVWPSGEEQRYTCl IVQI IEG LPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAA CSDS
- HLA-B serotypes and/or alleles are known in the art to be associated with disease.
- B27 is associated with ankylosing spondylitis, inflammatory joint diseases, psoriasis, inflammatory bowel disorders, reactive arthritis.
- ⁇ . ⁇ - ⁇ is also associated with HLA graft compatibility (e.g. HLA-A*02:01 to ⁇ . ⁇ - A*02:426).
- HLA-C refers to an MHC class I cell surface receptor associated with this name and any other molecules that have analogous biological function that share at least 80% amino acid sequence identity, preferably 90% sequence identity, or alternatively at least 95% sequence identity with any HLA-C variant, including but not limited to any one of its several variants, including but not limited to HLA-C serotypes Cw I to Cwl I and CI 2 to CI 8.
- the gene locus of HLA-C is located at chromosome 6:31.21 (mRNA: NM 0021 17, included herein as SEQ ⁇ NO: 24. and NM_001243042, included herein as SEQ ID NO: 25).
- HLA-C is a hctcrodimcr composed of an a chain (encoded by the HLA-C gene) and a ⁇ chain.
- the p chain (“
- HLA-C sequences are known in the art and a non-limited example is HLA-Cw-l precursor included herein as SEQ ID NO: 22: MRVMAPRALL LLLSUGLALT ETWACSHSMR YFDTAVSRPG RGEPRFISVG YVDDTQFVRF DSDAASPRGE PRAPWVEQF.G PEYWDRETQK YKRQAQADRV SLRNLRGYYN QSEDGSHTLQ RMSGCDLGPD GRLLRGYDQS AYDGKDY1AL NEDLRSWTAA DTAAQITQRK LEAARAAEQL RAYLEGTCVE WLRRYLENGK ETLQRAEPPK THVTHHPLSD HEATLRCWAL GFYPAEITLT WQRDGEDQTQ DTELVETRPA GDGTFQKWAA VVVPSGQEQR YTCHMQHEGL QEPLTLSWEP SSQPTIPIMG IVAGLAVLVV LAVLGAVVTA M
- HLA-C serotypes and/or alleles are known in the art to be associated with disease including but not limited to Cw 1 (multinodular goiters) and C* 16 (chronic B-cell lymphocytic leukemia). I ILA- C is associated with HLA graft compatibility.
- HI.A-DP refers to an MHC class II cell surface receptor associated with this name and any other molecules that have analogous biological function that share at least 80% amino acid sequence identity, preferably 90% sequence identity, or alternatively at least 95% sequence identity with any HLA-DP variant, including but not limited to any one of its several variants, including but not limited to HI .A-DP serotypes A I and R I and HI .A-DP alleles A 1*01 to A 1*04 and Bl*01 to Bl *l l . In humans, the gene locus of HLA-DP is located at chromosome 6p21.31 (mRNA: NM_0021 17 (SEQ ID NO 24).
- HLA-DP is a hclcrodimer composed of an u chain (encoded by the HLA-DPA1 gene) and a P chain (encoded by the HLA-DPBI gene).
- HLA-DPA1 is included herein as SEQ ID NO: 26: RPEDRMFH1RAVILRAI5LAFI.I.SLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDF.
- HI.A-DPBI is included herein as SEQ ID NO: 27:
- HLA-DR refers to an MHC class II cell surface receptor associated with this name and any other molecules that have analogous biological function that share at least 80% amino acid sequence identity, preferably 90% sequence identity, or alternatively at least 95% sequence identity with any HLA-DR variant, including but not limited to any one of its several variants, including but not limited to IILA-DR serotypes DRI to DR 75 comprising a combination of HLA-DRA and HLA-DRB haplotypes.
- HLA-DR sequences are known in the art and non-limited examples of such are disclosed in Rose, L.M. et al. ( 1996) Cancer Immunol. Immunother.43:26-30: HLA-DRB 1*1001 [DR101 which is included herein as SEQ ID NO: 28:
- HLA-DRB3*0201 [DR52] which is included herein as SEQ ID NO: 29:
- HLA-G also known as “MHC-G” refers to a specific molecule associated with this name and any other molecules that have analogous biological function that share at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with IILA-G, including but not limited to any one of its several isoforms.
- HLA-G is a nonclassical MIIC class I paralogue consisting of a helerodimer of a heavy chain and a jfc microglobulin. The genetic locus for HLA-G is found at chromosome 6:29.83 in humans and at chromosome 17:37.27 in mice.
- NM_002I27.5 included herein as SEQ ID NO: 31; XM_006715080.1, included herein as SEQ ID NO: 32; XM_006725041.1 , included herein as SEQ ID NO: 33; XM_006725700.1 , included herein as SEQ ID NO: 34: and XM_006725909.1 , included herein as SRQ ID NO: 35.
- SEQ ID NO: 36 An example of the protein translation of NM_002127.5 is included herein as SEQ ID NO:
- nucleic acids or polypeptide sequences refers to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, e.g., at least 60% identity, preferably at least 65%, 70%, 75%, 80%, 85%, 90%. 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region (eg., nucleotide sequence encoding an antibody described herein or amino acid sequence of an antibody described herein).
- Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. ⁇ degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences.
- the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel el a I., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1.
- default parameters are used for alignment.
- a preferred alignment program is BLAST, using default parameters.
- the terms also include sequences that have deletions and/or additions, as well as those that have substitutions.
- the preferred algorithms can account for gaps and the like.
- identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is at least 50- 100 amino acids or nucleotides in length.
- An "unrelated” or “non-homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences disclosed herein.
- Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
- the hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein binding, or in any other sequence-specific manner.
- the complex may comprise two strands forming a duplex structure, three or more strands forming a multi-stranded complex, a single self-hybridizing strand, or any combination of these.
- a hybridization reaction may constitute a step in a more extensive process, such as the initiation of a PCR reaction, or the enzymatic cleavage of a polynucleotide by a ribozymc.
- Examples of stringent hybridization conditions include: incubation temperatures of about 25°C to about 37°C: hybridization buffer concentrations of about 6x SSC to about lOx SSC; formamide concentrations of about 0% to about 25%: and wash solutions from about 4x SSC to about 8x SSC.
- Examples of moderate hybridization conditions include: incubation temperatures of about 40°C to about S0°C; buffer concentrations of about 9x SSC to about 2x SSC; formamide concentrations of about 30% to about 50%; and wash solutions of about Sx SSC to about 2x SSC.
- high stringency conditions include: incubation temperatures of about 55°C to about 68°C; buffer concentrations of about Ix SSC to about O.lx SSC; formamide concentrations of about 55% to about 75%; and wash solutions of about Ix SSC, O.lx SSC. or deionized water.
- hybridization incubation limes are from 5 minutes to 24 hours, with 1 , 2, or more washing steps, and wash incubation times are about 1, 2, or 15 minutes.
- SSC is 0.15 M NaCI and 15 mM citrate buffer. It is understood that equivalents ofSSC using other buffer systems can be employed.
- the term "1COS coslimulalory signaling region” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 00% sequence identity, more preferably at least 05% sequence identity with the ( COS coslimulalory signaling region sequence as shown herein.
- Non-limiting example sequences of the ICOS costimulatory signaling region are provided in U.S.
- immune response refers to the development of a cell-mediated response (e.g. mediated by antigen-specific T cells or their secretion products).
- a cellular immune response is elicited by the presentation of polypeptide epitopes in association with Class I or Class II MHC molecules, to treat or prevent a viral infection, expand antigen-specific Breg cells.
- the response may also involve activation of other components.
- the term “immune response” may be used to encompass the formation of a regulatory network of immune cells.
- regulatory network formation may refer to an immune response elicited such that an immune cell, preferably a T eel I. more preferably a T regulatory cell, triggers further differentiation of other immune cells, such as but not limited to, D cells or antigen-presenting cells - non limiting examples of which include dendritic cells, monocytes, and macrophages.
- regulatory network formation involves B cells being differentiated into regulatory B cells; in certain embodiments, regulatory network formation involves the formation of tolerogenic antigen- presenting cells.
- Immuno cells include all cells that arc produced by hematopoietic stem cells (lISC) including, but not limited to, HSCs, white blood cells (leukocytes), lymphocytes (including T cells, 13 cells, and natural killer (NK) cells) and mycloid-dcrived cells (neutrophils, eosinophils, basophils, monocytes, macrophages, dendritic cells).
- LISC hematopoietic stem cells
- Leukocytes include but are not limited to lymphocytes, granulocytes, monocytes, and macrophages.
- inflammatory response and "inflammation” as used herein indicate the complex biological response of immune cells, humoral factors, and vascular tissues of an individual or subject to exogenous or endogenous stimuli, such as pathogens, damaged cells, or irritants, and/or inflammatory signals such as pro-inflammatory cytokines.
- the inflammatory response includes secretion of cytokines and, more particularly, of pro-inflammatory cytokines, i.e. cytokines which are produced predominantly by activated immune cells and are involved in the amplification of inflammatory reactions.
- Exemplary pro-inflammatory cytokines and chemokines include but arc not limited to IL- ⁇ , TNF-o, IFN- ⁇ , IL-8, IL-6, IL-12, IL-15, IL-16, lL-17 (including family members IL17A. 1LI7B. IL-17C, IL-I7D. 1L-I7E, IL-I7F). IL-18. GM- CSF, IL-21, IL-23, IL-27 and TGF- ⁇ .
- Exemplary anti-inflammatory cytokines include but arc not limited to TGF- ⁇ , IL-IRot. 1L-4. IL-6, IL-10. lL-1 1. IL-13. IL-35. INF-a.
- a cytokine may have either pro-inflammatory and anti-inflammatory properties depending on the particular biological context (Cavaillon. J.M (2001 ) Cell Mol Biol 47(4): 69S-702).
- Exemplary inflammations include acute inflammation and chronic inflammation.
- Acute inflammation indicates a short-term process characterized by the classic signs of inflammation (swelling, redness, pain, heat, and loss of function) due to the infiltration of the tissues by plasma and leukocytes.
- An acute inflammation typically occurs as long as the injurious stimulus is present and ceases once the stimulus has been removed, broken down, or walled off by scarring (fibrosis).
- Chronic inflammation indicates a condition characterized by concurrent active inflammation, tissue destruction, and attempts at repair. Chronic inflammation is not characterized by the classic signs of acute inflammation listed above.
- chronically inflamed tissue is characterized by the infiltration of mononuclear immune cells (monocytes, macrophages, lymphocytes, and plasma cells), tissue destruction, and attempts at healing, which include angiogenesis and fibrosis.
- An inflammation can be inhibited in the sense of the present disclosure by affecting and in particular inhibiting any one of the events that form the complex biological response associated with an inflammation in an individual.
- exemplary diseases or conditions associated with or related to inflammation and/or inflammatory responses include but are not limited to multiple sclerosis, muscle injuries, graft versus host disease, Parkinson's disease, Alzheimer's, inflammatory bowel disease, Huntington's disease, amyotrophic lateral sclerosis, Behcet's disease, sarcopenia, aging, spinal cord injury, wound repair, and dysphagia. Additional diseases or conditions associated with or related to inflammation and/or inflammatory responses include autoimmune disease or disorders.
- autoimmune disease or disorder includes diseases or disorders arising from and directed against an individual's own tissues or organs or manifestation thereof or a condition resulting there from. In one embodiment, it refers to a condition that results from, or is aggravated by, the production by T cells that are reactive with normal body tissues and antigens.
- autoimmune diseases or disorders include, but are not limited to arthritis (rheumatoid arthritis such as acute arthritis, chronic rheumatoid arthritis, gout or gouty arthritis, acute gouty arthritis, acute immunological arthritis, chronic inflammatory arthritis, degenerative arthritis, type II collagen-induced arthritis, infectious arthritis, Lyme arthritis, proliferative arthritis, psoriatic arthritis.
- autoimmune urticaria myositis, polymyositis/dermatomyositis. juvenile dermatomyositis, toxic epidermal necrolysis, scleroderma (including systemic scleroderma), sclerosis such as systemic sclerosis, multiple sclerosis (MS) such as spino-optical MS.
- myositis polymyositis/dermatomyositis. juvenile dermatomyositis, toxic epidermal necrolysis, scleroderma (including systemic scleroderma), sclerosis such as systemic sclerosis, multiple sclerosis (MS) such as spino-optical MS.
- MS multiple sclerosis
- PPMS primary progressive MS
- RRMS relapsing remitting MS
- progressive systemic sclerosis atherosclerosis, arteriosclerosis, sclerosis disseminata, ataxic sclerosis, neuromyelitis optica spectrum disorder (NMO, also known as Devic's Disease or Devic's Syndrome), inflammatory bowel disease (IDD)
- NMO neuromyelitis optica spectrum disorder
- IBD inflammatory bowel disease
- Crohn's disease autoimmune-mediated gastrointestinal diseases, colitis such as ulcerative colitis, colitis ulcerosa, microscopic colitis, collagenous colitis, colitis polyposa, necrotizing enterocolitis, and transmural colitis, and autoimmune inflammatory bowel disease
- bowel inflammation pyoderma gangrenosum, erythema nodosum
- respiratory distress syndrome including adult or acute respiratory distress syndrome (ARDS).
- ARDS adult or acute respiratory distress syndrome
- meningitis inflammation of all or part of the uvea, ulceris, choroiditis, an autoimmune hematological disorder, rheumatoid spondylitis, rheumatoid synovitis, hereditary angioedema, cranial nerve damage as in meningitis, herpes gestationis, pemphigoid gestationis, pruritis scroti, autoimmune premature ovarian failure, sudden hearing loss due to an autoimmune condition.
- IgE-mediated diseases such as anaphylaxis and allergic and atopic rhinitis, encephalitis such as Rasmussen's encephalitis and limbic and/or brainstem encephalitis, uveitis, such as anterior uveitis, acute anterior uveitis, granulomatous uveitis, nongranulomatous uveitis, phacoantigenic uveitis, posterior uveitis, or autoimmune uveitis, glomerulonephritis (GN) with and without nephrotic syndrome such as chronic or acute glomerulonephritis such as primary GN, immune-mediated GN, membranous GN (membranous nephropathy), idiopathic membranous GN or idiopathic membranous nephropathy, membrano- or membranous proliferative GN (MPGN), including Type I and Type II, and rapidly progressive GN.
- GN
- balanitis including balanitis circumscripta plasmacellularis, balanoposthitis, erythema annulare centrifugum, erythema dyschromicum perstans, eythema multiform, granuloma annulare, lichen nitidus.
- lichen sclerosus et atrophicus lichen simplex chronicus, lichen spinulosis, lichen planus, lamellar ichthyosis, cpidcrmolytic hyperkeratosis, prcmalignant keratosis, pyoderma gangrenosum, allergic conditions and responses, allergic reaction, eczema including allergic or atopic eczema, aslealotic eczema, dyshidrotic eczema, and vesicular palmoplantar eczema, asthma such as asthma branchiate, bronchial asthma, and auto-immune asthma, conditions involving infiltration of T cells and chronic inflammatory responses, immune reactions against foreign antigens such as fetal A- D-O blood groups during pregnancy, chronic pulmonary inflammatory disease, autoimmune myocarditis, leukocyte adhesion deficiency, lupus, including lupus nephritis, lup
- NLE neonatal lupus syndrome
- lupus erythematosus disseminatus Type I diabetes.
- Type II diabetes latent autoimmune diabetes in adults (or Type l.S diabetes)
- Diamond Black fan anemia hemolytic anemia or immune hemolytic anemia including autoimmune hemolytic anemia (AIHA), Addison's disease, autoimmune neutropenia, pancytopenia, leukopenia, diseases involving leukocyte diapedesis, CNS inflammatory disorders, Alzheimer's disease.
- Parkinson's disease multiple organ injury syndrome such as those secondary to septicemia, trauma or hemorrhage, antigen-antibody complex-mediated diseases, anti-glomerular basement membrane disease, anti-phospholipid antibody syndrome, anti-phospholipid syndrome, allergic neuritis, Behcet's disease/syndrome, Castleman's syndrome, Goodpasture's syndrome.
- Reynaud's syndrome Sjogren's syndrome, Stevens-Johnson syndrome, pemphigoid such as pemphigoid bullous and skin pemphigoid, pemphigus (including pemphigus vulgaris, pemphigus foliaceus, pemphigus mucus-membrane pemphigoid, and pemphigus erythematosus), autoimmune polyendocrinopathies, Reiter's disease or syndrome, thermal injury, preeclampsia, an immune complex disorder such as immune complex nephritis, antibody-mediated nephritis, polyneuropathies, chronic neuropathy such as IgM polyneuropathies or IgM-mcdiated neuropathy, autoimmune or immune-mediated thrombocytopenia such as idiopathic thrombocytopenic purpura (ITP) including chronic or acute 1TP, acquired thrombocytopenic purpura, sclcritis such as
- autoimmune disease of the testis and ovary including autoimmune orchitis and oophoritis, primary hypothyroidism, hypoparathyroidism, autoimmune endocrine diseases including thyroiditis such as autoimmune thyroiditis, Hashimoto's disease, chronic thyroiditis (Hashimoto's thyroiditis), or subacute thyroiditis, autoimmune thyroid disease, idiopathic hypothyroidism. Graves disease.
- polyglandular syndromes such as autoimmune polyglandular syndromes (or polyglandular endocrinopathy syndromes), paraneoplastic syndromes, including neurologic paraneoplastic syndromes such as Lambert-Eaton myasthenic syndrome or Eaton-Lambert syndrome, stiff-man or stiff-person syndrome, encephalomyelitis such as allergic encephalomyelitis or encephalomyelitis allergica and experimental allergic encephalomyelitis (EAE), myasthenia gravis such as mymoma-associated myasthenia gravis, cerebellar degeneration, neuromyolonia, opsoclonus or opsoclonus myoclonus syndrome (OMS), and sensory neuropathy, multifocal motor neuropathy, Sheehan's syndrome, autoimmune hepatitis, chronic hepatitis, lupoid hepatitis, gianT cell hepatitis, chronic active hepatitis or autoimmune chronic active hepatitis,
- IgA nephropathy idiopathic IgA nephropathy
- linear IgA dermatosis acute febrile neutrophilic dermatosis
- subcorneal pustular dermatosis subcorneal pustular dermatosis
- transient acantholytic dermatosis cirrhosis such as primary biliary cirrhosis and pneumonocirrhosis
- autoimmune enteropathy syndrome autoimmune enteropathy syndrome.
- Celiac orCoeliac disease Celiac orCoeliac disease, celiac sprue (gluten enteropathy), refractory sprue, idiopathic sprue, cryoglobulinemia, amyotrophic lateral sclerosis (ALS; Lou Gehrig's disease), autoimmune ear disease such as autoimmune inner ear disease (AIED), autoimmune hearing loss, polychondritis such as refractory or relapsed or relapsing polychondritis, pulmonary alveolar proteinosis, Cogan's syndrome/nonsyphilitic interstitial keratitis. Bell's palsy.
- ALS amyotrophic lateral sclerosis
- AIED autoimmune inner ear disease
- polychondritis such as refractory or relapsed or relapsing polychondritis
- pulmonary alveolar proteinosis Cogan's syndrome/nonsyphilitic interstitial keratitis. Bell'
- Sweet's disease/syndrome rosacea autoimmune, zoster-associated pain, amyloidosis, a non-cancerous lymphocytosis, a primary lymphocytosis, which includes monoclonal B cell lymphocytosis (e.g., benign monoclonal gammopathy and monoclonal gammopathy of undetermined significance. MGUS), peripheral neuropathy, paraneoplastic .syndrome, channelopathies such as epilepsy, migraine, arrhythmia, muscular disorders, deafness, blindness, periodic paralysis, and channelopathies of the CNS, autism, inflammatory myopathy, focal or segmental or focal segmental glomerulosclerosis (FSGS).
- FSGS focal or segmental or focal segmental glomerulosclerosis
- endocrine ophthalmopathy uvcorctinitis, chorioretinitis, autoimmune hepatological disorder, fibromyalgia, multiple endocrine failure, Schmidt's syndrome, adrcnalitis. gastric atrophy, presenile dementia, demyelinating diseases such as autoimmune demyelinating diseases and chronic inflammatory demyelinating polyneuropathy, Drcssler's syndrome, alopecia greata. alopecia totalis. CREST syndrome (calcinosis.
- Chagas' disease rheumatic fever, recurrent abortion, farmer's lung, erythema multiforme, post- cardiotomy syndrome, Cushing's syndrome, bird-fancier's lung, allergic granulomatous angiitis, benign lymphocytic angiitis, Alport's syndrome, alveolitis such as allergic alveolitis and fibrosing alveolitis, interstitial lung disease, transfusion reaction, leprosy, malaria, parasitic diseases such as leishmaniasis, kypanosomiasis, schistosomiasis, ascariasis. aspergillosis. Sampler's syndrome.
- Caplan's syndrome dengue, endocarditis, endomyocardial fibrosis, diffuse interstitial pulmonary fibrosis, interstitial lung fibrosis, pulmonary fibrosis, idiopathic pulmonary fibrosis, cystic fibrosis, endophthalmitis, erythema elevatum et diutinum, erythroblastosis fetalis, eosinophilic faciitis, Shulman's syndrome, Feltys syndrome, flariasis, cyclitis such as chronic cyclitis, heterochronic cyclitis, iridocyclitis (acute or chronic), or Fuch's cyclitis, Ilenoch-Schonlein purpura, human immunodeficiency virus (HIV) infection, SOL), acquired immune deficiency syndrome (AIDS), echovinis infection, sepsis, endotoxemia, pancreatitis, thyroxicosis, parvovirus infection,
- Epstein-Barr virus infection Epstein-Barr virus infection, mumps. F.van's syndrome, autoimmune gonadal failure, Sydenham's chorea, poststreptococcal nephritis, thromboangitis ubiterans, thyrotoxicosis, tabes dorsalis, chorioiditis.
- gianT cell polymyalgia chronic hypersensitivity pneumonitis, keratoconjunctivitis sicca, epidemic keratoconjunctivitis, idiopathic nephritic syndrome, minimal change nephropathy, benign familial and ischemia-reperfusion injury, transplant organ reperfusion, retinal autoimmunity, joint inflammation, bronchitis, chronic obstructive airway/pulmonary disease, silicosis, aphthae, aphthous stomatitis, arteriosclerotic disorders, asperniogenese, autoimmune hemolysis, Boeck's disease, cryoglobulinemia, Dupuytren's contracture, endophthalmia phacoanaphylaciica.
- enteritis allergica erythema nodosum leprosum, idiopathic facial paralysis, chronic fatigue syndrome, fcbris rheumatics.
- pancreatitis polyradiculitis acuta, pyoderma gangrenosum, Quervain's thyreoiditis. acquired spcnic atrophy, non-malignant thymoma, vitiligo, toxic-shock syndrome, food poisoning, conditions involving infiltration of T cells, leukocyte-adhesion deficiency, immune responses associated with acute and delayed hypersensitivity mediated by cytokines and T-lymphocytes, diseases involving leukocyte diapedesis, multiple organ injury syndrome, antigen- antibody complex-mediated diseases, antiglomerular basement membrane disease, allergic neuritis, autoimmune polyendocrinopathies, oophoritis, primary myxedema, autoimmune atrophic gastritis, sympathetic ophthalmia, rheumatic diseases, mixed connective tissue disease, nephrotic syndrome, insulitis.
- autoimmune polyglandular syndrome type I adult- onset idiopathic hypoparathyroidism ( ⁇ )
- cardiomyopathy such as dilated cardiomyopathy, cpidcrmolisis bullosa acquisita (EBA)
- hemochromatosis myocarditis, nephrotic syndrome, primary sclerosing cholangitis, purulent or nonpurulent sinusitis, acute or chronic sinusitis, ethmoid, frontal, maxillary, or sphenoid sinusitis
- an eosinophil-related disorder such as eosinophilia, pulmonary infiltration eosinophilia, eosinophilia-myalgia syndrome, Lofllert syndrome, chronic eosinophilic pneumonia, tropical pulmonary eosinophilia, bronchopneumonic aspergillosis, aspergilloma, or granulomas containing eosinophils,
- Wiskott-Aldrich syndrome ataxia telangiectasia syndrome, angiectasis, autoimmune disorders associated with collagen disease, rheumatism, neurological disease, lymphadenitis, reduction in blood pressure response, vascular dysfunction, tissue injury, hyperalgesia, renal ischemia, cerebral ischemia, and disease accompanying vascularization, allergic hypersensitivity disorders, glomerulonephritides, repertusion injury, lymphomatous tracheobronchitis, inflammatory dermatoses, dermatoses with acute inflammatory components, multiple organ failure, bullous diseases, renal cortical necrosis, acute purulent meningitis or other central nervous system inflammatory disorders, ocular and orbital inflammatory disorders, granulocyte transfusion-associated syndromes, cytokine-induced toxicity, narcolepsy, acute serious inflammation, chronic intractable inflammation, pyelitis, endarterial hyperplasia, peptic ulcer, valvulitis, emphysema,
- introduce refers to the process whereby a foreign (i.e. extrinsic or extracellular) agent is introduced into a host cell thereby producing a cell comprising the foreign agent.
- Methods of introducing nucleic acids include but are not limited to transduction, retroviral gene transfer, iransfcction. clcciroporation. transformation, viral infection, and other recombinant DNA techniques known in the art.
- transduction is done via a vector (e.g. a viral vector).
- iransfcction is done via a chemical carrier, DNA/liposomc complex, or micelle (e.g.
- viral infection is done via infecting the cells with a viral particle comprising the polynucleotide of interest (e.g. AAV).
- introduction further comprises CRISPR mediated gene editing or Transcription activator-like effector nuclease (TALEN) mediated gene editing.
- CRISPR mediated gene editing or Transcription activator-like effector nuclease (TALEN) mediated gene editing.
- soluble factors, cytokines, proteins, peptides, enzymes, growth factors, signaling molecules, small molecule inhibitors include but are not limited to culturing the cells in the presence of the foreign agent, contacting the cells with the agent, contacting the cells with a composition comprising the agent and an excipient, and contacting the cells with vesicles or viral particles comprising the agent.
- isolated refers to molecules or biologicals or cellular materials being substantially free from other materials.
- isolated refers to nucleic acid, such as DNA or RNA. or protein or polypeptide (e.g.. an antibody or derivative thereof), or cell or cellular organelle, or tissue or organ, separated from other DNAs or RNAs, or proteins or polypeptides, or cells or cellular organelles, or tissues or organs, respectively, that are present in the natural source.
- isolated also refers to a nucleic acid or peptide that is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
- an "isolated nucleic acid” is meant to include nucleic acid fragments which are not naturally occurring as fragments and would not be found in the natural state.
- isolated is also used herein to refer to polypeptides which are isolated from other cellular proteins and is meant to encompass both purified and recombinant polypeptides.
- isolated is also used herein to refer to cells or tissues that are isolated from other cells or tissues and substantially separated from other cells of a tissue. "Isolated cell” is meant to encompass both cultured and engineered cells or tissues.
- linker sequence relates to any amino acid sequence comprising from 1 to 10, or alternatively, 8 amino acids, or alternatively 6 amino acids, or alternatively 5 amino acids that may be repealed from I to 10. or alternatively to about 8, or alternatively to about 6, or alternatively about S, or 4 or alternatively 3, or alternatively 2 times.
- the linker may comprise up to IS amino acid residues consisting of a pentapeptide repeated three times.
- the linker sequence is a (Glycine4Serine)3 flexible polypeptide linker comprising three copies of gly-gly-gly-gly-ser, or equivalents thereof.
- linker sequences are known in the art, e.g., GGGGSGGGGSGGGG (and equivalents thereof): the tripeptide EFM; or Glu-Phe-Gly-Ala-Gly-Leu-Val-Leu-Gly-Gly-Gln-Phe-Met, and equivalents of each thereof.
- a "flexible linker” intends a linker characterized by minimal rigidity.
- a flexible linker facilitates improved, preferred, or optimal secondary conformation, tertiary conformation, and/or quaternary conformation of the linked protein domains or full length polypeptide.
- a flexible linker reduces or minimizes negative steric effects.
- MHC major histocompatibility complex
- HLA human leukocyte antigen
- MHC class I MHC- I
- MHC-II MHC class II
- a particular antigen, peptide, and/or epitope is identified and presented in an antigen-MHC complex in the context of an appropriate MHC class I or II protein.
- the genetic makeup of a subject may be assessed to determine which MHC allele is suitable for a particular patient, disease, or condition with a particular set of antigens.
- the MHC genes arc known as the histocompatibility 2 (H-2) genes.
- Murine classical MHC class I subtypes include II-2D. II-2K, and H-2L.
- Murine non- classical MHC class I subtypes include H-2Q, H-2M, and H-2T.
- Murine classical MHC class II subtypes include ⁇ -2 ⁇ ( ⁇ - ⁇ ), and H-2F.
- Non-classical murine MHC class II subtypes include H-2M and H-20.
- Canine MHC molecules arc known as Dog Leukocyte Antigens (DLA).
- Feline MHC molecules are known as Feline Leukocyte Antigens (FI.A).
- an orthologous or homologous MHC molecule is selected to transition a therapy or treatment involving a specific antigen-MHC complex from one species to a different species.
- Non-classical MHC molecules are non-polymorphic, conserved among species, and possess narrow, deep, hydrophobic ligand binding pockets. These binding pockets are capable of presenting glycolipids and phospholipids to Natural Killer T (NKT) cells or certain subsets of CD8+ T-cells.
- NKT Natural Killer T
- MHCs for use according to the present disclosure may be produced, isolated, or purified through techniques known in the art. Common protocols for obtaining MHCs involve steps such as, but not limited to, electrophoresis or other techniques of charge or size based separation, biotinylation or other tagging methods and purification, or transfection and induction of vector constructs expressing MHC proteins. Purified animal antibodies arc also available through commercially available sources, including retailers such as eBioscience. Biolegend. or Tonbo Biosciences.
- the MHC may be classical MHC I, non-classical MHC I, classical MHC II. non-classical MHC II. dimers (Fc fusions). MHC tetramers.
- MHC multimcrs arc generated according to methods well documented in the art. see, e.g., Bakker et al. "MHC Multimer Technology: Current Status and Future Prospects," Current Opinion in Immunology, Vol. 17, No. 4 pp. 428-433 (2005) and references cited therein.
- MHC restriction refers to an antigen, antigen fragment, peptide, or epitope that is only specifically recognized and bound by an antigen binding domain when the antigen is bound to a particular MHC molecule.
- an MI IC-reslrictcd antigen is not specifically recognized and bound by an antigen binding domain outside of the context of a particular MHC molecule.
- the particular MHC molecule is a specific allele or subtype of H LA- A, HLA-B, HLA-C, HLA-b, HLA-F, HLA-G, HLA-DM, HLA- DO.
- the antigen binding domain is the antigen binding domain of an antibody, an antibody fragment, a CAR, an engineered TCR, or a B- cell receptor ("BCR").
- the term "monoclonal antibody” refers to an antibody produced by a cell into which the light and heavy chain genes of a single antibody have been transfected or, more traditionally, by a single clone of B-lymphocytcs.
- Monoclonal antibodies generally have affinity for a single epitope (i.e. they are monovalent) but may be engineered to he specific for two or more epitopes (e.g. bispecific). Methods of producing monoclonal antibodies arc known to those of skill in the art.
- Monoclonal antibodies include recombinant antibodies, chimeric antibodies, humanized antibodies, and human antibodies.
- NK cell also known as natural killer cell, refers to a type of lymphocyte that originates in the bone marrow and play a critical role in the innate immune system. NK cells provide rapid immune responses against viral-infected cells, tumor cells or other stressed cell, even in the absence of antibodies and major histocompatibility complex on the cell surfaces. NK. cells may cither be isolated or obtained from a commercially available source. Non-limiting examples of commercial NK cell lines include lines NK-92 (ATCC® CRL-2407TM). NK-92MI (ATCCtt CRL-2408TM). Further examples include but arc not limited to NK lines HANK1, KHYG-I. NKI.. NK-YS. NO 1-90.
- Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (http://www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures (https://www.dsnu.de/).
- the term "overexpress" with respect to a cell, a tissue, or an organ expresses a protein to an amount that is greater than the amount that is produced in a control cell, a control issue, or an organ.
- a protein that is overexpressed may be endogenous to the host cell or exogenous to the host cell.
- OX40 costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, or alternatively 90% sequence identity, or alternatively at least 95% sequence identity with the ⁇ 40 costimulatory signaling region sequence as shown herein.
- Non-limiting example sequences of the OX40 costimulatory signaling region are disclosed in U.S.
- a "pathogenic T cell” is a T cell that is harmful to a subject containing the T cell. Whereas, a non-pathogenic T cell is not substantially harmful to a subject, and an anti-pathogenic T cells reduces, ameliorates, inhibits, or negates the harm of a pathogenic T cell.
- protein refers to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics.
- the subunits may be linked by peptide bonds. In another aspect, the subunit may be linked by other bonds, e.g., ester, ether, etc.
- a protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise a protein's or peptide's sequence.
- amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics.
- polynucleotide and “oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonueleolides or ribonucleotides or analogs thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: a gene or gene fragment (for example, a probe, primer.
- a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide.
- sequence of nucleotides can be interrupted by non-nucleotide components.
- a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
- the term also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any aspect of this technology that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
- a polynucleotide is composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); thymine (T); and uracil (IJ) for thymine when the polynucleotide is RNA.
- a polynucleotide sequence is the alphabetical representation of a polynucleotide molecule. This alphabetical representation can be input into databases in a computer having a central processing unit and used for bioinrormatics applications such as functional genomics and homology searching.
- nucleic acid sequence and “polynucleotide” are used interchangeably to refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides.
- ⁇ polypeptide may contain a contiguous nucleic acid sequence of the following lengths: 10, 20, 30, 40, SO.60, 70. 80, 90. 100. 110. 120, 130, 140, ISO, 160. 170. 180. 190.200. 210. 220. 230, 240, 250, 260, 270, 280. 290, 300, 310, 320, 330, 340, 350, 360, 370. 380. 390. 400, 410, 420, 430. 440, 441, 450, 460, 470, 480, 490, 500, 510, 520, 530. 540, 550. 560. 570. 580. 590, 600. 610. 620. 630.
- nucleosides or base pairs.
- a particular polypeptide from may be encoded by nucleic acids containing natural variations that having slightly di!Tcrcnl nucleic acid sequences but. nonetheless, encode the same or substantially similar protein, polypeptide, or peptide.
- promoter refers to any sequence that regulates the expression of a coding sequence, such as a gene. Promoters may be constitutive, inducible, repressive, or tissue-specific, for example.
- a "promoter” is a control sequence that is a region of a polynucleotide sequence at which initiation and rale of transcription arc controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RN A polymerase and other transcription factors.
- Non-limiting exemplary promoters include CMV, U6, EFIa, SV40, PGKI (human or mouse). PS, Ubc. human beta actin, CAG, TRE, IJAS. Ac5. Polyhedrin. CaMKIIa.
- TEF1 GDS. ADIl l, CaMV35S. IJbi, III. U6. and Alpha- 1 -antitrypsin.
- Synthetically-derived promoters may be used for ubiquitous or tissue specific expression.
- virus-derived promoters some of which are noted above, may be useful in the methods disclosed herein, e.g., CMV, HIV, adenovirus, and AAV promoters.
- purification marker refers to at least one marker useful for purification or identification. ⁇ non-exhaustive list of this marker includes His, lacZ, GST, maltose-binding protein, NusA, BCCP.
- c-myc CaM, FLAG, GFP, YFP. cherry, thioredoxin. poly(NANP), V5, Snap, HA, chitin-binding protein, Softag I, Soflag 3, Strep, or S-protein.
- Suitable direct or indirect fluorescence marker comprise FLAG, GFP, YFP, RFP, dTomato, cherry, Cy3, Cy 5, Cy 5.5, Cy 7, DNP, AMCA, Biotin, Digoxigenin, Tamra, Texas Red, rhodamine, Alexa fluors, F1TC. TRITC or any other fluorescent dye or hapten.
- a purified nucleic acid, peptide, protein, biological complexes or other active compound is one that is isolated in whole or in part from proteins or other contaminants.
- substantially purified peptides, proteins, biological complexes, or other active compounds for use within the disclosure comprise more than 80% of all macromolccular species present in a preparation prior to admixture or formulation of the peptide, protein, biological complex or other active compound with a pharmaceutical carrier, excipient. buffer, absorption enhancing agent, stabilizer, preservative, adjuvant or other co-ingredient in a complete pharmaceutical formulation for therapeutic administration.
- the peptide, protein, biological complex or other active compound is purified to represent greater than 90%, often greater than 95% of all macromolecular species present in a purified preparation prior to admixture with other formulation ingredients.
- the purified preparation may be essentially homogeneous, wherein other macromolecular species are not detectable by conventional techniques.
- the term “recognizes and specifically binds” or “antibody binding” or “specific binding” means the contact between the antigen binding domain of an antibody, antibody fragment.
- an antigen binding domain binds to both a complex of both an antigen and an MHC molecule.
- antigen binding domains bind with affinities of less than about 10 ⁇ ' M, 10 7 M.
- specific binding refers to the binding of an antigen to an MHC molecule, or the binding of an antigen binding domain of an engineered T-cell receptor to an antigen or antigen-MI IC complex.
- recombinant protein refers to a polypeptide which is produced by recombinant DNA techniques, wherein generally, DNA encoding the polypeptide is inserted into a suitable expression vector which is in turn used to transform a host cell to produce the heterologous protein.
- a polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) having a certain percentage (for example, 80%, 85%, 90%. or 95%) of "sequence identity" to another sequence means that, when aligned, that percentage of bases (or amino acids) arc the same in comparing the two sequences.
- the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al.. eds. 1987) Supplement 30. section 7.7.18. Table 7.7.1.
- default parameters arc used for alignment.
- a preferred alignment program is BLAST, using default parameters.
- signal peptide or “signal polypeptide” intends an amino acid sequence usually present al the N-lerminal end of newly synthesized secretory or membrane polypeptides or proteins. It acts to direct the polypeptide across or into a cell membrane and is then subsequently removed Examples of such are well known in the art. Non-limiting examples are those described in U.S. Patent Nos. 8,853,381 and 5,958,736.
- the terms "subject.” “host,” “individual,” and “patient” are as used interchangeably herein to refer to human and veterinary subjects, for example, humans, animals, non-human primates, dogs, cats, sheep, mice, horses, and cows.
- the subject is a human.
- the subject is suffering from a disease or condition to be treated by one of the methods disclosed herein.
- suicide gene refers to a gene encoding a factor that is capable of inducing death in a cell that expresses it.
- a suicide gene provides a strategy to regulate cell persistence by providing a mechanism for specific depletion of cells expressing the suicide gene. Once activated. the suicide gene kills the cell through, for example, apoptosis or cell-mediated cytotoxicity.
- Non limiting examples of suicide genes include (1) iCasp9 which is activated by administration of API 903 to cause apoptosis, (2) CD20 which is activated by administration of CD-20 specific antibody rituximab causing depletion through antibody-dependent cellular cytotoxicity, and (3) herpesvirus thymidine kinase which is activated by ganciclovir.
- T-cell refers to a type of lymphocyte that matures in the thymus. T cells play an important role in cell-mediated immunity and arc distinguished from other lymphocytes, such as R cells, by the presence of a T-cell receptor (TCR) on the cell surface. T- cclls may either be isolated or obtained from a commercially available source. * T cell” includes all types of immune cells expressing CD3 including T-helper cells (CD4+ cells), cytotoxic T-cells (CD8+ cells), natural killer T-cclls, naive T cells (CCR7+, CD45RA+), central memory T-cclls (CCR7+, CD45RA-).
- T-regulatory cells Treg
- gamma-dclla T cells T-regulatory cells
- Natural killer T cells TCR co-express NK cell markers and a semi- invariant T cell receptor (TCR). They are implicated in the regulation of immune responses associated with a broad range of diseases.
- Non-limiting examples of commercially available T- cell lines include lines BCL2 (AAA) Jurkat (ATCCCD CRL-2902TM), BCI.2 (S70A) Jurkat (ATCC® CRL-2900TM), BCL2 (S87A) Jurkat (ATCC® CRL-2901TM), BCL2 Jurkat (ATCC® CRI.-2899TM).Neo Jurkat (ATCCflDCRL-2898TM),TAI.I.-l04 cytotoxic human Tcell line(ATCC # CRL-11386).
- ⁇ ' -ccll lines e.g., such as Deglis, F.BT-8, HPB-Ml.p-W, HIJT 78, HUT 102, Karpas 384, Ki 225, My-I.a, Sc-Ax, SKW-3, SMZ-I and 134: and immature T- cell lines, e.g., ALL-SIL. Bel 3. CCRF-CKM, CML-Tl, DND- 41, Dl 1.528, F.U-9, HD-Mar, ⁇ - ⁇ . ⁇ ., H-SB2. HT-1, JK-TI, Jurkat, Karpas 45, KF.-37, KOPT- Kl. K-TI.
- mature ⁇ ' -ccll lines e.g., such as Deglis, F.BT-8, HPB-Ml.p-W, HIJT 78, HUT 102, Karpas 384, Ki 225, My-I.a, Sc-Ax, S
- J.CaMl .6 (ATCC CRL-2063), RS4;1 1 (ATCC CRL-1873).
- CCRF-CEM ATCC CRM-CCL-1 19
- cutaneous T-cell lymphoma lines e.g., HuT78 (ATCC CRM-TIB-161 ).
- GI 11 (ATCC CRL-8294), Hull 02 (ATCC ⁇ -162).
- Null leukemia cell lines including but not limited to REIl, NALL-l, KM-3, 1.92-221, are a another commercially available source of immune cells, as arc cell lines derived from other leukemias and lymphomas. such as K562 crythroleukemia, THP-1 monocytic leukemia.
- HEL erythroleukemia, IIL60 leukemia, HMC-1 leukemia, KG- 1 leukemia, U266 myeloma include the American Type Culture Collection, or ATCC, (http://www.atcc.orgO and the German Collection of Microorganisms and Cell Cultures (https://www.dsmz.de/).
- T-cell receptor refers to a cell surface molecule found on T-cells that functions to recognize and bind antigens presented by antigen presenting molecules.
- a TCR is a hetemdimer of an alpha chain (TRA) and a beta chain (TRR).
- TRU alternative gamma
- TRD delta
- T-cells expressing this version of a TCR are known as ⁇ T-cells.
- TCRs are part of the immunoglobulin supcrfamily. Accordingly, like an antibody, the TCR comprises three hypcrvariablc CDR regions per chain.
- the TCR hclerodimcr is generally present in an octomcric complex that further comprises three dimcric signaling modules CD3y/e, CD3o7e. and CD247 ⁇ / ⁇ or ⁇ / ⁇ .
- a nonlimiting exemplary amino acid sequence of the human TCR-alpha chain is included herein as SEQ ID NO: 39: MF.TLLGVSI .VII.WI.QLARVNSQQGEF.DPQAI 51QEGF.NATMNCSYKTS1NNI,QWYRQN SGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCAPVLSGGGAD GI.TFGKGTHI.IIQPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITD KTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFET DTNI .NFQNI .SVIGFRH .1.1.KVAGFNI .1.MTI .RI .WSS.
- a Nonlimiting exemplary amino acid sequence of the human ICR-beta chain is included herein as SEQ ID NO: 40:
- modified TCR refers to a I CR that has been genetically engineered, and/or a transgenic TCR. and/or a recombinant TCR.
- modified TCRs include single-chain ⁇ TCRs (scTv), full-length TCRs produced through use of a T cell display system, and TCRs wherein the CDR regions have been engineered to recognize a specific antigen, peptide, fragment, and/or MHC molecule.
- scTv single-chain ⁇ TCRs
- Methods of developing and engineering modified TCRs are known in the art. For example, see Stone, J.D. et al. Methods in Enzymology 503: 189-222 (2012), PCI ' Application WO2014018863 Al.
- TRI cells are a subset of CD4+ T cells that have regulatory properties and are able to suppress antigen-specific immune responses in vi/ro and in vivo. These TRI cells are defined by their unique profile of cytokine production and make high levels of IL-IO and TGF-beta, but no IL-4 or IL-2. The IL-10 and TGF-beta produced by these cells mediate the inhibition of primary naive T cells in vitro. There is also evidence that TR cells exist in vivo, and the presence of high IL-10-producing CD4(+) T cells in patients with severe combined immunodeficiency who have received allogeneic stem-cell transplants have been documented.
- TR 1 cells are involved in the regulation of peripheral tolerance and they could potentially be used as a cellular therapy to modulate immune responses in vivo. See, for example, Levings, M. et al. J. Allergy Clin. Immunol. 106(1 Pt2):SI09-l2 (2000).
- TRI cells arc defined by their ability to produce high levels of IL-10 and TUF-bcia. Trl cells specific for a variety of antigens arise in vivo, but may also differentiate from naive CD4+ T cells in the presence of IL-10 in vitro. TRI cells have a low proliferative capacity, which can be overcome by 11.-15. TRI cells suppress naive and memory T helper type I or 2 responses via production of IL-10 and TUF-bcta. Further characterization of TRI cells at the molecular level will define their mechanisms of action and clarify their relationship with other subsets of Tr cells.
- TRI cells to identify novel targets for the development of new therapeutic agents, and as a cellular therapy to modulate peripheral tolerance, can be foreseen. See, for example. Roncarolo. M. ct al. Immunol. Rev. 182:68-79 (2001 ).
- treating or “treatment” of a disease or condition in a subject refers to ( 1 ) preventing the symptoms or disease or condition from occurring in a subject that is predisposed or does not yet display symptoms of the disease; (2) inhibiting the disease or condition or arresting its development; or (3) ameliorating or causing regression of the disease or condition or the symptoms of the disease or condition.
- treatment is an approach for obtaining beneficial or desired results, including clinical results.
- beneficial or desired results can include one or more, but are not limited to, alleviation or amelioration of one or more symptoms, diminishment of extent of a condition (including a disease), stabilized (i.e., not worsening) state of a condition (including disease), delay or slowing of condition (including disease), progression, amelioration or palliation of the condition (including disease), states and remission (whether partial or total), whether detectable or undetectable.
- the disease or condition is associated with the immune response, the clinical endpoints will vary by the specific tissue targeted or affected by the immune response.
- the disease is neurodegeneration, e.g.
- Parkinson's disease exemplary clinical endpoints for successful treatment include but are not limited to ( I ) improvement or stabilization of the following: unified Parkinson's disease rating scale (UPDKS) rating, motor function, ambulation, and/or speech; (2) decreased time to dementia and/or nursing home placement: (3) decreases or stabilization of autonomic failure. falls, and/or cognitive symptoms. Additional clinical endpoints are described in more detail herein.
- UPDKS unified Parkinson's disease rating scale
- unit dose refers to physically discrete units suitable for use in a subject, each unit containing a predetermined quantity of the composition calculated to produce the desired responses in association with its administration, i.e., the appropriate route and regimen.
- the quantity to be administered depends on the result and/or protection desired. Precise amounts of the composition also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting dose include physical and clinical state of the subject, route of administration, intended goal of treatment (alleviation of symptoms versus cure), and potency, stability, and toxicity of the particular composition.
- solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically or prophylactically effective.
- the formulations arc easily administered in a variety of dosage forms, such as the type of injectable solutions described herein.
- vector refers to a nucleic acid construct deigned for transfer between different hosts, including but not limited to a plasmid, a virus, a cosmid, a phage, a BAC, a YAC, etc.
- a "viral vector” is defined as a recombinantly produced virus or viral particle that comprises a polynucleotide to be delivered into a host cell, either in vivo, ex vivo or in vitro.
- plasmid vectors may be prepared from commercially available vectors.
- viral vectors may be produced from baculoviruses, retroviruses, adenoviruses, AAVs, etc.
- the viral vector is a Ienti viral vector.
- examples of viral vectors include retroviral vectors, adenovirus vectors, adeno- associated virus vectors, alphavirus vectors and the like.
- Infectious tobacco mosaic virus (TMV)- based vectors can be used to manufacturer proteins and have been reported to express Griffithsin in tobacco leaves (OTCeefe et al. (2009) Proc. Nat. Acad. Sci. USA ⁇ 06 ⁇ 5):6099-6 ⁇ 04).
- Alphavirus vectors such as Semliki Forest virus-based vectors and Sindbis virus-based vectors, have also been developed for use in gene therapy and immunotherapy. See, Schlesinger & Dubensky (1999) Curr. Opin.
- a vector construct refers to the polynucleotide comprising the retroviral genome or part thereof, and a gene of interest such as a polynucleotide encoding a CAR. Further details as to modern methods of vectors for use in gene transfer may be found in. for example, Kotterman et al. (2015) Viral Vectors for Gene Therapy: Translational and Clinical Outlook Annual Review of Biomedical Engineering 17.
- Vectors that contain both a promoter and a cloning site into which a polynucleotide can be operatively linked are well known in the art. Such vectors are capable of transcribing RNA in vitro or in vivo, and are commercially available from sources such as Agilent Technologies (Santa Clara, Calif.) and Pnimega Biotech (Madison, Wis.).
- an engineered T-cell receptor comprising, consisting essentially of, or yet further consisting ⁇ : (a) an extracellular antigen binding domain, (b) a transmembrane domain, and (c) an intracellular signaling domain, wherein the extracellular antigen binding domain binds an antigen that binds an MIIC molecule, wherein the antigen binds to the MHC molecule with high affinity, and/or wherein the antigen induces a specific cytokine response, optionally an II.- 17, IFNy, and/or II.-5 response.
- the antigen is bound to the MHC molecule.
- the engineered T-cell receptor is a modified TCR.
- the engineered T-cell receptor is a CAR.
- the polynucleotide is the complement of a polynucleotide encoding an engineered T-cell receptor. Also provided herein are the expression product(s) of the polynucleotide encoding an engineered T-cell receptor.
- the present disclosure provides an engineered T-cell receptor that comprises, consists, or alternatively consists essentially of an antigen binding domain that specifically recognizes and binds, binds, or is specific to an antigen bound to an MHC molecule.
- the MHC binds to the antigen with high affinity, optionally an affinity less than 1000 nM.
- the antigen binds to the MHC with high affinity, optionally an affinity less than 1000 nM.
- the affinity of the interaction between the antigen and the MHC molecule is characterized by a dissociation constant (Kn) which is less than about 0.1 nM, less than than about I nM, less than about 5 nM. less than about 10 nM. less than about IS nM, less than about 20 nM, less than about SO nM, less than about 100 nM, less than about ISO nM, less than about 200 nM. less than about 250 nM, less than about 300 nM, less than about 350 nM. less than about 400 nM, less than about 450 nM, less than about 500 nM, less than about 550 nM, less than about 600 nM.
- Kn dissociation constant
- nM less than about 650 nM, less than about 700 nM, less than about 750 nM, less than about 800 nM, less than about 850 nM, less than about 900 nM, less than about 950 nM, less than about 1000 nM, less than about 1100 nM, less than about 1200 nM, less than about 1300 nM, less than about 1400 nM, less than about 1500 nM, less than about 2000 nM. less than about 2500 nM.
- the affinity of the interaction between the antigen and the MHC molecule ranges from: about I nM to about 10 nM. about I nM to about 15 nM, about 1 nM to about 50 nM, about I nM to about 100 nM, about I nM to about 200 nM, about I nM to about 300 nM, about 1 nM to about 400 nM. about I nM to about 500 nM.
- I nM to about 600 nM about I nM to about 700 nM, about I nM to about 800 nM, about I nM to about 900 nM, about I nm to about 1000 nM, about I nM to about 1 100 nM, about I nM to about 1200 nM, about I nM to about 1300 nM, about I nM to about 1400 nM, about 1 nM to about 1500 nM.
- nM to about 2 uM about 1 nM to about 3 uM, about 1 nM to about 4 ⁇ , about 1 nM to about 5 uM , about 10 nM to about 15 nM, about 10 nM to about 50 nM, about 10 nM to about 100 nM. about 10 nM to about 200 nM. about 10 nM to about 300 nM, about 10 nM to about 400 nM, about 10 nM to about 500 nM, about 10 nM to about 600 nM, about 10 nM to about 700 nM, about 10 nM to about 800 nM. about 10 nM to about 900 nM.
- about 50 nM to about 1300 nM, about 50 nM to about 1400 nM about 50 nM to about 1500 nM, about 50 nM to about 2 ⁇ .
- the MHC's affinity for the antigen is less than about 1000 nM.
- the antigen comprises, consists, or alternatively consists essentially of all or part of an epitope derived from an antigen of the group of: a microbial antigen, a viral antigen, a bacterial antigen, a fungal antigen, a protozoan antigen, an antigen involved in autoimmune disease, a neurodegenerative disease, an autoantigen. an allergy antigen, a graft rejection antigen, a tumor antigen, or a cancer or tumor antigen.
- the antigen comprises all or part of a toxin.
- the antigen comprises all or part of an epitope derived from an antigen involved in a neurodegenerative disease or disorder such as a-synucleinopathy, Parkinson's disease. Lewy Body dementia, or Alzheimer's disease.
- the antigen comprises all or part of an epitope derived from a-synuclein (NM_000345, included herein as SEQ ID NO: 41; NM_001 146054, included herein as SEQ ID NO: 42: NM_001 146055, included herein as SF.Q ID NO: 43: and NM_007308 included herein as SF.Q ID NO: 44), Tau protein (Nl'JJOl 1 16538, included herein as SliQ ID NO: 45: NP_001 1 16539, included herein as SF.Q ID NO: 46: NP_001 190180.
- a-synuclein NM_000345, included herein as SEQ ID NO: 41; NM_001 146054, included herein as SEQ ID NO: 42: NM_001 146055, included herein as SF.Q ID NO: 43: and NM_007308 included herein as SF.Q ID NO: 44
- Tau protein Nl'JJOl
- SF.Q ID NO: 47 NP_00l 190181 , included herein as SEQ ID NO: 48; and NP_005901, included herein as SEQ ID NO: 49), or TAR DNA- binding protein 43 (TDP-43. NP_031401. included herein as SEQ ID NO: 50: and NP_031401 I . included herein as SEQ ID NO: 51 ), or equivalents of each thereof.
- amino acid sequence of a-synuclein is included herein as SEQ ID NO: 52:
- the antigen comprises, consists, or alternatively consists essentially of all or part of any one of the peptides listed in the following Table 1. or equivalents thereof.
- the antigen comprises, consists, or alternatively consists essentially of all or part of the amino acid sequence of the amino acid sequence KTKEGVLY VGSK.TK.E (SEQ ID NO: 55), MPVDPDNF.AYF.MPSE (SEQ ID NO: 56). DNEAYEMPSFEGYQD (SEQ ID NO: 57), EMPSEEGYQDYEPEA (SEQ ID NO: 58). VLYVGSKTK (SEQ ID NO: 59). or an equivalent of each thereof.
- the length of the antigen disclosed herein may vary based on the particular MHC allele and/or the specific antigen recognition domain (eg. TCR, seFv, etc.).
- the length of the antigen peptides according to some embodiments described herein may vary from, for example, at least 5, al least 6, at least 7, at least 8, at least 9, at least 10, at least I I, at least 12, at least 13, at least 14, at least 15. at least 16. at least 17. at least 18. at least 19. at least 20. between 20 - 25. between 20-30, between 30-40 amino acids, or up to 50 amino acids in length.
- the antigen includes a core of at least at least 5 amino acids, at least 6, at least 7. at least 8, al least 9 and more.
- the length of the autoantigenic peptide does not exceed about 100 amino acids, does not exceed about 50 amino acids, does not exceed about 30 amino acids, or docs not exceed 20 amino acids. According to some embodiments of the invention, the length of the autoantigenic peptide includes at least 5 and no more than 35 amino acids.
- antigens or equivalents thereof that exhibit sequence identity to a reference a-synuclein, Tau, or TDP-43.
- the antigens or equivalents thereof comprise, consist or consist essentially of a sequence at least 60% or more (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%. etc.) identical to a reference peptide of Table I. or sub-sequence, portion, homologuc, variant thereof.
- the antigens disclosed herein have one or more modifications, such as an amino acid addition to, deletion of, or substitution of any amino acid residue in any peptide set forth in Table 1 or to the reference sequence of ⁇ -symic!ein, Tau, or TDP-43.
- a modified sequence is at least 80% or more, e.g., 80-85%, 85-90%, 90-95%, 95-100% identical to a Table I peptide or to the reference sequence of a-synuclein, Tau. or TDP- 43, or sub-sequence, portion, homologuc or derivative thereof or has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1, 12. 13, 14. 15. 16. 17. 18. 19.20. 20-25. 25-30.30-50. 50-100. or more, additions to. deletions of. or substitutions.
- antigen binding domains that recognize and/or bind modified and variant forms of antigens including but not limited to ⁇ -synuclein, Tau, TDP-43 peptides, or equivalents thereof.
- modified and variant forms of antigens include but not limited to ⁇ -synuclein, Tau, TDP-43 peptides, or equivalents thereof.
- modifications intend an antigen or equivalent thereof that deviates from a reference sequence.
- modifications may have greater or less activity or function than a reference peptide such as ability to elicit, stimulate, induce, promote, increase or enhance a T-cell response or immune or inflammatory response.
- the antigens or equivalents disclosed herein include sequences having substantially the same, greater or less relative activity or function as a T-cell epitope than a reference epitope set forth in in Table 1 , for example, an ability to elicit, stimulate, induce, promote, increase or enhance an immune response in vitro or in vivo.
- Non-limiting examples of modifications include one or more amino acid substitutions (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9. 10, 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-25, 25-30, 30-50, 50-100, or more residues), additions and insertions (eg., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-25, 25-30, 30-50, 50-100, or more residues) and deletions (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9. 10, 1, 12, 13, 14, 15, 16, 17. 18, 19, 20, 20-25, 25-30.30-50, 50-100) ofa reference antigen.
- amino acid substitutions e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9. 10, 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-25, 25-30, 30-50, 50-100, or more residues
- additions and insertions eg., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-25, 25-30.30-50,
- antigens and peptides contemplated herein include but are not limited to acetylation, amidalion, azido group conjugated to the primary epsilon amino group on an inserted lysine or as 5-azidopentanoic acid on the N-terminus, biotinylation.
- carrier proteins and MAP peptides e.g.
- KLII or BSA conjugated peptides KLII or BSA conjugated peptides
- MAP peptides modifications to increase cell penetration
- conjugation to 5-azidopentanoic acid azidogroup conjugated to lysine or propargylglycine
- F1TC 5,6 FAM, Rhodamine B
- fluorescence/quencher pairs for FRET analysis e.g. Abz/Unp and EDANS/Uabcyl
- formylation methylation.
- phosphorylation of tyrosine, serine or threonine, conjugated to resin, DTT can be added if peptides contain several cysteines or other amino acids that are easily oxidized, sulfation of tyrosine, Tyr(S03H2), and unnatural amino acids: D-amino acids, Aib, Abu, Ahx, Om, pGlu, Nle, DAB, Cit, Hyp, Tyr(3- N02), or Met sulfoxide or sulfone.
- antigens or equivalents thereof may further comprise independently at least 2, or alternatively at least 3, or alternatively at least 4, or alternatively at least 5. or at least 6, or alternatively at least 7. or alternatively at least 8. or alternatively at least 9 or alternatively at least 10 amino acids at the amino and/or carboxyl terminus of the polypeptide.
- the antigens listed in Table I or equivalents thereof further comprise independently at least 2, or alternatively at least 3, or alternatively at least 4, or alternatively at least 5, or at least 6, or alternatively at least 7, or alternatively at least 8, or alternatively at least 9 or alternatively at least 10 amino acids at the amino and/or carboxyl terminus of the polypeptide.
- antigens or equivalents thereof can be a part of or contained within a larger molecule, such as another peptide sequence, such as a fusion, heterologous domain, or chimera.
- an addition is a chimeric fusion sequence or heterologous domain (i.e. an amino acid sequence having one or more molecules not normally present in a reference endogenous sequence covalently attached to the sequence).
- the antigen is an Ml IC-restricted antigen.
- the antigen binding domain specifically binds to both the antigen and the MHC molecule.
- the antigen binding domain specifically binds a region spanning the antigen and MIIC bound to the antigen (i.e. the antigen-MI IC complex).
- the M1IC molecule comprises, consists, or alternatively consists essentially of all or part of an MHC class I molecule (e.g. 1ILA-A, IILA-B, IILA-C, I1LA-E, I1LA-F, IILA-G, or CDI molecule).
- the MHC molecule comprises, consists of, or alternatively consists essentially of an MIIC class II molecule (e.g. IILA-DM, IILA-DO, IILA-DP, IILA-DQ, and IILA-DR).
- MIIC class II molecule e.g. IILA-DM, IILA-DO, IILA-DP, IILA-DQ, and IILA-DR.
- the MHC molecule is a classical MHC molecule.
- the MHC molecule is a non-classical MIIC molecule.
- the extracellular antigen binding domain specifically binds and recognizes an antigen bound to a specific MHC allele or mutation. Additional information regarding HI .A alleles and their association with Parkinson's disease is available in Wissemann et al. (2013) Am J Hum Genet.93:984-993. PMC38241 16.
- the antigen is bound to an MHC molecule comprising, consisting, or consisting essentially of all or part ⁇ HLA-A*I 1 :01, HLA-DRB5*01 :01, HLA- DRBI* I5:0I . HLA-DQB 1*03:04. HLA-DRB 1 *07:01. HI. A-DRB 1*09:01, or HI.A- DQB 1*03:01.
- a nonlimiting exemplary amino acid sequence of HLA-A*1 1 :01 is provided herein as SEQ ID NO: 206:
- a nonlimiting exemplary amino acid sequence of HI .A-DRB5*01 :01 is provided herein as SEQ ID NO: 207:
- HLA-DQB 1*03:04 A nonlimiting exemplary sequence of HLA-DQB 1*03:04 is provided herein as SEQ ID NO: 209:
- a nonlimiting exemplary sequence of II LA- DRD 1*09:01 is provided herein as SEQ ID NO: 21 1 :
- the antigen bound to an MHC comprises, consists, or consists essentially of a peptide comprising the sequence KTKEGVLYVGSKTKE (SEQ ID NO: 55) or an equivalent thereof bound to DRB1* 15:01 or DRB5*01 :01.
- a peptide comprising the sequence MPVDPDNEAYEMPSE (SEQ ID NO: 56) or an equivalent thereof " bound to an MHC molecule
- a peptide comprising the sequence DNEAYEMPSEEGYQD (SEQ ID NO: 57) or an equivalent thereof bound to DRB5*01 :01
- a peptide comprising the sequence EMPSEEGYQDYEPEA (SEQ ID NO: 58) or an equivalent thereof bound to an MHC molecule
- a peptide comprising the sequence VLYVGSKTK (SEQ ID NO: 59) or an equivalent thereofbound to A*l 1 :01.
- the antigen binding domain comprises, consists, or consists essentially of Fab, variable regions of a TCR, BCR, or Ig, or a fragment of an scFv (e.g. a VH or VL chain).
- An scFv region can comprise the variable regions of the heavy (Vn) and light chains (VL) of immunoglobulins, connected with a short linker peptide.
- the linker peptide may be from 1 to 50 amino acids, for instance. 1.2, 3, 4, 5. 6. 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17. 18, 19, 20, 21, 22, 23. 24, 25, 26. 27, 28. 29, 30, 31. 32.
- the linker is glycine rich, although it may also contain serine or threonine.
- the heavy chain variable region of the Ig comprises, or consists essentially thereof, or consists of those disclosed herein or an equivalent of each thereof and/or comprises one or more CDR regions comprising those disclosed herein or an equivalent of each thereof.
- the light chain variable region of the Ig comprises, or consists essentially thereof, or consists of those disclosed herein or an equivalent of each thereof and/or comprises one or more CDR regions comprising those disclosed herein or an equivalent of each thereof.
- Transmembrane Domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Transmembrane regions of particular use in this disclosure may be derived from the following:
- the transmembrane domain is a CD3. CD8, or a CD28 transmembrane domain.
- the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
- a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
- a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the engineered t-cell receptor.
- a glycine-serine doublet provides a particularly suitable linker.
- intracellular signaling domain (or cytoplasmic domain) of the engineered T-cell receptor is responsible for activation of at least one of the traditional cITcctor functions of an immune cell in which an engineered T-ccII receptor has been introduced.
- the intracellular signaling domain comprises, consists, or consists essentially of the intracellular signaling domain of a co-stimulatory molecule.
- the intracellular signaling domain refers to a portion of a protein which transmits the effector function signal and directs the immune cell to perform its specific function. An entire signaling domain or a portion thereof may be used so long as the portion is sufficient to transmit the effector function signal.
- Cytoplasmic sequences of the T-cell receptor (TCR) and co-rcccptors, as well as derivatives or variants thereof, can function as intracellular signaling domains for use in a CAR or modified TCR.
- Intracellular signaling domains of particular use in this disclosure may be derived from FcR (e.g. NM_000566 (SEQ ID NO: 242)).
- CD3 (NM_000732 (SEQ ID NO: 218), NM_000733 (SF.Q ID NO: 219), NM_000073 (SEQ ID NO: 220)), phosphatide cylidylyltransfcrasc 1 (CDS, NM_001263 (SEQ ID NO: 232)), CD22 (NM_024916 (SF.Q ID NO: 236)), CD79a (NM_021601 , (SEQ ID NO: 252). NM_00I783 (SEQ ID NO: 253)), CD79B (NM_000626 (SEQ ID NO: 254)).
- CD66d (NM_001277163 (SF.Q ID NO: 255).
- the intracellular signaling domain of the engineered l-ccll receptor can comprise the signaling domain of CD28, 4- IBB, CD3 zeta, CD27 (NM_001242 (SEQ ID NO: 263)). ICOS. or OX40.
- the intracellular signaling domain is derived from a protein of the same species as the subject In other embodiments, the intracellular signaling domain is derived from a protein of a different cell (e.g. macrophage, B cell) or a different species than the subject.
- a second co-stimulatory signal may also be required.
- the intracellular region of at least one co-stimulatory signaling molecule including but not limited to CD27 (NM 001242 (SEQ ID NO: 263)), CD28, 4- IBB, OX40, CD30 (NM_00I243 (SEQ ID NO: 257)), CD40 (NM_001250 (SEQ ID NO: 258)). programmed cell death protein 1 (PD- 1. NM_005018 (SEQ ID NO: 259)), ICOS.
- lymphocyte function-associated antigen- 1 (LFA-l, NM_001 1 14380 (SEQ ID NO: 260)), CD2 (NM_001767 (SEQ ID NO: 261)), CD7 (NM_006137 (SEQ ID NO: 262)), CD27 (NM_001242 (SEQ ID NO: 263)), CD276 (NM_001024736 (SEQ ID NO: 264)), or a ligand that specifically binds with CD83, may also be included in the cytoplasmic domain of the engineered T-cell receptor.
- the engineered T-cell receptor of the present disclosure can comprise one or more co- stimulatory domain.
- a CAR may comprise one. two, or more co-stimulatory domains.
- the costimulatory domain can be derived from the costimulatory domain of CD28, 4-1 BB, CD3 zeta, CD27, ICOS, or OX40. In some embodiments, the costimulatory domain is derived from a protein of the same species as the subject. In other embodiments, the costimulatory domain is derived from a protein of a different species than the subject.
- the polynucleotide can further comprise a detectable marker or purification marker and/or a polynucleotide encoding a detectable marker or a purification marker, each conjugated to the polynucleotide.
- the engineered T-cell receptor may optionally further comprise a spacer domain of up to 300 amino acids, preferably 5 to 100 amino acids, more preferably 25 to 50 amino acids.
- the spacer may be 1. 2. 3. 4. 5. 6. 7, 8. 9. 10. 1 1. 12. 13. 14. 15. 16, 17. 18. 19, 20, 21, 22. 23, 24, 25. 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41.42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids.
- a spacer domain may comprise, for example, a portion of a human Fc domain, a CI 13 domain, or the hinge region of any immunoglobulin, such as IgA. IgD. IgE, IgG, or IgM, or variants thereof. Additional spacers include, but are not limited to, CD4, CD8, and CD28 hinge regions.
- present disclosure provides vectors comprising, consisting, or alternatively consisting essential of a polynucleotide according to any of the embodiments described herein.
- the polynucleotide is operatively linked to a promoter.
- the vector is from the group of: a plasmid, a retroviral vector, a lentiviral vector. an adenoviral vector, or an adeno-associated viral vector.
- the vector is an expression vector.
- the vector is useful for integration in genomic DNA, replication, viral particle production, and/or infection or transduction with high efficiency.
- the disclosed vectors comprise an element that enhances or induces a regulatory T-cell or a memory regulatory T-cell phenotype. In other embodiments, the disclosed vectors comprise an element that reduces or inhibit effector T-cell phenotype.
- the isolated nucleic acid sequence is comprised in a vector.
- the vector is a plasmid.
- the vector is a viral vector.
- the vector is a lcnliviral vector.
- the term "vector” intends a recombinant vector that retains the ability to infect and transduce non-dividing and/or slowly-dividing cells and integrate into the target cell's genome.
- the vector is derived from or based on a wild-type virus.
- the vector is derived from or based on a wild-type lcnlivirus. Examples of such, include without limitation, human immunodeficiency virus (HIV), equine infectious anemia virus (EIAV). simian immunodeficiency virus (SIV) and feline immunodeficiency virus (FIV).
- retrovirus can be used as a basis for a vector backbone such murine leukemia virus (MLV).
- MLV murine leukemia virus
- a viral vector according to the disclosure need not be confined to the components of a particular virus.
- the viral vector may comprise components derived from two or more different viruses, and may also comprise synthetic components. Vector components can be manipulated to obtain desired characteristics, such as target cell specificity.
- the recombinant vectors of this disclosure may be derived from primates and non- primates.
- primate Icntiviruscs include the human immunodeficiency virus (HIV), the causative agent of human acquired immunodeficiency syndrome (AIDS), and the simian immunodeficiency virus (SIV).
- the non-primate lcnliviral group includes the prototype "slow vims" visna/maedi virus (VMV), as well as the related caprine arthritis-encephalitis virus (CAEV), equine infectious anemia virus (EIAV) and the more recently described feline immunodeficiency virus (FIV) and bovine immunodeficiency virus (BIV).
- Recombinant lentiviral vectors are known in the art, c.g.. sec US Patent Nos. 6.924,123; 7,056.699; 7,07,993; 7,419,829 and 7,442,551.
- Retroviral vectors for use in this disclosure include, hut are not limited to pl.enti series versions 4, 6, and 6.2 (Invilrogen); "ViraPower” system (Lenligen Corp.), plIIV-7-GFP, "Lenli- X”. pLVX, (Clontcch). pLKO.l-puro (Sigma-Aldrich), pLemiR (Open Biosystems), and pLV (Charitt. Medical School, Institute of Virology (CBF), Berlin, Germany).
- assays include, for example, Southern and Northern blotting. RT-PCR and PCR; biochemical assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (F.I.ISAs and Western blots) or by assays described herein to identify agents falling within the scope of the disclosure.
- assays include, for example, Southern and Northern blotting. RT-PCR and PCR; biochemical assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (F.I.ISAs and Western blots) or by assays described herein to identify agents falling within the scope of the disclosure.
- the disclosed vectors can further comprise a regulatory element such as an enhancer element.
- enhancers include, for example, WPRE, the human cytomegalovirus (HCMV) immediate early (IB) enhancer, the enhancer of the Moloney Murine Sarcoma Virus (MMSV), the U3 region of Rous Sarcoma Virus (RSV), the U3 region of Spleen Focus Forming Virus (SFFV), and the HCMV IE enhancer.
- the disclosed vectors can further comprise a polynucleotide encoding all or part of forkhcad box P3 ("FoxP3," NM_001 1 14377. (SEQ ID NO: 265); and NM_014009. (SEQ ID NO: 266)) or an equivalent thereof.
- FoxP3 may he operatively linked to a regulatory control element such as a promoter or an internal ribosomc entry site (IRES).
- IRS internal ribosomc entry site
- FoxP3 is fused to a detectable marker such as GFP.
- the ubiquitin binding sites in FoxP3 arc mutated to reduce degradation and/or stabilize the protein.
- the STUBl gene (NM_005861, (SF.Q ID NO: 267); and NM_001293I97 (SF.Q ID NO: 268) or its equivalent) is included in the vector to reduce degradation and/or stabilize the protein.
- SF.Q ID NO: 269 A nonlimiting example of the nucleotide sequence of FoxP3 is included herein as SF.Q ID NO: 269:
- AGTCCACTTC ACCAAGCCTG CCCTTGGACA AGGACCCGAT GCCCAACCCC
- ATCCCAGTGC ACCCAGGAAG GACAGCACCC TTTCGGCTGT GCCCCAGAGC
- CAACATGGAC TACTTCAAGT TCCACAACAT GCGACCCCCT TTCACCTACG
- the disclosed vectors can further comprise a polynucleotide encoding all or part of II.- 10 (NM_000572 (SliQ ID NO: 270)) or an equivalent thereof.
- IL-10 may be operatively linked to a regulatory control element such as a promoter or an internal ribosome entry site (IRES).
- IL-10 is (used to a detectable marker such as GFP.
- the IL- 10 is activation inducible.
- expression of 11 -10 may be under the control of a promoter activated by an inflammatory response (e.g. mxl promoter activated by interferon).
- SEQ ID NO: 271 A nonlimiting example of the nucleotide sequence of IL-10 is included herein as SEQ ID NO: 271:
- the disclosed vectors can further comprise a suicide gene to induce cell death in cells comprising and/or expressing the vector.
- the suicide gene is operatively linked to a promoter.
- the promoter is inducible (e.g. tetracycline-inducible).
- the suicide gene is triggered following adoptive cell treatment (Buddee et al., Pl.oS One, (2013)).
- the suicide gene may function to downrcgulatc expression of the engineered T-cell receptor following binding to the target antigen (WO 2016/01 1210).
- Non- limiting examples of suicide genes include caspasc-9 (NM_00I229, (SEQ ID NO: 272): NM_001278054 (SEQ ID NO: 273): or NM_032996 (SEQ ID NO: 274), or its equivalent) and thymidine kinase ⁇ NM_003258 (SEQ ID NO: 275) or its equivalent).
- Engineered T-cell receptors described herein may comprise, consist of, or alternatively consist essentially of: (a) an extracellular antigen binding domain, (b) a transmembrane domain, and (c) an intracellular signaling domain, wherein the extracellular antigen binding domain binds an antigen that binds an MIIC molecule, wherein the antigen binds to the MHC molecule with high affinity, and/or wherein the antigen induces a specific cytokine response, optionally an IL- 17, IFNy, and/or IL-5 response.
- the engineered T-cell receptor is a modified T-cell receptor. In other aspects, the engineered T-cell receptor is a chimeric antigen receptor (CAR). In certain aspects, the extracellular antigen binding domain binds both the antigen and the MHC molecule.
- the polynucleotide or vector encodes the engineered T cell receptor. In one aspect, the cells express the polynucleotide or vector according to any of the embodiments disclosed herein. In some aspects, the cells comprise two or more polynucleotides encoding distinct engineered T-cell receptors. In some aspects, the cells comprise two or more vectors encoding distinct engineered T-cell receptors.
- ITic cells comprising two or more vectors or polynucleotides may express engineered T-cell receptors that bind a plurality of antigens (e.g. the cells comprise a plurality of engineered T-cell receptors have distinct antigen specificities).
- the cell is an isolated cell.
- the cell is isolated or purified from a subject's peripheral blood mononuclear cells and in other aspects it is a cultured cell from a cell population that optionally is commercially available.
- the cell is of any appropriate species for the subject being treating, e.g., mammalian, canine, feline, murine or human.
- the cell is a leukocyte.
- the leukocyte may be murine, canine, feline, simian, or human.
- the cell is a T-cell.
- the T-cell may be a regulatory T-cell. regulatory memory T-cell, a central memory T-cell.
- the cell Is an NK cell that is isolated or a cultured cell from a cell population that optionally is commercially available.
- the cell is of any appropriate species for the subject being treating, e.g., mammalian, canine, feline, murine or human.
- the cell comprises and/or expresses an engineered T-cell receptor on the cell surface.
- Engineered T-cell receptors described herein may comprise, consist of. or alternatively consist essentially of: (a) an extracellular antigen binding domain, (b) a transmembrane domain, and (c) an intracellular signaling domain, wherein the extracellular antigen binding domain binds an antigen that binds an MHC molecule, wherein the antigen binds lo the MHC molecule with high affinity, and/or wherein the antigen induces a specific cytokine response, optionally an 1L-17. lFNy, and/or 1L-5 response.
- the engineered T-cell receptor is a modified T-cell receptor.
- the engineered T-cell receptor is a chimeric antigen receptor (CAR).
- the extracellular antigen binding domain binds both the antigen and the MHC molecule.
- the polynucleotide or vector encodes the engineered T cell receptor.
- the cell further comprises the antigen-MHC complex bound to the extracellular antigen binding domain.
- the population is substantially homogenous.
- substantially homogenous intends a plurality of cells of greater than 50%. 60%, 70%. 80%. or 95% purity or homogeneity.
- the population is a heterogenous mixture of two or more cells comprising and/or expressing distinct engineered T-cell receptors with distinct antigen specificities.
- non-human animal comprising, consisting, or alternatively consisting essentially of the polynucleotide or vector of any one of the embodiments described herein.
- compositions comprising, consisting of, or alternatively consisting essentially of a carrier and one or more of the products disclosed herein: a polynucleotide, vector, engineered T cell receptor, cell, modified cell, population comprising said cells or modified cells, or composition according to any of the embodiments described herein.
- Engineered T-cell receptors described herein may comprise, consist of, or alternatively consist essentially of: (a) an extracellular antigen binding domain, (b) a transmembrane domain, and (c) an intracellular signaling domain, wherein the extracellular antigen binding domain binds an antigen that binds an MHC molecule, wherein the antigen binds to the MHC molecule with high affinity, and/or wherein the antigen induces a specific cytokine response, optionally an IL-17, ⁇ , and/or IL-S response.
- the engineered T-cell receptor is a modified T-cell receptor.
- the engineered T-cell receptor is a chimeric antigen receptor (CAR).
- the extracellular antigen binding domain binds both the antigen and the MHC molecule.
- the polynucleotide or vector encodes the engineered T cell receptor.
- the cell or modified cell expresses the polynucleotide or vector and/or comprises an engineered T cell receptor on a surface of the cell or modified cell.
- the composition comprises one or more of the polynucleotide, vector, engineered T cell receptor, cell, modified cell, population comprising said cells or modified cells and, optionally, a carrier, such as but not limited to a pharmaceutically acceptable carrier
- the composition comprises a pharmaceutically or physiologically acceptable carrier, diluent, or cxcipiunl.
- Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like: carbohydrates such as glucose, mannose. sucrose or dcxtrans, mannitol; proteins: polypeptides or amino acids such as glycine: antioxidants: chelating agents such as F.DTA or glutathione: adjuvants (e.g.. aluminum hydroxide): and preservatives.
- compositions of the present disclosure may be formulated for oral, intravenous, intranasal, intramuscular, intrathecal, topical, enteral, and/or parenteral administration.
- the compositions of the present disclosure arc formulated for intravenous administration.
- the compositions are administered systemically.
- the addition of one or more antimicrobial agents such as chlorobulanol, ascorbic acid, parabens. thermerosal. or the like can be used to prevent the growth of microorganisms. It may also be preferable to include agents that alter the tonicity such as sugars or salts.
- compositions comprising cells or modified cells
- solutions can be prepared in suitable diluents such as saline, phosphate-buffered saline, hydrogcl, nutrient carrier, albumin, recombinant albumin, Dulhecco's Modified Ragle Medium, glucose, water, ethanol, glycerol, liquid polyethylene glycol(s), various oils, and/or mixtures thereof, and others known to those skilled in the art.
- suitable diluents such as saline, phosphate-buffered saline, hydrogcl, nutrient carrier, albumin, recombinant albumin, Dulhecco's Modified Ragle Medium, glucose, water, ethanol, glycerol, liquid polyethylene glycol(s), various oils, and/or mixtures thereof, and others known to those skilled in the art.
- Administration of the cells or compositions can be effected in one dose, continuously or intermittently throughout the course of treatment. Methods of determining the most effective means and dosage of administration are known to those of skill in the art and will vary with the composition used for therapy, the purpose of the therapy and the subject being treated. In some aspects, a matrix and or catheter may be used. Preferably, the administration is in such an amount as will be therapeutically effective and immune modifying. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician. Suitable dosage formulations and methods of administering the agents are known in the art.
- administrations of a composition about, at least about, or at most about 3, 4, 5, 6, 7. 8, 9, 10 or more administrations.
- the administrations will normally range from 1, 2, 3, 4, 5, 6, or 7 days to annual intervals, more usually from one to two week intervals.
- Periodic boosters at intervals of every other day, twice a week, weekly, biweekly, monthly, or 0.1, 0.2, 0.3, 0.4, 0.5, 1, 2, 3,4 or 5 years, usually two years, will be desirable to maintain the condition of the immune system.
- the administration(s) may be followed by assays for autoreactive immune responses, inflammatory cytokine production, cytotoxic cells, and T cell activity.
- the carrier may be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol), and the like), suitable mixtures thereof, and vegetable oils.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion, and by the use of surfactants.
- the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobulanol, phenol, sorbic acid, Ihimcrosal, and the like.
- isotonic agents for example, sugars or sodium chloride.
- Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
- the cells, populations, vectors, and polynucleotides of the disclosure can be administered in combination with other traditional therapies, These include, but arc not limited to, the administration of immunosuppressive or modulating therapies or treatments and therapies to ameliorate the symptoms of and/or treat neurodegenerative disorders such as Parkinson's disease.
- immunosuppressive agents or therapies include anti-inflammatory drugs such as sulfasalazine, corticosteroids such as prednisone, and immune system suppressors such as azathioprine and mercaptopurine.
- Additional classes of immune modulating therapies or treatments include but arc not limited to a calcincurin inhibitor, a chemokine receptor inhibitor, a glucocorticoid, an mTOR inhibitor, an anti-metabolic compound, a phosphodicstcrasc-3 inhibitor, an antibody, or a leukocyte function antigcn-3/Fc fusion protein.
- The cells and populations of cell are administered to the host using methods known in the art and described, for example, in PC17US2011/064191. This administration of the cells or compositions of the invention can be performed to generate an animal model of the relevant disease, disorder, or condition for experimental assays and screens.
- kits comprising, consisting of, or alternatively consisting essentially of a composition as described herein and instructions for use. Additional reagents and/or instructions can further be provided as necessary.
- a method of producing a modified cell comprising, consisting, or alternatively consisting essentially of: (i) introducing a polynucleotide or vector according to any of the embodiments described herein into a cell or a population of cells, and optionally culturing the cell or population of cells under conditions that favor expression of the polynucleotide or the vector; (ii) and further optionally selecting a cell or enriching a cell or a subpopulaiion of cells that have been successfully modified with the polynucleotide or vector of step (i).
- the cells are selected from or isolated from a group consisting of leukocytes.
- the T-cclls arc regulatory T-cclls, regulatory memory T-cells, naTve T-cells, central memory T-cells. effector memory T-cells, CD4+ T-cclls. or a CD8+ T-cclls.
- the cell is isolated from a subject.
- the subject may he a murine, canine, feline, simian, or a human.
- step (i) comprises CRISPR mediated gene editing to introduce the polynucleotide into the genome of the target cell.
- Methods of using CRISPR to perform gene editing are known in the art.
- the polynucleotide or vector is introduced to the target cell via a viral particle comprising, consisting of, or alternatively consisting essentially of a polynucleotide or vector according to the embodiments described herein.
- cells expressing the disclosed engineered T-cell receptors may be further modified to express one or more of: FoxP3, II.- 10, a detectable or selectable marker, a suicide gene, and/or an equivalent of each thereof as described herein,.
- one or more of FoxP3, IL- 10, the detectable or selectable marker, and/or a suicide gene may be encoded on one or more vectors introduced to the cell or subpopulation of modified cells.
- each gene may be operatively linked to an expression control element such as a promoter.
- one or more of FoxP3, lL-10. the detectable or selectable marker, and/or a suicide gene are encoded on the same vector.
- one or one or more of FoxP3, IL- 10, the detectable or selectable marker, and/or a suicide gene are encoded on separate vectors.
- one or more of FoxP3, 1 L- 10, the delectable or selectable marker, and/or a suicide gene is encoded on the same vector that encodes an engineered T-cell receptor according to any of the embodiments described herein.
- l ; oxP3 expression is induced by contacting the cell or subpopulation of modified cells with an effective amount of transforming growth factor beta 1-4 ("TUFB," eg. ⁇ ' ⁇ : N1MXW651; available from Pcprolcch rhlGl ⁇ cat# 100-21. I00-21C) and/or II .-10 (available from Peprotech rhll.-IO cat# 200-10), thereby inducing FoxP3 expression in the cell or subpopulation of modi I ted cells.
- the culture conditions comprise about I to about 10 ng/ml.. or alternatively about 5 to about 20 ng/ml..
- the culture conditions comprise about 10 ng/mL, or alternatively about 15 ng/mL, or alternatively about 20 ng/ml ., or alternatively about 25 ng/ml ., or alternatively about 30 ng/mL. or alternatively about 40 ng/mL. or alternatively about 50 ng/ml.
- TGFp * and/or IL-10 is about 5 to about 100 ng/mL.
- the cell or subpopulation of modified cells is contacted with an effective amount of anti-interferon ⁇ antibody (e.g. ThermoFisher cat# 16-731 l-8IXSkurkovich, S. et al. J. of Immune Based Therapies, Vaccines, and Antimicrobials, 4:1-8 (2015)) anti IL-5 antibody (e.g. mepolizumab (GlaxoSmithKline)) (Mukhergee, M. et al. World Allergy Organ J. 7( 1 ): 32 (2014)), anti-TNF antibody or inhibitor (e.g.
- anti-interferon ⁇ antibody e.g. ThermoFisher cat# 16-731 l-8IXSkurkovich, S. et al. J. of Immune Based Therapies, Vaccines, and Antimicrobials, 4:1-8 (2015)
- anti IL-5 antibody e.g. mepolizumab (GlaxoSmithKline)
- anti-TNF antibody or inhibitor
- the antibodies are activation-induced.
- cells Prior to expansion and genetic modification of the cells disclosed herein, cells may be obtained From a subject - for instance, in embodiments involving autologous therapy - or a commercially available culture, that are available from the American Type Culture Collection (ATCC), for example.
- ATCC American Type Culture Collection
- Cells can be obtained from a number of sources in a subject, including peripheral blood mononuclear cells (PRMC), bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
- PRMC peripheral blood mononuclear cells
- bone marrow lymph node tissue
- cord blood thymus tissue
- tissue from a site of infection ascites, pleural effusion, spleen tissue, and tumors.
- Isolation methods for use in relation to this disclosure include, but arc not limited to Life Technologies Dynabeads® system; STEMcell ' Technologies EasySepTM, RoboScpTM, RosetleSepTM, ScpMaleTM: Millenyi Biotec MACSTM cell separation kits, fluorescence activated cell sorting (FACS), and other commercially available cell separation and isolation kits.
- Particular subpopulations of immune cells may be isolated through the use of beads or other binding agents available in such kits specific to unique cell surface markers. For example, MACSTM CD4+ and CD8-* MicroBcads or complement depletion may be used to isolate CD4» and CD8+ T-cells.
- cells may be obtained through commercially available cell lines, including but not limited to BCL2 (AAA) Jurkat (ATCC® CRL-2902TM).
- appropriate cells may be derived from stem cells or lymphoid progenitors including iPS cells, F.S cells, hematopoietic stem cells, common lymphoid progenitors (CI.Ps), DN1, DN2. DN3, DN4, or DP cells.
- iPS cells including iPS cells, F.S cells, hematopoietic stem cells, common lymphoid progenitors (CI.Ps), DN1, DN2. DN3, DN4, or DP cells.
- the cells are autologous to the subject being treated. In another aspect, the cells are allogeneic to the subject being treated. Packaging vector and cell tines
- Polypeptides encoding engineered T-cell receptors can be packaged into a ientiviral or retroviral packaging system by using a packaging vector and cell lines.
- the packaging plasmid includes, but is not limited to retroviral vector, Ientiviral vector, adenoviral vector, and adeno- assoeiated viral vector.
- the packaging vector contains elements and sequences that facilitate the delivery of genetic materials into cells.
- the retroviral constructs are packaging plasmids comprising at least one retroviral helper UNA sequence derived from a replication-incompetent retroviral genome encoding in trans all virion proteins required to package a replication incompetent retroviral vector, and for producing virion proteins capable of packaging the replication-incompetent retroviral vector at high titer, without the production of replication-competent helper virus.
- the retroviral UNA sequence lacks the region encoding the native enhancer and/or promoter of the viral 5' I.TR of the virus, and lacks both the psi function sequence responsible for packaging helper genome and the 3' LTR, but encodes a foreign polyadenylation site, for example the SV40 polyadenylation site, and a foreign enhancer and/or promoter which directs efficient transcription in a cell type where virus production is desired.
- the retrovirus is a leukemia vims such as a Moloney Murine Leukemia Virus (MMLV), the Human Immunodeficiency Virus (HIV), or the Gibbon Ape Leukemia virus (GALV).
- the foreign enhancer and promoter may be the human cytomegalovirus (HCMV) immediate early (IF.) enhancer and promoter, the enhancer and promoter (U3 region) of the Moloney Murine Sarcoma Virus (MMSV), the 1)3 region of Rous Sarcoma Virus (RSV), the U3 region of Spleen Focus Forming Virus (SFFV), or the HCMV IE enhancer joined to the native Moloney Murine Leukemia Virus (MMI.V) promoter.
- HCMV human cytomegalovirus
- IF. Enhancer and promoter
- U3 region of the Moloney Murine Sarcoma Virus
- RSV Rous Sarcoma Virus
- SFFV Rous Sarcoma Virus
- SFFV Spleen Focus Forming Virus
- HCMV IE enhancer joined to the native Moloney Murine Leukemia Virus
- the retroviral packaging plasmid may consist of two retroviral helper UNA sequences encoded by plasmid based expression vectors, for example where a first helper sequence contains a cDNA encoding the gag and pol proteins of ecotropic MMLV or GALV and a second helper sequence contains a cUNA encoding the env protein.
- the Env gene which determines the host range, may be derived from the genes encoding xenotropic, amphotropic, ecotropic.
- polytropic polytropic (mink focus forming) or 10A1 murine leukemia virus env proteins, or the Gibbon Ape Leukemia Virus (GALV env protein, the Human Immunodeficiency Virus env (gpl60) protein, the Vesicular Stomatitus Virus (VSV) G protein, the Human T cell leukemia (IITLV) type I and II env gene products, chimeric envelope gene derived from combinations of one or more of the aforementioned env genes or chimeric envelope genes encoding the cytoplasmic and transmembrane of the aforementioned env gene products and a monoclonal antibody directed against a specific surface molecule on a desired target cell.
- GLV env protein Gibbon Ape Leukemia Virus
- gpl60 Human Immunodeficiency Virus env
- VSV Vesicular Stomatitus Virus
- IITLV Human T cell leukemia
- the cells can be activated and expanded using generally known methods such as those described in U.S. Patent Nos. 6,352,694: 6,534.055; 6.905.680: 6.692,964: 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7, 175,843; 5.883.223: 6.905,874: 6.797.514; 6,867.041.
- Stimulation with the antigen and/or MHC ex vivo can activate and expand the selected engineered T-cell receptor expressing cell subpopulalion.
- Isolation methods for use in relation to this disclosure include, but are not limited to Lite Technologies Dynabeads® system activation and expansion kits; RD Biosciences PhosflowTM activation kits, Miltcnyi Biotcc MACS 1 * 1 activation/expansion kits, and other commercially available cell kits specific to activation moieties of the relevant cell.
- Particular subpopulations of immune cells may be activated or expanded through the use of beads or other agents available in such kits. For example, u-CD3/a-CD28 Dynaheadsffi) may be used to activate and expand a population of isolated T-cclls.
- the polynucleotides, cells, vectors, populations, and modified cells of the present disclosure may be used to induce an anti-inflammatory response in a cell, tissue, or subject, mediate an immune response in a cell, tissue, or subject or mediate an inflammatory response in a cell tissue, or subject in vitro, ex vivo, or in vivo.
- the polynucleotides, cells, vectors, populations, and modified cells of the present invention may be administered either alone or in combination with diluents, known anti-cancer therapeutics, and/or with other components such as cytokines or other cell populations that are immunostimulatory to a subject in need thereof.
- the cell, tissue, or subject may be canine, equine, murine, rat, simian, feline, or human.
- Method aspects of the present disclosure relate to methods for inducing an antiinflammatory response, mediating an immune response, or mediating an inflammatory response in a subject in need thereof, the method comprising, consisting of, or alternatively consisting essentially of administering to a subject in need thereof an effective amount of the polynucleotides, vectors, cells, modified cells, compositions, or populations disclosed herein.
- the response is characterized by suppression of pathogenic T-cells.
- the response is characterized by increased or decreased expression of one or more pro-inflammatory cytokines in the cell, tissue, or subject, and optionally wherein the one or more pro-inflammatory cytokines comprise IL-lp, TNF-a, IFN- ⁇ , 1L-8.
- the response is characterized by increased or decreased expression of one or more anti-inflammatory cytokines in the cell, tissue, or subject, and optionally wherein the one or more anti-inflammatory cytokines comprise TGF- ⁇ , IL-lRa, IL-4. IL-6, lL-IO. IL-I I. IL-13, 1L-3S, and/or INF-a.
- the cell, modified cell, or population is autologous to the subject. The subject may he canine, equine, murine, rat, simian, feline, or human.
- Additional method aspects of the present disclosure relate to methods for enhancing the activity of a regulatory T-ccll or a regulatory memory T-ccll, the methods comprising, consisting of. or alternatively consisting essentially of administering to a subject in need thereof, an effective amount of the polynucleotides, vectors, cells, modified cells, compositions, or populations disclosed herein.
- the enhanced activity of the regulatory T-cell is characterized by increased expression of IL-10.
- the subject may be canine, equine, murine, rat, simian, feline, or human.
- a method of treating a disease or condition involving an inflammatory response or related to inflammation in a subject in need thereof comprising, consisting of, or alternatively consisting essentially of administering to the subject an effective amount of the polynucleotides, vectors, cells, modified cells, compositions, or populations disclosed herein. Success of the treatment can be determined by detecting improvement or stabilization of one or more clinical endpoints.
- Exemplary clinical endpoints include but are not limited to reduction in expression of pro-inflammatory cytokines in the inflamed tissue (or systemically), increase in the expression of anti-inflammatory cytokines in the inflamed tissue (or systemically), reduction in infiltration of lymphocytes to the inflamed tissue, decreased numbers of circulating or localized pathogenic and/or cytotoxic cells, decreased numbers of auto-reactive pathogenic cells, expansion of regulatory cells, reduced pain, reduced swelling, reduced inflammation, reduced or stabilized neurological damage, and/or increased or stabilized function of the inflamed tissue.
- the subject may be canine, equine, murine, ral, simian, feline, or human.
- Also provided herein is a method of treating a neurodegenerative disease or disorder in a subject in need thereof, comprising, consisting of. or alternatively consisting essentially of administering to the subject an effective amount of the polynucleotides, vectors, cells, modified cells, compositions, or populations disclosed herein.
- Engineered T-cell receptors described herein may comprise, consist of, or alternatively consist essentially of: (a) an extracellular antigen binding domain, (b) a transmembrane domain, and (c) an intracellular signaling domain, wherein the extracellular antigen binding domain binds an antigen that binds an M11C molecule, wherein the antigen binds to the MHC molecule with high affinity, and/or wherein the antigen induces a specific cytokine response, optionally an IL-I7, lFNy, and/or IL-S response.
- the engineered T-cell receptor is a modified T-cell receptor.
- the engineered T-cell receptor is a chimeric antigen receptor (CAR).
- the extracellular antigen binding domain binds both the antigen and the MHC molecule.
- the polynucleotide or vector encodes the engineered T cell receptor.
- the cell or modified cell expresses the polynucleotide or vector and/or comprises an engineered T eel I receptor on a surface of the cell or modified cell.
- the composition comprises one or more of the polynucleotide, vector, engineered T cell receptor, cell, modified cell, population comprising said cells or modified cells and, optionally, a carrier, such as but not limited to a pharmaceutically acceptable carrier.
- the neurodegenerative disease or disorder is a- synuclcinopathy, Parkinson's disease, Lcwy Body dementia, or Alzheimer's disease.
- the cell, modified cell, or population is autologous to the subject being treated. Success of the treatment can be determined by detecting improvement or stabilization of one or more clinical endnoints. Fxemplary clinical endpoints include hut are not limited to reduction in expression of pro-inflammatory cytokines in the inflamed tissue (or systemically).
- the subject may be canine, equine, murine, rat, simian, feline, or human.
- the peptide-reactive. cytotoxic T-cells identified in the examples below may contribute to the pathogenesis of neurodegenerative disease by targeting neurons and killing them.
- the polynucleotides, vectors, cells, modified cells, compositions, or populations disclosed herein may function to treat neurodegenerative disease, halt progression of neurodegenerative disease, or prophy tactically prevent the onset of neurodegenerative disease by targeting these pathogencic T-cells and suppressive their inflammatory response.
- the methods described herein further comprise administration of an effective amount of one or more immunosuppressive therapeutic compounds to the subject in need thereof.
- the immunosuppressive therapeutic compounds include but are not limited to a calcineurin inhibitor, chemokine receptor inhibitor, a glucocorticoid, an m TOR inhibitor, an anti- metabolic compound, a phosphodicsterasc-5 inhibitor, an antibody, or a leukocyte function antigen-3/Fc fusion protein.
- the subject may be canine, equine, murine, rat. simian, feline, or human.
- the endogenous T-cclls and/or other lymphocytes of the patient are depicted prior to administration of an effective amount of the polynucleotides, vectors, cells, modified cells, compositions, or populations disclosed herein.
- compositions of the present invention may be administered in a manner appropriate to the disease to be treated or prevented.
- the quantity and frequency of administration will he determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
- the polynucleotides, vectors, engineered T-cell receptors, cells, modified cells, compositions, or populations disclosed herein may be delivered or administered intravenously, intrathecal ly, intraperitoneally, intranasally, by inhalation, intramuscularly, suhcutaneously, or by other suitable means of administration such as inhalation therapy or intranasally.
- CARs Chimeric antigen receptors
- modified 1 -cell receptors offer two distinct approaches to alter immune cell specificity. The primary structural difference between these two receptors is based on their origin. CARs arc typically derived from the small chain variable fragments (scFv) of antibody molecules. In contrast, modified TCRs are typically derived from sequenced, disease-relevant T cell receptors. Generally, CARs recognize surface bound antigens expressed by targeted cells without regard to MHC presentation, while modified TCRs recognize peptides presented by MIIC molecules, similar to endogenous TCRs that recognize cognate antigen-MHC complexes. Because modified TCRs bind to antigen-MHC complexes, they can be used to target both extracellular and intracellular proteins. Doth approaches to develop adoptive cell therapies are described in this example.
- T-cell epitopes appropriate for modulating the immune response with adoptive cell therapy and MHC haplotypes that can present the eplidopes are identified (e.g. through an epitope screen and next generation sequencing).
- One method e.g. an epitope screen
- samples comprising peripheral blood mononuclear cells (PBMCs) arc obtained from the venous blood of human subjects suffering from the disease or condition of interest (e.g. Parkinson's disease, autoimmune disorder, or inflammatory condition).
- the MHC haplotypes orihe samples are identified by next- generation sequencing.
- Peptides comprising epitopes derived from autoantigen targets or other disease-relevant antigen targets are synthesized.
- the peptides are predicted to bind specific subtypes and/or alleles of MHC molecules, e.g. those identified to be associated with disease.
- the PBMCs arc stimulated with the synthesized peptides in culture for about two weeks or an appropriate period to measure response.
- inflammatory cytokines e.g. IFNy or 1L-5 arc measured in the samples to delect a specific peplidc-MIIC immune response.
- Complexes of peptides with MHC molecules are chosen if the affinity of the binding of the peptide to the MHC is less than about 1000 nM or, in some embodiments, if the peptide elicits a cytokine response despite restriction to a particular MHC allele (e.g. binds promiscuously to a panel or several Ml IC alleles).
- TCR polypeptide e.g. uSyn CD4+ T-cclls, 1ILA-A*1 1:01 CD3+ T-cells
- T-cells that produce inflammatory cytokines upon stimulation with peptide and/or peptide-MHC complex are selected and sequenced to determine the amino acid sequence of the variable regions of their T-cell receptor (TCR).
- Peptide-MHC multimers e.g. tetramers, (kxtramers) may be developed to enable cell-tracking and purification.
- Exemplary uSyn peptides recognized by T-cells and the corresponding MHC allele are provided in Table 7 below:
- scFv single-chain variable fragments
- scFv is a fusion protein of the variable regions of immunoglobulin heavy and light chains, connected by linker peptide.
- scFv can be created from subcloned heavy and light chains derived from a monoclonal antibody or hybridoma, or by phage display.
- Peptide-MHC complexes identified in the epitope screen are selected for monoclonal antibody development or scFv development. For example, in Parkinson's disease, the following combinations are targeted for development:
- the selection criteria for optimal scFv or antibodies includes clones that produce soluble recombinant IgG 1 Tor in vitro blocking assays. If a suitable rodent model for a disease or condition exists, labeled recombinant IgG produced is tested to determine cellular localization and efficacy in high-multi-dose PoC experiments. For example, for Parkinson's disease such models include but are not limited to Park2. LRRK2, and Synuclcin mutant mouse strains (available from Jackson Laboratory). Tetramers are developed for cell selection and purification. Once suitable scFv is identified, the amino acid sequence is determined.
- the vector can further comprise a FoxP3 transcription factor to promote and maintain Trcg function.
- the FoxP3 can be mutated to deactivate S ' fUBI or ubiquitin binding domains. In some aspects, additional gain of function mutations can he included.
- the vector can further comprise UFP or another detectable marker.
- the FoxP3 can be fused to GFP or another delectable marker to allow screening for FoxP3 positive cells.
- the vector can further comprise a selection marker, killing marker, and/or a suicide gene (e.g. caspase 0) to attenuate the life of a cell transduced with the vector.
- a selection marker, killing marker, and/or a suicide gene e.g. caspase 0
- Such marker or gene can be inducible (e.g. rapamycin or doxycycline inducible).
- the vector can comprise activation-inducible II. -10.
- the vector is then introduced (e.g. via transduction, CRISPR, transfection) into enriched regulatory T-cells of a subject. Methods of enriching regulatory T-cdls are known in the art and described herein. Alternatively, the vector is introduced into regulatory memory T-cells, NK cells, CD4+ T-cells, CD8+ T-cells, central memory T-cells, naive T-cells. effector T-cells, or cytotoxic T-cells.
- mice model is used to determine whether cells comprising the engineered T-cell receptor can modulate the immune response in an appropriate disease model.
- Parkinson's disease such models may include Park2, LRRK2, and Synuclein mutant mouse strains (available from Jackson Laboratory). Additional models for Parkinson's use neurotoxins specific for DA SN neurons, including MPTP and 60HDA, to produce neuron loss.
- viral vectors that overexpress o-syn may be used to mimic a familial form of Parkinson's disease in humans caused by gene multiplication of u-syn (AAV2-SYN mouse model, Theodore el al., J. Neuropathol Kxp. Neurol. 67: 1 149-58 (2008)).
- the mice may be on a mixed C57/BL6 (!Ab) or C3II (lAk) background which may affect antigen presentation.
- the pcptidc-MHC affinity is measured for the model. If the affinity is within an acceptable range (e.g. up to 1,000 nM) or the peptide induces a robust T-cell cytokine response (e.g. ⁇ , IL-S, or IL-17 response), an engineered T-ccll receptor is developed as described above. The CD4+ T-cell responses are characterized and compared to those measured in the human subjects.
- mice comprising die engineered T-cell receptor are crossed to mice with MHC alleles of interest.
- uSyn transgenic mice are crossed to DRB5*01 :01 , DRR 1* 15:01. DQBI «03:04.
- the CD4+ T-cell responses are characterized and compared to those measured in the human cells.
- T-regulatory cells comprising the engineered T-cells are administered to the mice via any appropriate method.
- Treatment parameters are measured including decreased expression of proinflammatory cytokines, increased expression of anti-inflammatory cytokines, suppression of cytotoxic cells, expansion in vivo of regulatory T-cells, reduced inflammation in tissue, and/or amelioration of disease-specific symptoms.
- For example, in Parkinson's disease, a reduction in the amount of neurodegeneration can be determined by assaying for neuronal loss (e.g. by cell counting of brain tissue sections). Behavioral tests can be performed to determine whether neuronal function has improved, remained static, or decreased at a reduced rate relative to untreated or control treated mice. Such behavioral tests include beam traversal, the cylinder test, and the adhesive test to assess the motor abilities of the mice.
- Additional tests to measure treatment outcome include dopamine release and update assays (decreased dopamine release is associated with neurodegeneration). as well as assays for modulation of inflammatory cytokine expression in neuronal tissue, and assays to detect infiltration of B and T Lymphocytes.
- adoptive cell therapy is performed in humans or other mammals.
- the mode of administering the modified cells will vary by condition and target tissue. Administration may occur by any suitable method described herein.
- the success of the therapy is measured by a reduction in clinical symptoms of the disease or condition, decrease in inflammation, decrease in expression of pro-inflammatory cytokines, increased expression of anti-inflammatory cytokines, reduction or suppression of cytotoxic T-cells, expansion of regulatory T-cells, reduction in the infiltration of B and T-cells into the target tissue, or arresting or suppressing the development of clinical symptoms.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Cell Biology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Biophysics (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Psychiatry (AREA)
- Hospice & Palliative Care (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
L'invention concerne de nouveaux récepteurs de lymphocytes T modifiés comprenant des TCR et CAR modifiés ciblant les antigènes-MIIC pertinents pour une maladie. L'invention concerne également de nouvelles méthodes de traitement de maladies ou d'états associés à une inflammation et/ou à des troubles neurodégénératifs.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201762522641P | 2017-06-20 | 2017-06-20 | |
US62/522,641 | 2017-06-20 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2018236986A1 true WO2018236986A1 (fr) | 2018-12-27 |
Family
ID=64735798
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2018/038478 WO2018236986A1 (fr) | 2017-06-20 | 2018-06-20 | Récepteurs de lymphocytes t modifiés et méthodes d'utilisation correspondantes |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2018236986A1 (fr) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2020198299A1 (fr) * | 2019-03-26 | 2020-10-01 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions et procédés de caractérisation et de traitement de la maladie d'alzheimer |
US11142570B2 (en) | 2017-02-17 | 2021-10-12 | Bristol-Myers Squibb Company | Antibodies to alpha-synuclein and uses thereof |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2015157117A2 (fr) * | 2014-04-09 | 2015-10-15 | The Trustees Of Columbia University In The City Of New York | Utilisation de leucocytes et de nouveaux biomarqueurs dans le diagnostic, la confirmation et le traitement d'un trouble neurologique |
US20160175358A1 (en) * | 2014-11-17 | 2016-06-23 | Adicet Bio, Inc. | Engineered gamma delta t-cells |
-
2018
- 2018-06-20 WO PCT/US2018/038478 patent/WO2018236986A1/fr active Application Filing
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2015157117A2 (fr) * | 2014-04-09 | 2015-10-15 | The Trustees Of Columbia University In The City Of New York | Utilisation de leucocytes et de nouveaux biomarqueurs dans le diagnostic, la confirmation et le traitement d'un trouble neurologique |
US20160175358A1 (en) * | 2014-11-17 | 2016-06-23 | Adicet Bio, Inc. | Engineered gamma delta t-cells |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11142570B2 (en) | 2017-02-17 | 2021-10-12 | Bristol-Myers Squibb Company | Antibodies to alpha-synuclein and uses thereof |
US11827695B2 (en) | 2017-02-17 | 2023-11-28 | Bristol-Myers Squibb Company | Antibodies to alpha-synuclein and uses thereof |
WO2020198299A1 (fr) * | 2019-03-26 | 2020-10-01 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions et procédés de caractérisation et de traitement de la maladie d'alzheimer |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR102489954B1 (ko) | 인간 백혈구 항원 제한된 감마 델타 t 세포 수용체 및 이의 사용 방법 | |
US11242376B2 (en) | Compositions and methods for TCR reprogramming using fusion proteins | |
AU2022202021A1 (en) | Nanoparticle compositions for sustained therapy | |
US11884716B2 (en) | Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells | |
KR20200067845A (ko) | 항-hla-a2 항체 및 그 사용 방법 | |
JP2013503204A (ja) | B7−h4融合タンパク質およびその使用方法 | |
WO2014055771A1 (fr) | Récepteur d'antigène chimérique de récepteur alpha du folate humain | |
KR20140127816A (ko) | 암의 치료에 유용한 t 세포의 지속성 집단을 생성시키기 위한 조성물 및 방법 | |
CN106573987A (zh) | Pd‑l1融合蛋白及其用途 | |
US20240067732A1 (en) | Anti-hla-a2 antibodies and uses thereof | |
EP3714042A1 (fr) | Utilisation et production de cellules immunitaires modifiées | |
AU2020366434A1 (en) | CAL-T constructs and uses thereof | |
US20210322473A1 (en) | Modified t cells and methods of their use | |
US20240052006A1 (en) | Anti-inflammatory cytokines and methods of use | |
WO2018236986A1 (fr) | Récepteurs de lymphocytes t modifiés et méthodes d'utilisation correspondantes | |
AU3418893A (en) | Vaccination and methods against diseases resulting from pathogenic responses by specific t cell populations | |
WO2018236909A1 (fr) | Récepteurs de lymphocytes t modifiés et leurs procédés d'utilisation dans la modulation de réponses inflammatoires et le traitement de l'athérosclérose | |
WO2023086900A1 (fr) | Cellules microgliales de récepteur antigénique chimérique (car) génétiquement modifiées pour le traitement de troubles neurodégénératifs | |
EP3765054A2 (fr) | Compositions et méthodes de ciblage de lymphocytes t gamma delta au moyen de récepteurs antigéniques chimériques | |
RU2782276C2 (ru) | Анти-hla-a2 антитела и способы их применения | |
US12011480B2 (en) | Nanoparticle compositions for sustained therapy | |
WO2024064640A2 (fr) | Récepteurs antigéniques chimériques spécifiques d'un antigène citrulliné pour cibler des lymphocytes t régulateurs pour traiter l'hidradénite suppurée | |
WO2024036303A2 (fr) | Lymphocytes t universels et compositions et leurs méthodes d'utilisation |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18820986 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 18820986 Country of ref document: EP Kind code of ref document: A1 |