WO2018218166A1 - Using split deaminases to limit unwanted off-target base editor deamination - Google Patents

Using split deaminases to limit unwanted off-target base editor deamination Download PDF

Info

Publication number
WO2018218166A1
WO2018218166A1 PCT/US2018/034687 US2018034687W WO2018218166A1 WO 2018218166 A1 WO2018218166 A1 WO 2018218166A1 US 2018034687 W US2018034687 W US 2018034687W WO 2018218166 A1 WO2018218166 A1 WO 2018218166A1
Authority
WO
WIPO (PCT)
Prior art keywords
cell
split
deaminase
ncas9
fusion proteins
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/034687
Other languages
French (fr)
Inventor
J. Keith Joung
James ANGSTMAN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
General Hospital Corp
Original Assignee
General Hospital Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by General Hospital Corp filed Critical General Hospital Corp
Priority to CA3063449A priority Critical patent/CA3063449A1/en
Priority to EP18805050.4A priority patent/EP3630198A4/en
Priority to CN201880045766.8A priority patent/CN111093714A/en
Priority to AU2018273968A priority patent/AU2018273968A1/en
Priority to US16/615,538 priority patent/US20200172895A1/en
Priority to JP2019564864A priority patent/JP2020521451A/en
Publication of WO2018218166A1 publication Critical patent/WO2018218166A1/en
Anticipated expiration legal-status Critical
Priority to JP2023111873A priority patent/JP2023126956A/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/78Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/102Mutagenizing nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0647Haematopoietic stem cells; Uncommitted or multipotent progenitors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/80Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/80Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
    • C07K2319/81Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor containing a Zn-finger domain for DNA binding
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y305/00Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
    • C12Y305/04Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amidines (3.5.4)
    • C12Y305/04001Cytosine deaminase (3.5.4.1)

Definitions

  • BE Base editing technologies use an engineered DNA binding domain (such as RNA-guided, catalytically inactive Cas9 (dead Cas9 or dCas9), a nickase version of Cas9 (nCas9), or zinc finger (ZF) arrays) to recruit a cytosine deaminase domain to a specific genomic location to effect site-specific cytosine ⁇ thymine transition substitutions 1,2 .
  • BEs are a particularly attractive tool for treating genetic diseases that manifest in cellular contexts where making precise mutations by homology directed repair (HDR) would be therapeutically beneficial but are difficult to create with traditional nuclease-based genome editing technology.
  • HDR homology directed repair
  • HDR high-length indel mutations
  • BE technology has the potential to allow practitioners to make highly controllable, highly precise mutations without the need for cell-type- variable DNA repair mechanisms.
  • Base editor platforms possess the unique capability to generate precise, user-defined genome-editing events without the need for a donor DNA molecule.
  • Base Editors that include a single strand nicking CRISPR-Cas9 (nCas9) protein fused to cytosine deaminase domain and uracil glycosylase inhibitor (UGI) domains (e.g., BE3) efficiently induce cytosine-to-thymine (C-to-T) base transitions in a site- specific manner as determined by the CRISPR guide RNA (gRNA) spacer sequence 1 .
  • BEs that use split deaminases (sDA) that are functional when brought into close proximity to each other, one fused to a ZF and one to an nCas9-UGI protein comprising one or more UGIs, so as to limit the ability of the deaminase domain from deaminating at off-target ssDNA target sites independent of nCas9 R-loop formation.
  • sDA split deaminases
  • fusion proteins comprising: (i) a first portion of a split deaminase (“sDA1”) enzyme fused to a programmable DNA-binding domain, preferably selected from the group consisting of such as a ZF, TALE, Cas9, catalytically inactive Cas9 (dCas9) or Cas9 ortholog (i.e., a homologous protein from another species such as dCpf1), nicking Cas9 (nCas9) or nicking Cas9 ortholog, wherein the sDA1 is an N-terminal truncated, catalytically inactive or deficient derivative of a parental deaminase selected from the group consisting of hAID, rAPOBEC1, mAPOBEC3, hAPOBEC3A, hAPOBEC3B, hAPOBEC3C,
  • hAPOBEC3F hAPOBEC3F
  • hAPOBEC3G hAPOBEC3H
  • variants thereof e.g., variants that have altered substrate specificities or activities such as eA3A
  • sDA2 split deaminase
  • sDA1 portion e.g., dCpf1, TALE, ZF
  • the sDA2 is a C- terminal truncated, catalytically inactive or deficient derivative of a parental deaminase selected from the group consisting of hAID, rAPOBEC1*, mAPOBEC3, hAPOBEC3A, hAPOBEC3B, hAPOBEC3C, hAPOBEC3F, hAPOBEC3G, or hAPOBEC3H, and/or variants thereof, e.g., with altered substrate specificities or activities such as eA3A.
  • a parental deaminase selected from the group consisting of hAID, rAPOBEC1*, mAPOBEC3, hAPOBEC3A, hAPOBEC3B, hAPOBEC3C, hAPOBEC3F, hAPOBEC3G, or hAPOBEC3H, and/or variants thereof
  • the split deaminases are not full length proteins, but are fragments thereof, wherein the co-expression of a fusion protein of (i) with a fusion protein of (ii) comprising a sDA1 and sDA2 portion from the same parental deaminase in eukaryotic cells, and their subsequent co-localization at adjacent genomic target sites, provides a catalytically active base-editor.
  • sDA1 and“sDA2” are used herein to refer to the first and second split deaminases generally, and do not refer specifically to the exemplary split deaminases described herein.
  • nucleic acids encoding the fusion proteins described herein, and compositions comprising one or more of those nucleic acids, e.g., wherein the nucleic acids encode a pair of the fusion proteins, e.g., comprising a SDA1 and SDA2 portion from the same parental deaminase.
  • vectors comprising the nucleic acids, and isolated host cells comprising and optionally expressing the nucleic acids.
  • the host cell is a stem cell, e.g., a hematopoietic stem cell.
  • fusion proteins described herein comprising a SDA1 and SDA2 portion from the same parental deaminase, as well as one or more gRNAs that interact with Cas9 domains in the fusion proteins.
  • one of the fusion proteins comprises nCas9
  • the other fusion protein comprises ZF or TALE
  • the ZF or TALE is targeted to a sequence of 9-24bp adjacent to the target site of the gRNA for the nCas9, wherein the gRNA binds to the nucleic acid comprising the selected cytosine.
  • the nucleic acid is in a cell, e.g., a eukaryotic cell, and the method comprises contact the cell with the fusion proteins or expressing the fusion proteins in the cell.
  • one of the fusion proteins comprises nCas9
  • the other fusion protein comprises ZF or TALE
  • the ZF or TALE is targeted to a sequence of 9-24bp adjacent to the target site of the gRNA for the nCas9, wherein the gRNA binds to the nucleic acid comprising the selected cytosine.
  • the fusion protein is delivered as an RNP, mRNA, or plasmid.
  • compositions comprising a purified fusion protein or pair of fusion proteins described herein, preferably a pair of fusion proteins described herein comprising a sDA1 and sDA2 portion from the same parental deaminase, an optionally one or more gRNAs that interact with Cas9 domains in the fusion proteins.
  • the composition comprise one or more ribonucleoprotein (RNP) complexes.
  • RNP ribonucleoprotein
  • the fusion protein is delivered as an RNP, mRNA, or plasmid DNA.
  • Also provided herein are methods for deaminating a selected cytosine in a nucleic acid the method comprising contacting the nucleic acid with a fusion protein or base editing system described herein.
  • compositions comprising a purified a fusion protein or base editing system as described herein.
  • nucleic acids encoding a fusion protein or base editing system described herein, as well as vectors comprising the nucleic acids, and host cells comprising the nucleic acids, e.g., stem cells, e.g., hematopoietic stem cells.
  • FIGURE 1 Diagram of an exemplary typical high efficiency base editing setup.
  • a nicking Cas9 bearing a catalytically inactivating mutation at one of its two nuclease domains binds to the target site dictated by the variable spacer sequence of the gRNA.
  • the formation of a stable R-loop creates a ssDNA editing window on the non-deaminated strand.
  • the Cas9 creates a single strand break in the genomic DNA, prompting the host cell to repair the lesion using the deaminated strand as a template, thus biasing repair towards the cytosine ⁇ thymine transition substitution. See Komor et al., 2016.
  • FIGUREs 2A-2G Schematic representation of: 2A.) First-generation base editor targeting and deaminating at an on-target site, with a deaminase targeting an R- loop generated by an on-target nCas9.2B.) First-generation base-editor binding to and deaminating an off-target genomic R-loop independent of its nCas9 targeting capabilities.2C.) First-generation base-editor binding to and deaminating an off-target genomic transcription bubble independent of its nCas9 targeting capabilities.
  • FIGUREs 3A-3B hAPOBEC3G with representative candidate split sites. Multiple rotational views of the hAPOBEC3G structure are shown. Magenta colored loop regions are candidate split sites selected on the bases of their lack of secondary structures and their distance from the catalytic center. PDB: 3E1U.
  • FIGURE 4 C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.1- 3AC3L-ZF-C and N-sDA2.1-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • FIGURE 5 C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.1- 3AC3L-ZF-C and N-sDA2.2-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • FIGURE 6 C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.2- 3AC3L-ZF-C and N-sDA2.1-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • FIGURE 7 C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.2- 3AC3L-ZF-C and N-sDA2.2-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • FIG. 9 C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.3-3AC3L- ZF-C and N-sDA2.2-nCas9-UGI-C proteins in several indicated orientations.
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • FIG. 10 C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.2- 3AC3L-ZF-C and N-sDA2.3-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • FIG. 11 C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.3- 3AC3L-ZF-C and N-sDA2.4-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • FIG. 13 C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.4- 3AC3L-ZF-C and N-sDA2.4-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • FIG. 14 C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.5- 3AC3L-ZF-C and N-sDA2.4-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • FIG. 15 C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.5- 3AC3L-ZF-C and N-sDA2.6-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ⁇ C orientation).
  • FIG. 17 C-to-T conversion data with first-generation BE3 (described in reference 1) with both gRNAs used in this study. (Note that the coloration gradient of these samples is shaded lighter than graphs above and that direct comparison requires evaluation of relative numerical rates). Orientation information is depicted, with an arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM). EGFP target sequence,
  • Figure 20 Evidence of C-to-T conversion when using adjacently-targeting N- sDA1.X-NLS-ZF-C and N-sDA2.X-nCas9-UGI-C human APOBEC3a (hA3A) split Base Editors in the indicated orientation. Pointed boxes representing the nCas9 gRNA binding site (gRNA2) and ZF binding site (ZF1) are shown, with the pointed ends indicating the PAM-proximal end of the gRNA and indicating the N ⁇ C orientation of the ZF, respectively. Conversion rates at each position are indicated by shaded boxes.
  • Rates of deamination by split BE pairs are around 2.5% per cytosine using the sDA1.6 + sDA2.6 configuration and around 1.7% per cytosine for the sDA1.1 + sDA2.1 configuration, while a hAPOBEC3A-nCas9-UGI positive control possessed 3-4x the amount of on-target activity as active hA3A halfase pairs.
  • gRNA target region
  • Figures 21A-21D Summary of C-to-T conversion rate of all rAPO1 halfase combination base editors as compared to a benchmark BE3 base editor at an integrated EGFP locus. The sum of total C-to-T editing percentages among three cytosines within or near the target gRNA’s approximate editing window is shown, as averaged between two replicates.
  • 21A shows the ZF1+gRNA1 data
  • 21B shows the ZF1+gRNA2 data
  • 21C shows the ZF2+gRNA1 data
  • 21D shows the ZF2+gRNA2 data.
  • FIG. 22 Representation of a portion of the EGFP reporter gene and the target sites used for the rAPO1 halfase combination experiments.
  • EGFP target region GCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCG
  • a cytosine deaminase (DA) domain and uracil glycosylase inhibitor (UGI; a small bacteriophage protein that inhibits host cell uracil DNA glycosylase (UDG), the enzyme responsible for excising uracil from the genome 1, 4 ) are both fused to nCas9 (derived from either Streptococcus pyogenes Cas9 (SpCas9) or Staphylococcus aureus Cas9 (SaCas9).
  • the nCas9 forms an R-loop at a target site specified by its single guide RNA (gRNA) and recognition of an adjacent protospacer adjacent motif (PAM), leaving approximately 4-8 nucleotides of the non-target strand exposed as single stranded DNA (ssDNA) near the PAM-distal end of the R-loop ( Figure 1).
  • This region of the ssDNA is the template that is able to be deaminated by the ssDNA-specific DA domain to produce a guanosine:uracil (G:U) mismatch and defines the editing window.
  • the nCas9 nicks the non-deaminated strand of DNA, biasing conversion of the G:U mismatch to an adenine:thymine (A:T) base pair by directing the cell to repair the nick lesion using the deaminated strand as a template.
  • deaminase domains described in these fusion proteins have been rat APOBEC1 (rAPO1), an activation-induced cytosine deaminase (AID) derived from lamprey termed CDA (PmCDA), human AID (hAID), or a hyperactive form of hAID lacking a nuclear export signal, or an engineered variant of human APOBEC3A (hA3A) termed eA3A 1-2, 5-7, 16 . Any of these deaminase domains from these BEs can be used as parental deaminases in the present fusion proteins.
  • nSpCas9 nCas9 domain
  • any Cas9-like nickase could be used based on any ortholog of the Cpf1 protein (including the related Cpf1 enzyme class) to perform this function, unless specifically indicated.
  • a completely enzymatically dead dCas9 or Cas9-like enzyme can also be used as the targeting mechanism of a functional BE enzyme.
  • BE in therapeutic settings will be to assess its genome-wide capacity for off-target mutagenesis and to modify the technology to minimize or, ideally, to eliminate the risks of stimulating deleterious off-target mutations.
  • BEs we described technological improvements to BEs that can be used to reduce or eliminate potential unwanted BE mutagenesis. Using Split Deaminases to Limit Unwanted Off-target Base Editor Deamination
  • AID/APOBEC enzymes Because of AID/APOBEC enzymes’ natural ability to bind and deaminate cytosines in genomic DNA and cytosines in RNA, non-specific spurious deamination events are a possibly important source of off-target mutagenesis in the genome and transcriptome from CRISPR Base Editor technology. In theory, even if the BE’s nCas9 domain (and any potential dCas9, TALE, and/or ZF domains) are eminently specific, this might do nothing to prevent the natural RNA- and ssDNA-targeting ability of the APOBEC enzyme from non-specifically deaminating globally across the transcriptome or the whichever regions of the genome are exposed as ssDNA, such as actively transcribed regions or DNA undergoing replication.
  • sDA1 split deaminase
  • ZF any DNA targeting domain orthogonal to Cas9, such as Cpf1, TALE, ZF, or a dCas9 orthogonal to the nCas9 used to target sDA2, may be suitable
  • any DNA targeting domain orthogonal to Cas9 such as Cpf1, TALE, ZF, or a dCas9 orthogonal to the nCas9 used to target sDA2
  • a reciprocal or somewhat overlapping C-terminal truncation of a deaminase fused to an nCas9-UGI fusion protein such that the N-terminal truncation and the C-terminal truncation together form a functional enzyme.
  • the exemplary BEs were made in a similar orientation to the first- generation BE3 enzyme (sDA2-nCas9-UGI) targeting an adjacent sequence with a ⁇ 17-24bp target site 1 .
  • a yeast cytosine deaminase yCD
  • yCD yeast cytosine deaminase
  • a split BE should generally increase the specificity of editing compared to typical BEs by virtue of the fact that the split BE system requires the binding of a higher number of sequential/adjacent DNA bases, thereby decreasing the off-target effects conferred by off-target binding of either halfase on its own.
  • CRISPR BE architectures are known to induce C-to-T mutations in human cells at some genomic sites that are imperfect matches to their gRNAs 13 , and since ZFs are known to bind with some capacity to off-target sites it stands to reason that a ZF-BE architecture would also induce off-target mutagenesis to some capacity 14 .
  • CRISPR/Cas-based targeting system including Cas9s from Streptococcus pyogenes or Stapholococcus aureus or Cpf1 proteins from various organisms could be used in place of the nCas9 portion of the sDA2-nCas9-UGI fusion protein, so long as the targeting mechanism results in specific DNA binding and the creation of an R-loop that exposes ssDNA to action by the reconstituted split deaminase.
  • Table 1 contains a list of representative
  • CRISPR/Cas targeting systems and the residues/mutations therein known to be important for creating nickase and catalytically inactive (dead) mutants.
  • Cpf1 nickases have yet to be described
  • catalytically null Cpf1 orthologs may replicate the targeting characteristics of nCas9 such that it could form the basis of a functional sDA2 halfase.
  • ZF domains are chosen as the DNA binding domain for sDA1 due to their small size, presumed lack of immunogenicity, and because, unlike CRISPR-based targeting systems, they do not create an R-loop upon binding and do not expose additional substrate ssDNA to the deaminase domain. In principle, however, use of any engineered DNA binding domain, such as a
  • CRISPR-based targeting complex or a TALE DNA binding domain could still result in functional sDA1 halfase.
  • ZF domains targeting an integrated EGFP gene were used for the sDA1 halfases 15 .
  • the present fusion proteins can include programmable DNA binding domains such as engineered C2H2 zinc-fingers, transcription activator effector-like effectors (TALEs), and Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) Cas RNA-guided nucleases (RGNs) and their variants, including ssDNA nickases (nCas9) or their analogs and catalytically inactive dead Cas9 (dCas9) and its analogs, and any engineered protospacer-adjacent motif (PAM) variants.
  • a programmable DNA binding domain is one that can be engineered to bind to a selected target sequence.
  • the Cas9 nuclease from S. pyogenes can be guided via simple base pair complementarity between 17-20 nucleotides of an engineered guide RNA (gRNA), e.g., a single guide RNA or crRNA/tracrRNA pair, and the complementary strand of a target genomic DNA sequence of interest that lies next to a protospacer adjacent motif (PAM), e.g., a PAM matching the sequence NGG or NAG (Shen et al., Cell Res (2013); Dicarlo et al., Nucleic Acids Res (2013); Jiang et al., Nat Biotechnol 31, 233-239 (2013); Jinek et al., Elife 2, e00471 (2013); Hwang et al., Nat Biotechnol 31, 227-229 (2013); Cong et al., Science 339, 819-823 (2013); Mali et al., Science 339, 823-826 (2013c); Cho e
  • Cpf1 The engineered CRISPR from Prevotella and Francisella 1 (Cpf1) nuclease can also be used, e.g., as described in Zetsche et al., Cell 163, 759-771 (2015); Schunder et al., Int J Med Microbiol 303, 51-60 (2013); Makarova et al., Nat Rev Microbiol 13, 722-736 (2015); Fagerlund et al., Genome Biol 16, 251 (2015).
  • Cpf1 requires only a single 42-nt crRNA, which has 23 nt at its 3’ end that are complementary to the protospacer of the target DNA sequence (Zetsche et al., 2015).
  • SpCas9 recognizes an NGG PAM sequence that is 3’ of the protospacer
  • AsCpf1 and LbCp1 recognize TTTN PAMs that are found 5’ of the protospacer (Id.).
  • the present system utilizes a wild type or variant Cas9 protein from S. pyogenes or Staphylococcus aureus, or a wild type Cpf1 protein from Acidaminococcus sp. BV3L6 or Lachnospiraceae bacterium ND2006 either as encoded in bacteria or codon-optimized for expression in mammalian cells and/or modified in its PAM recognition specificity and/or its genome-wide specificity.
  • a number of variants have been described; see, e.g., WO 2016/141224,
  • the guide RNA is expressed or present in the cell together with the Cas9 or Cpf1. Either the guide RNA or the nuclease, or both, can be expressed transiently or stably in the cell or introduced as a purified protein or nucleic acid.
  • the Cas9 also includes one of the following mutations, which reduce nuclease activity of the Cas9; e.g., for SpCas9, mutations at D10A or H840A (which creates a single-strand nickase).
  • the SpCas9 variants also include mutations at one of the following amino acid positions, which destroy the nuclease activity of the Cas9: D10, E762, D839, H983, or D986 and H840 or N863, e.g., D10A/D10N and
  • H840A/H840N/H840Y to render the nuclease portion of the protein catalytically inactive; substitutions at these positions could be alanine (as they are in Nishimasu al., Cell 156, 935–949 (2014)), or other residues, e.g., glutamine, asparagine, tyrosine, serine, or aspartate, e.g., E762Q, H983N, H983Y, D986N, N863D, N863S, or N863H (see WO 2014/152432).
  • the Cas9 is fused to one or more Uracil glycosylase inhibitor (UGI) protein sequences;
  • UGI Uracil glycosylase inhibitor
  • the UGIs are at the C-terminus of a BE fusion protein, but could
  • Transcription activator like effectors of plant pathogenic bacteria in the genus Xanthomonas play important roles in disease, or trigger defense, by binding host DNA and activating effector-specific host genes. Specificity depends on an effector-variable number of imperfect, typically ⁇ 33-35 amino acid repeats.
  • Polymorphisms are present primarily at repeat positions 12 and 13, which are referred to herein as the repeat variable-diresidue (RVD).
  • RVDs of TAL effectors correspond to the nucleotides in their target sites in a direct, linear fashion, one RVD to one nucleotide, with some degeneracy and no apparent context dependence.
  • the polymorphic region that grants nucleotide specificity may be expressed as a triresidue or triplet.
  • Each DNA binding repeat can include a RVD that determines recognition of a base pair in the target DNA sequence, wherein each DNA binding repeat is responsible for recognizing one base pair in the target DNA sequence.
  • the RVD can comprise one or more of: HA for recognizing C; ND for recognizing C; HI for recognizing C; HN for recognizing G; NA for recognizing G; SN for recognizing G or A; YG for recognizing T; and NK for recognizing G, and one or more of: HD for recognizing C; NG for recognizing T; NI for recognizing A; NN for recognizing G or A; NS for recognizing A or C or G or T; N* for recognizing C or T, wherein * represents a gap in the second position of the RVD; HG for recognizing T; H* for recognizing T, wherein * represents a gap in the second position of the RVD; and IG for recognizing T.
  • TALE proteins may be useful in research and biotechnology as targeted chimeric nucleases that can facilitate homologous recombination in genome engineering (e.g., to add or enhance traits useful for biofuels or biorenewables in plants). These proteins also may be useful as, for example, transcription factors, and especially for therapeutic applications requiring a very high level of specificity such as therapeutics against pathogens (e.g., viruses) as non-limiting examples.
  • pathogens e.g., viruses
  • MegaTALs are a fusion of a meganuclease with a TAL effector; see, e.g., Boissel et al., Nucl. Acids Res.42(4):2591-2601 (2014); Boissel and Scharenberg, Methods Mol Biol.
  • Zinc finger (ZF) proteins are DNA-binding proteins that contain one or more zinc fingers, independently folded zinc-containing mini-domains, the structure of which is well known in the art and defined in, for example, Miller et al., 1985, EMBO J., 4:1609; Berg, 1988, Proc. Natl. Acad. Sci. USA, 85:99; Lee et al., 1989, Science. 245:635; and Klug, 1993, Gene, 135:83.
  • Crystal structures of the zinc finger protein Zif268 and its variants bound to DNA show a semi-conserved pattern of interactions, in which typically three amino acids from the alpha-helix of the zinc finger contact three adjacent base pairs or a“subsite” in the DNA (Pavletich et al., 1991, Science, 252:809; Elrod-Erickson et al., 1998, Structure, 6:451).
  • the crystal structure of Zif268 suggested that zinc finger DNA-binding domains might function in a modular manner with a one-to-one interaction between a zinc finger and a three-base-pair “subsite” in the DNA sequence.
  • multiple zinc fingers are typically linked together in a tandem array to achieve sequence-specific recognition of a contiguous DNA sequence (Klug, 1993, Gene 135:83).
  • Such recombinant zinc finger proteins can be fused to functional domains, such as transcriptional activators, transcriptional repressors, methylation domains, and nucleases to regulate gene expression, alter DNA methylation, and introduce targeted alterations into genomes of model organisms, plants, and human cells (Carroll, 2008, Gene Ther., 15:1463-68; Cathomen, 2008, Mol. Ther., 16:1200-07; Wu et al., 2007, Cell. Mol. Life Sci., 64:2933-44).
  • functional domains such as transcriptional activators, transcriptional repressors, methylation domains, and nucleases to regulate gene expression, alter DNA methylation, and introduce targeted alterations into genomes of model organisms, plants, and human cells
  • module assembly One existing method for engineering zinc finger arrays, known as“modular assembly,” advocates the simple joining together of pre-selected zinc finger modules into arrays (Segal et al., 2003, Biochemistry, 42:2137-48; Beerli et al., 2002, Nat. Biotechnol., 20:135-141; Mandell et al., 2006, Nucleic Acids Res., 34:W516-523; Carroll et al., 2006, Nat. Protoc.1:1329-41; Liu et al., 2002, J. Biol. Chem.,
  • the zinc finger arrays are described in, or are generated as described in, WO 2011/017293 and WO 2004/099366. Additional suitable zinc finger DBDs are described in U.S. Pat. Nos.6,511,808, 6,013,453, 6,007,988, and 6,503,717 and U.S. patent application 2002/0160940. Base Editors
  • the base editor is a deaminase that modifies cytosine DNA bases, e.g., a cytosine deaminase from the apolipoprotein B mRNA-editing enzyme, catalytic polypeptide-like (APOBEC) family of deaminases, including APOBEC1, APOBEC2, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3D/E, APOBEC3F, APOBEC3G, APOBEC3H, APOBEC4 (see, e.g., Yang et al., J Genet Genomics.2017 Sep 20;44(9):423-437); activation-induced cytosine deaminase (AID), e.g., activation induced cytosine deaminase (AICDA), cytosine deaminase 1 (CDA1), and CDA2, and cytosine deamin
  • AID
  • split deaminase regions are shown in Table 3.
  • Each split region listed in Table 3 represents a region of the enzyme either known to be a linker region devoid of secondary structure and positioned away from enzymatically important functions or predicted to be linker based on alignment with hAPOBEC3G where structural information is lacking (* indicates which proteins lack sufficient structural information).
  • Unstructured recognition loops were not included due to their importance in determining substrate binding and specificity. All protein sequences acquired from uniprot.org. All positional information refers to positions within the full-length protein sequences as described below. Candidate split regions described only indicate our best attempt at a priori prediction of which splits will be functional. TABLE 3.
  • the split deaminase regions can include mutations that may enhance base editing, e.g., when made to the nCas9-UGI portion, e.g., mutations corresponding to W90, R126, or R132 of SEQ ID NO:46, e.g., corresponding to W90Y, R126E, R132E, of SEQ ID NO:46 (see, e.g., Kim et al.“Increasing the Genome-Targeting Scope and Precision of Base Editing with Engineered Cas9-Cytosine Deaminase Fusions.” Nature Biotechnology 35(4):371–376 (2017)).
  • the split deaminase regions can include mutations at positions corresponding to one or more of N57, Y130, or K60 of SEQ ID NO:49, e.g., mutations corresponding to N57G, N57A, N57Q, Y130F, K60D of SEQ ID NO:49 (see, e.g., reference 17).
  • the components of the fusion proteins are at least 80%, e.g., at least 85%, 90%, 95%, 97%, or 99% identical to the amino acid sequence of a exemplary sequence (e.g., as provided herein), e.g., have differences at up to 1%, 2%, 5%, 10%, 15%, or 20% of the residues of the exemplary sequence replaced, e.g., with conservative mutations, e.g., including or in addition to the mutations described herein.
  • the variant retains desired activity of the parent, e.g., nickase activity, and/or the ability to interact with a guide RNA and/or target DNA, optionally with improved specificity or altered substrate specificity.
  • the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
  • the length of a reference sequence aligned for comparison purposes is at least 80% of the length of the reference sequence, and in some embodiments is at least 90% or 100%.
  • the nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • nucleic acid“identity” is equivalent to nucleic acid“homology”.
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. Percent identity between two
  • polypeptides or nucleic acid sequences is determined in various ways that are within the skill in the art, for instance, using publicly available computer software such as Smith Waterman Alignment (Smith, T. F. and M. S. Waterman (1981) J Mol Biol 147:195-7);“BestFit” (Smith and Waterman, Advances in Applied Mathematics, 482- 489 (1981)) as incorporated into GeneMatcher Plus TM , Schwarz and Dayhof (1979) Atlas of Protein Sequence and Structure, Dayhof, M.O., Ed, pp 353-358; BLAST program (Basic Local Alignment Search Tool; (Altschul, S. F., W. Gish, et al.
  • the length of comparison can be any length, up to and including full length (e.g., 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). For purposes of the present compositions and methods, at least 80% of the full length of the sequence is aligned.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
  • Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
  • isolated nucleic acids encoding the split deaminase fusion proteins
  • vectors comprising the isolated nucleic acids, optionally operably linked to one or more regulatory domains for expressing the variant proteins
  • host cells e.g., mammalian host cells, comprising the nucleic acids, and optionally expressing the variant proteins.
  • the host cells are stem cells, e.g., hematopoietic stem cells.
  • the fusion proteins include a linker between the DNA binding domain (e.g., ZFN, TALE, or nCas9) and the BE domains.
  • Linkers that can be used in these fusion proteins (or between fusion proteins in a concatenated structure) can include any sequence that does not interfere with the function of the fusion proteins.
  • the linkers are short, e.g., 2-20 amino acids, and are typically flexible (i.e., comprising amino acids with a high degree of freedom such as glycine, alanine, and serine).
  • the linker comprises one or more units consisting of GGGS (SEQ ID NO:5) or GGGGS (SEQ ID NO:6), e.g., two, three, four, or more repeats of the GGGS (SEQ ID NO:5) or GGGGS (SEQ ID NO:6) unit.
  • Other linker sequences can also be used.
  • the split deaminase fusion protein includes a cell- penetrating peptide sequence that facilitates delivery to the intracellular space, e.g., HIV-derived TAT peptide, penetratins, transportans, or hCT derived cell-penetrating peptides, see, e.g., Caron et al., (2001) Mol Ther.3(3):310-8; Langel, Cell-Penetrating Peptides: Processes and Applications (CRC Press, Boca Raton FL 2002); El- Andaloussi et al., (2005) Curr Pharm Des.11(28):3597-611; and Deshayes et al., (2005) Cell Mol Life Sci.62(16):1839-49.
  • a cell- penetrating peptide sequence that facilitates delivery to the intracellular space
  • HIV-derived TAT peptide e.g., HIV-derived TAT peptide, penetratins, transportans, or hCT
  • CPPs Cell penetrating peptides
  • cytoplasm or other organelles e.g. the mitochondria and the nucleus.
  • molecules that can be delivered by CPPs include therapeutic drugs, plasmid DNA, oligonucleotides, siRNA, peptide-nucleic acid (PNA), proteins, peptides,
  • CPPs are generally 30 amino acids or less, are derived from naturally or non-naturally occurring protein or chimeric sequences, and contain either a high relative abundance of positively charged amino acids, e.g. lysine or arginine, or an alternating pattern of polar and non-polar amino acids.
  • CPPs that are commonly used in the art include Tat (Frankel et al., (1988) Cell.55:1189-1193, Vives et al., (1997) J. Biol. Chem.272:16010-16017), penetratin (Derossi et al., (1994) J. Biol.
  • CPPs can be linked with their cargo through covalent or non-covalent strategies.
  • Methods for covalently joining a CPP and its cargo are known in the art, e.g. chemical cross-linking (Stetsenko et al., (2000) J. Org. Chem.65:4900-4909, Gait et al. (2003) Cell. Mol. Life. Sci.60:844-853) or cloning a fusion protein (Nagahara et al., (1998) Nat. Med.4:1449-1453).
  • Non-covalent coupling between the cargo and short amphipathic CPPs comprising polar and non-polar domains is established through electrostatic and hydrophobic interactions.
  • biomolecules into cells examples include cyclosporine linked to polyarginine for immunosuppression (Rothbard et al., (2000) Nature Medicine 6(11):1253-1257), siRNA against cyclin B1 linked to a CPP called MPG for inhibiting tumorigenesis (Crombez et al., (2007) Biochem Soc. Trans.35:44-46), tumor suppressor p53 peptides linked to CPPs to reduce cancer cell growth (Takenobu et al., (2002) Mol.
  • CPPs have been utilized in the art to transport contrast agents into cells for imaging and biosensing applications.
  • green fluorescent protein (GFP) attached to Tat has been used to label cancer cells (Shokolenko et al., (2005) DNA Repair 4(4):511-518).
  • Tat conjugated to quantum dots have been used to successfully cross the blood-brain barrier for visualization of the rat brain (Santra et al., (2005) Chem. Commun.3144-3146).
  • CPPs have also been combined with magnetic resonance imaging techniques for cell imaging (Liu et al., (2006) Biochem. and Biophys. Res. Comm.347(1):133-140). See also Ramsey and Flynn, Pharmacol Ther. 2015 Jul 22. pii: S0163-7258(15)00141-2.
  • the split deaminase fusion proteins can include a nuclear localization sequence, e.g., SV40 large T antigen NLS (PKKKRRV (SEQ ID NO:7)) and nucleoplasmin NLS (KRPAATKKAGQAKKKK (SEQ ID NO:8)).
  • PKKKRRV SEQ ID NO:7
  • KRPAATKKAGQAKKKK SEQ ID NO:8
  • Other NLSs are known in the art; see, e.g., Cokol et al., EMBO Rep.2000 Nov 15; 1(5): 411–415; Freitas and Cunha, Curr Genomics.2009 Dec; 10(8): 550–557.
  • the split deaminase fusion proteins include a moiety that has a high affinity for a ligand, for example GST, FLAG or hexahistidine sequences.
  • affinity tags can facilitate the purification of recombinant split deaminase fusion proteins.
  • the split deaminase fusion proteins described herein can be used for altering the genome of a cell.
  • the methods generally include expressing or contacting the split deaminase fusion proteins in the cells; in versions using one or two Cas9s, the methods include using a guide RNA having a region complementary to a selected portion of the genome of the cell.
  • Methods for selectively altering the genome of a cell are known in the art, see, e.g., US 8,993,233; US 20140186958; US 9,023,649; WO/2014/099744; WO 2014/089290; WO2014/144592; WO144288;
  • CRISPRs Clustered Regularly Interspaced Short Palindromic Repeats
  • the proteins can be produced using any method known in the art, e.g., by in vitro translation, or expression in a suitable host cell from nucleic acid encoding the split deaminase fusion protein; a number of methods are known in the art for producing proteins.
  • the proteins can be produced in and purified from yeast, E. coli, insect cell lines, plants, transgenic animals, or cultured mammalian cells; see, e.g., Palomares et al.,“Production of Recombinant Proteins: Challenges and
  • split deaminase fusion proteins can be linked to a moiety that facilitates transfer into a cell, e.g., a lipid nanoparticle, optionally with a linker that is cleaved once the protein is inside the cell. See, e.g., LaFountaine et al., Int J Pharm.2015 Aug 13;494(1):180-194.
  • the nucleic acid encoding the split deaminase fusion can be cloned into an intermediate vector for transformation into prokaryotic or eukaryotic cells for replication and/or expression.
  • Intermediate vectors are typically prokaryote vectors, e.g., plasmids, or shuttle vectors, or insect vectors, for storage or manipulation of the nucleic acid encoding the split deaminase fusion for production of the split deaminase fusion protein.
  • the nucleic acid encoding the split deaminase fusion protein can also be cloned into an expression vector, for
  • a plant cell preferably a mammalian cell or a human cell, fungal cell, bacterial cell, or protozoan cell.
  • a sequence encoding a split deaminase fusion protein is typically subcloned into an expression vector that contains a promoter to direct transcription.
  • Suitable bacterial and eukaryotic promoters are well known in the art and described, e.g., in Sambrook et al., Molecular Cloning, A Laboratory Manual (3d ed.2001); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al., eds., 2010).
  • Bacterial expression systems for expressing the engineered protein are available in, e.g., E.
  • Kits for such expression systems are commercially available.
  • Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available.
  • the promoter used to direct expression of a nucleic acid depends on the particular application. For example, a strong constitutive promoter is typically used for expression and purification of fusion proteins. In contrast, when the split deaminase fusion protein is to be administered in vivo for gene regulation, either a constitutive or an inducible promoter can be used, depending on the particular use of the split deaminase fusion protein. In addition, a preferred promoter for
  • administration of the split deaminase fusion protein can be a weak promoter, such as HSV TK or a promoter having similar activity.
  • the promoter can also include elements that are responsive to transactivation, e.g., hypoxia response elements, Gal4 response elements, lac repressor response element, and small molecule control systems such as tetracycline-regulated systems and the RU-486 system (see, e.g., Gossen & Bujard, 1992, Proc. Natl. Acad. Sci.
  • the expression vector typically contains a transcription unit or expression cassette that contains all the additional elements required for the expression of the nucleic acid in host cells, either prokaryotic or eukaryotic.
  • a typical expression cassette thus contains a promoter operably linked, e.g., to the nucleic acid sequence encoding the split deaminase fusion protein, and any signals required, e.g., for efficient polyadenylation of the transcript, transcriptional termination, ribosome binding sites, or translation termination.
  • Additional elements of the cassette may include, e.g., enhancers, and heterologous spliced intronic signals.
  • the particular expression vector used to transport the genetic information into the cell is selected with regard to the intended use of the split deaminase fusion protein, e.g., expression in plants, animals, bacteria, fungus, protozoa, etc.
  • Standard bacterial expression vectors include plasmids such as pBR322 based plasmids, pSKF, pET23D, and commercially available tag-fusion expression systems such as GST and LacZ.
  • Expression vectors containing regulatory elements from eukaryotic viruses are often used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors derived from Epstein-Barr virus.
  • eukaryotic vectors include pMSG, pAV009/A+, pMTO10/A+, pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the SV40 early promoter, SV40 late promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
  • the vectors for expressing the split deaminase fusion protein can include RNA Pol III promoters to drive expression of the guide RNAs, e.g., the H1, U6 or 7SK promoters. These human promoters allow for expression of split deaminase fusion protein in mammalian cells following plasmid transfection.
  • Some expression systems have markers for selection of stably transfected cell lines such as thymidine kinase, hygromycin B phosphotransferase, and dihydrofolate reductase.
  • High yield expression systems are also suitable, such as using a baculovirus vector in insect cells, with the gRNA encoding sequence under the direction of the polyhedrin promoter or other strong baculovirus promoters.
  • the elements that are typically included in expression vectors also include a replicon that functions in E. coli, a gene encoding antibiotic resistance to permit selection of bacteria that harbor recombinant plasmids, and unique restriction sites in nonessential regions of the plasmid to allow insertion of recombinant sequences.
  • Standard transfection methods are used to produce bacterial, mammalian, yeast or insect cell lines that express large quantities of protein, which are then purified using standard techniques (see, e.g., Colley et al., 1989, J. Biol. Chem., 264:17619-22; Guide to Protein Purification, in Methods in Enzymology, vol.182 (Deutscher, ed., 1990)). Transformation of eukaryotic and prokaryotic cells are performed according to standard techniques (see, e.g., Morrison, 1977, J. Bacteriol. 132:349-351; Clark-Curtiss & Curtiss, Methods in Enzymology 101:347-362 (Wu et al., eds, 1983).
  • Any of the known procedures for introducing foreign nucleotide sequences into host cells may be used. These include the use of calcium phosphate transfection, polybrene, protoplast fusion, electroporation, nucleofection, liposomes,
  • the methods also include delivering a gRNA that interacts with the Cas9.
  • the methods can include delivering the split deaminase fusion protein and guide RNA together, e.g., as a complex.
  • the split deaminase fusion protein and gRNA can be can be overexpressed in a host cell and purified, then complexed with the guide RNA (e.g., in a test tube) to form a ribonucleoprotein (RNP), and delivered to cells.
  • the split deaminase fusion protein can be expressed in and purified from bacteria through the use of bacterial expression plasmids.
  • His-tagged split deaminase fusion protein can be expressed in bacterial cells and then purified using nickel affinity chromatography.
  • RNPs circumvents the necessity of delivering plasmid DNAs encoding the nuclease or the guide, or encoding the nuclease as an mRNA. RNP delivery may also improve specificity, presumably because the half-life of the RNP is shorter and there’s no persistent expression of the nuclease and guide (as you’d get from a plasmid).
  • the RNPs can be delivered to the cells in vivo or in vitro, e.g., using lipid-mediated transfection or electroporation. See, e.g., Liang et al.
  • the present invention also includes the vectors and cells comprising the vectors, as well as kits comprising the proteins and nucleic acids described herein, e.g., for use in a method described herein.
  • sDA1-containing expression plasmids were constructed by selectively amplifying desired regions of the rAPO1, hA3A, or BE3 genes, as well as DNA sequences encoding a 3AC3L-NLS or NLS only linker and desired EGFP-targeting ZFs, by the PCR method such that they had significant overlapping ends and using isothermal assembly (or“Gibson Assembly,” NEB) to assemble them in the desired order in a pCAG expression vector.
  • sDA2-containing expression plasmids were constructed by truncating a BE3 gene by PCR and using Gibson assembly to put the resulting pieces into a pCAG expression plasmid. PCR was conducted using Q5 or Phusion polymerases (NEB).
  • a HEK293 cell line in which an integrated EGFP reporter gene has been integrated was grown in culture using media consisting of Advanced Dulbeccos Modified Medium (Gibco) supplemented with 10% heat inactivated fetal bovine serum (Gibco), 1% 10,000 U/ml penicillin-streptomycin solution (Gibco), and 1% Glutamax (Gibco). Cells were passaged every 3-4 days to maintain an actively growing population and avoid anoxic conditions.
  • Transfections containing 1.0 microgram of transfection quality DNA were conducted by seeding 1.5x10 5 cells in 24-well TC-treated plates (Corning) and using TransIT- 293 reagent according to manufacturer’s protocol (Mirus Bio).
  • 400 nanograms contained the sDA1-encoding plasmid
  • 400 nanograms contained the sDA2-encoding plasmid
  • 200 nanograms contained an expression plasmid encoding the SpCas9 gRNA targeting the EGFP reporter gene.
  • 400 nanograms contained BE-expressing plasmid
  • 400 nanograms contained a pMax-GFP-encoding plasmid (Lonza)
  • 200 nanograms contained an expression plasmid encoding the SpCas9 gRNA targeting the EGFP reporter gene.
  • 400 nanograms contained the sDA-encoding plasmid
  • 400 nanograms contained a pMax- GFP-encoding plasmid (Lonza)
  • 200 nanograms contained an expression plasmid encoding the SpCas9 gRNA targeting the EGFP reporter gene.
  • Genomic DNA was harvested 3 days post-transfection using the DNAdvance kit (Agencourt). High-throughput amplicon sequencing
  • Rates of base editing at target loci were determined by deep-sequencing of PCR amplicons amplified off of genomic DNA isolated from transfected cells.
  • Target site genomic DNA was amplified using EGFP-specific DNA primers flanking the sDA2 nCas9 binding sites.
  • Illumina TruSeq adapters were added to the ends of the amplicons either by PCR or NEBNext Ultra II kit (NEB) and molecularly indexed with NEBNext Dual Index Primers (NEB). Samples were combined into libraries and sequenced on the Illumina MiSeq machine using the MiSeq Reagent Micro Kit v2 (Illumina). Sequencing results were analyzed using a batch version of the software CRISPResso (crispresso.rocks).
  • “X” indicates an undetermined amino acid residue, indicating the variable regions of a ZF that are responsible for specific DNA binding.
  • sDA1 halfases that contain a truncation variant from split region X are referred to as sDA1.X, and sDA2 halfases are similarly named. Tables 4-6 show the exact truncation variants that we have created and evaluated. In addition to exactly reciprocal halfase pairs (in which the sDA1 and sDA2 portions of the BE contain truncation variants of a deaminase perfectly bisected by a defined split site), we also tested split BEs in which the halfases shared overlapping peptide sequences.
  • hA3A split BEs include an sDA1 with an sDA1-NLS-ZF configuration.
  • rAPO1 sDA1.1 + rAPO1 sDA2.1, rAPO1 sDA1.2 + rAPO1 sDA2.1, rAPO1 sDA1.2 + rAPO1 sDA2.2, hA3A sDA1.1 + sDA2.1, and hA3A 1.6 + hA3A 2.6 show significant activity compared to a positive BE3 control ( Figures 4, 6, 7, 20, and 21).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Medicinal Chemistry (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Hematology (AREA)
  • Mycology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Immunology (AREA)
  • Cell Biology (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)

Abstract

Described herein are methods and compositions for improving the genome-wide specificities of targeted base editing technologies. Herein, we describe dimeric base editing (BE) technologies that use split deaminases (sDA) that are functional when brought into close proximity to each other, one fused to a ZF and one to an nCas9-UGI protein comprising one or more UGIs, so as to limit the ability of the deaminase domain from deaminating at off-target ssDNA target sites independent of nCas9 R-loop formation. Thus, provided herein are fusion proteins comprising: (i) a first portion of a split deaminase ("sDAI") enzyme fused to a programmable DNA-binding domain; or (ii) a second portion of a split deaminase ("sDA2") fused to an nCas9 protein. The present invention also includes the vectors and cells comprising the vectors, as well as kits comprising the proteins and nucleic acids described herein.

Description

USING SPLIT DEAMINASES TO LIMIT UNWANTED OFF-TARGET BASE EDITOR DEAMINATION CLAIM OF PRIORITY
This application claims the benefit of U.S. Provisional Patent Application Serial No.62/511,296, filed on May 25, 2017; Serial No.62/541,544, filed on 08/04/2017; and Serial No.62/622,676, filed on 01/26/2018. The entire contents of the foregoing are hereby incorporated by reference. FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT
This invention was made with Government support under Grant No.
GM118158 awarded by the National Institutes of Health. The Government has certain rights in the invention. TECHNICAL FIELD
Described herein are methods and compositions for improving the genome- wide specificities of targeted base editing technologies. BACKGROUND
Base editing (BE) technologies use an engineered DNA binding domain (such as RNA-guided, catalytically inactive Cas9 (dead Cas9 or dCas9), a nickase version of Cas9 (nCas9), or zinc finger (ZF) arrays) to recruit a cytosine deaminase domain to a specific genomic location to effect site-specific cytosine→thymine transition substitutions1,2. BEs are a particularly attractive tool for treating genetic diseases that manifest in cellular contexts where making precise mutations by homology directed repair (HDR) would be therapeutically beneficial but are difficult to create with traditional nuclease-based genome editing technology. For example, it is challenging or impossible to achieve HDR outcomes in tissues composed primarily of slowly dividing or post-mitotic cell populations, since HDR pathways are restricted to the G2 and S phases of the cell cycle3. In addition, the efficiency of HDR can be substantially limited by the competing and more efficient induction of variable-length indel mutations caused by non-homologous end-joining-mediated repair of nuclease- induced breaks. By contrast, BE technology has the potential to allow practitioners to make highly controllable, highly precise mutations without the need for cell-type- variable DNA repair mechanisms. SUMMARY
Base editor platforms (BE) possess the unique capability to generate precise, user-defined genome-editing events without the need for a donor DNA molecule. Base Editors (BEs) that include a single strand nicking CRISPR-Cas9 (nCas9) protein fused to cytosine deaminase domain and uracil glycosylase inhibitor (UGI) domains (e.g., BE3) efficiently induce cytosine-to-thymine (C-to-T) base transitions in a site- specific manner as determined by the CRISPR guide RNA (gRNA) spacer sequence1. As with all genome editing reagents, it is critical to first determine and then mitigate BE’s capacity for generating off-target mutations before it is used for therapeutics so as to limit its potential for creating deleterious and irreversible genetically-encoded side-effects. Herein, we describe dimeric BEs that use split deaminases (sDA) that are functional when brought into close proximity to each other, one fused to a ZF and one to an nCas9-UGI protein comprising one or more UGIs, so as to limit the ability of the deaminase domain from deaminating at off-target ssDNA target sites independent of nCas9 R-loop formation.
Thus, provided herein are fusion proteins comprising: (i) a first portion of a split deaminase (“sDA1”) enzyme fused to a programmable DNA-binding domain, preferably selected from the group consisting of such as a ZF, TALE, Cas9, catalytically inactive Cas9 (dCas9) or Cas9 ortholog (i.e., a homologous protein from another species such as dCpf1), nicking Cas9 (nCas9) or nicking Cas9 ortholog, wherein the sDA1 is an N-terminal truncated, catalytically inactive or deficient derivative of a parental deaminase selected from the group consisting of hAID, rAPOBEC1, mAPOBEC3, hAPOBEC3A, hAPOBEC3B, hAPOBEC3C,
hAPOBEC3F, hAPOBEC3G, or hAPOBEC3H, and variants thereof, e.g., variants that have altered substrate specificities or activities such as eA3A; or (ii) a second portion of a split deaminase (“sDA2”) fused to an nCas9 protein, preferably an nCas9- UGI protein, e.g., in a manner similar to previously described base editor
architectures, or any orthogonal DNA targeting domain as the one used for its complementary sDA1 portion (e.g., dCpf1, TALE, ZF), wherein the sDA2 is a C- terminal truncated, catalytically inactive or deficient derivative of a parental deaminase selected from the group consisting of hAID, rAPOBEC1*, mAPOBEC3, hAPOBEC3A, hAPOBEC3B, hAPOBEC3C, hAPOBEC3F, hAPOBEC3G, or hAPOBEC3H, and/or variants thereof, e.g., with altered substrate specificities or activities such as eA3A. In the present methods, the split deaminases are not full length proteins, but are fragments thereof, wherein the co-expression of a fusion protein of (i) with a fusion protein of (ii) comprising a sDA1 and sDA2 portion from the same parental deaminase in eukaryotic cells, and their subsequent co-localization at adjacent genomic target sites, provides a catalytically active base-editor. The terms “sDA1” and“sDA2” are used herein to refer to the first and second split deaminases generally, and do not refer specifically to the exemplary split deaminases described herein.
Also provided herein are nucleic acids encoding the fusion proteins described herein, and compositions comprising one or more of those nucleic acids, e.g., wherein the nucleic acids encode a pair of the fusion proteins, e.g., comprising a SDA1 and SDA2 portion from the same parental deaminase. Further, provided herein are vectors comprising the nucleic acids, and isolated host cells comprising and optionally expressing the nucleic acids. In some embodiments, the host cell is a stem cell, e.g., a hematopoietic stem cell.
In addition, provided herein are methods for targeted deamination of one or more selected cytosines in a nucleic acid. The methods include contacting the nucleic acid with a pair of fusion proteins described herein comprising a SDA1 and SDA2 portion from the same parental deaminase, as well as one or more gRNAs that interact with Cas9 domains in the fusion proteins. In some embodiments, one of the fusion proteins comprises nCas9, the other fusion protein comprises ZF or TALE, and the ZF or TALE is targeted to a sequence of 9-24bp adjacent to the target site of the gRNA for the nCas9, wherein the gRNA binds to the nucleic acid comprising the selected cytosine.
In some embodiments, the nucleic acid is in a cell, e.g., a eukaryotic cell, and the method comprises contact the cell with the fusion proteins or expressing the fusion proteins in the cell.
Also provided are methods for improving specificity of targeted deamination in a cell, e.g., a eukaryotic cell, by expressing in the cell, or contacting the cell with, a pair of fusion proteins described herein comprising a sDA1 and sDA2 portion from the same parental deaminase, as well as one or more gRNAs that interact with Cas9 domains in the fusion proteins. In some embodiments, one of the fusion proteins comprises nCas9, the other fusion protein comprises ZF or TALE, the ZF or TALE is targeted to a sequence of 9-24bp adjacent to the target site of the gRNA for the nCas9, wherein the gRNA binds to the nucleic acid comprising the selected cytosine.
In some embodiments, the fusion protein is delivered as an RNP, mRNA, or plasmid.
Also provided herein are methods for deaminating one or more selected cytosines in a nucleic acid, by contacting the nucleic acid with a pair of fusion proteins described herein comprising a sDA1 and sDA2 portion from the same parental deaminase, as well as one or more gRNAs that interact with Cas9 domains in the fusion proteins.
In addition, provided herein are compositions comprising a purified fusion protein or pair of fusion proteins described herein, preferably a pair of fusion proteins described herein comprising a sDA1 and sDA2 portion from the same parental deaminase, an optionally one or more gRNAs that interact with Cas9 domains in the fusion proteins. In some embodiments, the composition comprise one or more ribonucleoprotein (RNP) complexes.
Also provided herein are ribonucleoprotein (RNP) complexes that include a variant spCas9 protein as described herein and a guide RNA that targets a sequence having a PAM sequence targeted by the split deaminase fusion protein comprising Cas9 or Cas9 derivative.
Also provided herein are methods for targeted deamination, or improving specificity of targeted deamination, of a selected cytosine in a nucleic acid, comprising contacting the nucleic acid with one or more of the fusion proteins or base editing systems described herein.
In some embodiments, the fusion protein is delivered as an RNP, mRNA, or plasmid DNA.
Also provided herein are methods for deaminating a selected cytosine in a nucleic acid, the method comprising contacting the nucleic acid with a fusion protein or base editing system described herein.
Additionally, provided herein are compositions comprising a purified a fusion protein or base editing system as described herein. Further, provided herein are nucleic acids encoding a fusion protein or base editing system described herein, as well as vectors comprising the nucleic acids, and host cells comprising the nucleic acids, e.g., stem cells, e.g., hematopoietic stem cells.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Methods and materials are described herein for use in the present invention; other, suitable methods and materials known in the art can also be used. The materials, methods, and examples are illustrative only and not intended to be limiting. All publications, patent applications, patents, sequences, database entries, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control.
Other features and advantages of the invention will be apparent from the following detailed description and figures, and from the claims. DESCRIPTION OF DRAWINGS FIGURE 1. Diagram of an exemplary typical high efficiency base editing setup. A nicking Cas9 bearing a catalytically inactivating mutation at one of its two nuclease domains binds to the target site dictated by the variable spacer sequence of the gRNA. The formation of a stable R-loop creates a ssDNA editing window on the non-deaminated strand. The Cas9 creates a single strand break in the genomic DNA, prompting the host cell to repair the lesion using the deaminated strand as a template, thus biasing repair towards the cytosine→thymine transition substitution. See Komor et al., 2016.
FIGUREs 2A-2G. Schematic representation of: 2A.) First-generation base editor targeting and deaminating at an on-target site, with a deaminase targeting an R- loop generated by an on-target nCas9.2B.) First-generation base-editor binding to and deaminating an off-target genomic R-loop independent of its nCas9 targeting capabilities.2C.) First-generation base-editor binding to and deaminating an off-target genomic transcription bubble independent of its nCas9 targeting capabilities. (Note: 2B and 2C are exemplary cases of genomic ssDNA targets potentially available to BE deamination, but do not constitute an exhaustive list.) 2D.) A split-deaminase (sDA) BE targeting a genomic site with an nCas9-mediated R-loop and adjacent TALE or ZF binding. Note that the two split deaminase portions (sDA1 and sDA2) are brought into close proximity by the adjacent binding, reconstituting their catalytic activity and allowing on-target deamination.2E and 2F.) Even if one half of a split BE could bind a non-target piece of ssDNA such as a genomic R-loop or transcription bubble through its sDA domain, it would not have enough machinery to reconstitute deaminase enzymatic activity (sDA2-nCas9-UGI half shown).2G. Off-target binding of the ZF or nCas9 components of a sDA system (ZF-sDA1 shown) would not result in co-localization of enough machinery to reconstitute deaminase enzymatic activity.
FIGUREs 3A-3B. hAPOBEC3G with representative candidate split sites. Multiple rotational views of the hAPOBEC3G structure are shown. Magenta colored loop regions are candidate split sites selected on the bases of their lack of secondary structures and their distance from the catalytic center. PDB: 3E1U.
FIGURE 4. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.1- 3AC3L-ZF-C and N-sDA2.1-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. The sDA1.1 and sDA2.1 pair resulted in significant C-to-T conversion when the ZF binding site was upstream of gRNA binding site with an in-series orientation with 31bps in-between. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
FIGURE 5. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.1- 3AC3L-ZF-C and N-sDA2.2-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. The sDA1.1 and sDA2.2 pair did not stimulate discernable C-to-T conversion in any orientation attempted. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
FIGURE 6. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.2- 3AC3L-ZF-C and N-sDA2.1-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. Low-level C-to-T mutations are observed primarily when using gRNA2 with either ZF, with gRNA1 experiments yielding detectable but diminished levels of activity. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
FIGURE 7. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.2- 3AC3L-ZF-C and N-sDA2.2-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. Low-level C-to-T mutations are observed primarily when using gRNA2 with either ZF, with gRNA1 experiments yielding detectable but diminished levels of activity. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 8. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.2-3AC3L- ZF-C and N-sDA2.3-nCas9-UGI-C proteins in several indicated orientations.
Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. No significant mutations detected. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 9. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.3-3AC3L- ZF-C and N-sDA2.2-nCas9-UGI-C proteins in several indicated orientations.
Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. No significant mutations detected. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 10. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.2- 3AC3L-ZF-C and N-sDA2.3-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. No significant mutations detected. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 11. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.3- 3AC3L-ZF-C and N-sDA2.4-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. No significant mutations detected. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 12. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.4- 3AC3L-ZF-C and N-sDA2.3-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. No significant mutations detected. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 13. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.4- 3AC3L-ZF-C and N-sDA2.4-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. No significant mutations detected. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 14. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.5- 3AC3L-ZF-C and N-sDA2.4-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. No significant mutations detected. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 15. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.5- 3AC3L-ZF-C and N-sDA2.6-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. No significant mutations detected. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 16. C-to-T transition mutations in the integrated EGFP gene from a split rAPO1 base editor architecture consisting of adjacently-targeting N-sDA1.6- 3AC3L-ZF-C and N-sDA2.6-nCas9-UGI-C proteins in several indicated orientations. Conversion rates at each position are indicated by shaded boxes with overlaid percentage numbers for residues in which significant mutation was observed.
Orientation information is depicted, with arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM) and ZF binding sites (with the arrow indicating the direction of ZF binding in reference to N ^C orientation).
Approximate editing windows (residues 4-8 in the gRNA target site) are indicated. Experiments were performed in duplicate and sequencing from each sample is shown independently. No significant mutations detected. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 17. C-to-T conversion data with first-generation BE3 (described in reference 1) with both gRNAs used in this study. (Note that the coloration gradient of these samples is shaded lighter than graphs above and that direct comparison requires evaluation of relative numerical rates). Orientation information is depicted, with an arrows representing gRNA binding sites (with the arrow pointing in the direction of the PAM). EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 18. C-to-T conversion rates of individual N-sDA1-ZF-C proteins without an adjacent sDA2-nCas9-UGI. No discernable editing observed. EGFP target sequence, CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT (SEQ ID NO:1).
Figure 19. C-to-T conversion rates of individual N-sDA2-nCas9-UGI-C proteins without an adjacent N-sDA1-ZF-C. No discernable editing was observed. EGFP target sequence,
CTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCT
(SEQ ID NO:1).
Figure 20. Evidence of C-to-T conversion when using adjacently-targeting N- sDA1.X-NLS-ZF-C and N-sDA2.X-nCas9-UGI-C human APOBEC3a (hA3A) split Base Editors in the indicated orientation. Pointed boxes representing the nCas9 gRNA binding site (gRNA2) and ZF binding site (ZF1) are shown, with the pointed ends indicating the PAM-proximal end of the gRNA and indicating the N ^C orientation of the ZF, respectively. Conversion rates at each position are indicated by shaded boxes. Rates of deamination by split BE pairs are around 2.5% per cytosine using the sDA1.6 + sDA2.6 configuration and around 1.7% per cytosine for the sDA1.1 + sDA2.1 configuration, while a hAPOBEC3A-nCas9-UGI positive control possessed 3-4x the amount of on-target activity as active hA3A halfase pairs. gRNA target region:
CATGCCCGAAGGCTACGTCCAG (SEQ ID NO:2).
Figures 21A-21D. Summary of C-to-T conversion rate of all rAPO1 halfase combination base editors as compared to a benchmark BE3 base editor at an integrated EGFP locus. The sum of total C-to-T editing percentages among three cytosines within or near the target gRNA’s approximate editing window is shown, as averaged between two replicates.21A shows the ZF1+gRNA1 data, 21B shows the ZF1+gRNA2 data, 21C shows the ZF2+gRNA1 data, 21D shows the ZF2+gRNA2 data.
Figure 22. Representation of a portion of the EGFP reporter gene and the target sites used for the rAPO1 halfase combination experiments. EGFP target region: GCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCG CCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACG
(SEQ ID NO:3). DETAILED DESCRIPTION
In the most efficient BE configuration described to date, a cytosine deaminase (DA) domain and uracil glycosylase inhibitor (UGI; a small bacteriophage protein that inhibits host cell uracil DNA glycosylase (UDG), the enzyme responsible for excising uracil from the genome1, 4) are both fused to nCas9 (derived from either Streptococcus pyogenes Cas9 (SpCas9) or Staphylococcus aureus Cas9 (SaCas9). The nCas9 forms an R-loop at a target site specified by its single guide RNA (gRNA) and recognition of an adjacent protospacer adjacent motif (PAM), leaving approximately 4-8 nucleotides of the non-target strand exposed as single stranded DNA (ssDNA) near the PAM-distal end of the R-loop (Figure 1). This region of the ssDNA is the template that is able to be deaminated by the ssDNA-specific DA domain to produce a guanosine:uracil (G:U) mismatch and defines the editing window. The nCas9 nicks the non-deaminated strand of DNA, biasing conversion of the G:U mismatch to an adenine:thymine (A:T) base pair by directing the cell to repair the nick lesion using the deaminated strand as a template. To date, the deaminase domains described in these fusion proteins have been rat APOBEC1 (rAPO1), an activation-induced cytosine deaminase (AID) derived from lamprey termed CDA (PmCDA), human AID (hAID), or a hyperactive form of hAID lacking a nuclear export signal, or an engineered variant of human APOBEC3A (hA3A) termed eA3A1-2, 5-7, 16. Any of these deaminase domains from these BEs can be used as parental deaminases in the present fusion proteins. BE technology was primarily established using the SpCas9 protein for its nCas9 domain (nSpCas9), but although herein we refer to nCas9, in general any Cas9-like nickase could be used based on any ortholog of the Cpf1 protein (including the related Cpf1 enzyme class) to perform this function, unless specifically indicated. In addition, a completely enzymatically dead dCas9 (or Cas9-like enzyme) can also be used as the targeting mechanism of a functional BE enzyme.
An important consideration for the use of BE in therapeutic settings will be to assess its genome-wide capacity for off-target mutagenesis and to modify the technology to minimize or, ideally, to eliminate the risks of stimulating deleterious off-target mutations. Herein, we described technological improvements to BEs that can be used to reduce or eliminate potential unwanted BE mutagenesis. Using Split Deaminases to Limit Unwanted Off-target Base Editor Deamination
Because of AID/APOBEC enzymes’ natural ability to bind and deaminate cytosines in genomic DNA and cytosines in RNA, non-specific spurious deamination events are a possibly important source of off-target mutagenesis in the genome and transcriptome from CRISPR Base Editor technology. In theory, even if the BE’s nCas9 domain (and any potential dCas9, TALE, and/or ZF domains) are eminently specific, this might do nothing to prevent the natural RNA- and ssDNA-targeting ability of the APOBEC enzyme from non-specifically deaminating globally across the transcriptome or the whichever regions of the genome are exposed as ssDNA, such as actively transcribed regions or DNA undergoing replication. In fact, an E. coli-based assay examining deaminases showed that an actively transcribed region could be highly enriched (~7-530 fold) for C→T transition mutations when exposed to various overexpressed mammalian deaminases4. Further, one group has found that co- expression of PmCda1 and nCas9 as two separate, untethered proteins in yeast cells results in similar levels of deamination at the gRNA-specified target site as when the two components are expressed as direct fusion partners, demonstrating that these proteins are capable of deaminating ssDNA from solution without an affinity tether to the genomic location5. This concern is especially relevant now that scientists are becoming increasingly aware that R-loops are a more common occurrence in the genomes of eukaryotic cells than previously thought, thus creating many potential steady-state off-target ssDNA substrates where an APOBEC could bind and deaminate6. While it is as yet unproven whether BE overexpression itself can sufficiently stimulate spurious deamination and mutagenesis on a global genomic scale, aberrant and over-active APOBEC deaminase activity is a known driver of tumorigenic mutagenesis7 and overexpression of at least hAPO38-11 has been shown to stimulate genomic cytosine hypermutation. Thus, it stands to reason that limiting the naturally global deaminating activity of over-expressed deaminases like BE will be important for translating BE technologies into therapeutic applications. Of note, since most BEs include at least one UGI inhibitor to bias deamination events toward productive C→T mutations, it is possible that global off-target BE activity is even more mutagenic than the effects of aberrant deaminase activity alone during tumorigenesis.
To impose a stricter requirement for BEs to act on their intended target sequences rather than globally, we created a split BE architecture comprised of two separate proteins consisting of reciprocal deaminase truncation variants fused to adjacently-targeted DNA binding domains. These dimeric BE technologies make use of“split deaminases” (sDAs) that require co-localization (an“AND Gate”) of both sDA domains at adjacent DNA sites to function properly. In this scenario, spurious binding events of either“halfase” of the dimeric base-editor will be unlikely to result in productive deamination events, since each component on its own will not contain the full complement of enzymatic machinery necessary to catalyze cytosine deamination (Figures 2A-2G).
To create dimeric BEs, we fused an N-terminal truncation of a split deaminase (sDA1) enzyme to a ZF (though any DNA targeting domain orthogonal to Cas9, such as Cpf1, TALE, ZF, or a dCas9 orthogonal to the nCas9 used to target sDA2, may be suitable) targeted to a ~9-24bp sequence, and a reciprocal or somewhat overlapping C-terminal truncation of a deaminase fused to an nCas9-UGI fusion protein, such that the N-terminal truncation and the C-terminal truncation together form a functional enzyme. The exemplary BEs were made in a similar orientation to the first- generation BE3 enzyme (sDA2-nCas9-UGI) targeting an adjacent sequence with a ~17-24bp target site1. To the best of the inventors’ knowledge, though there is no record of functional split APOBEC enzymes (or other mammalian deaminases), a yeast cytosine deaminase (yCD) has been shown to constitute at least a partially functional enzyme (on cytosine as a metabolite and the pro-drug 5-fluorocytosine, though it was not shown to be able to deaminate DNA) when split and reconstituted by protein dimerization12 and serves as a useful template to inform how various APOBEC proteins may be effectively bifurcated; however, since the yCD shares little primary sequence homology to mammalian deaminases, and the split yCD was not reported to function on DNA and used protein scaffolds to bring its constituent pieces together, it is not obvious that yCD split deaminases will be directly comparable to those so far described for use in for BEs. Therefore, we used APOBEC structural information to determine the unstructured linker regions as potential sites at which to split APOBEC enzymes (Figures 3A-3B), since those sites may be less likely to affect overall functionality or folding of the constituent subdomains. This split deaminase strategy can be used with wild-type versions of deaminase enyzmes, and also any engineered variants that may be described, with the split BE potentially retaining any special features of the engineered deaminases16.
This architecture should virtually eliminate the capacity for spurious deamination, since any other DNA binding event by either of the two constituent halfases will lack any enzymatic deaminase activity and will be therefore unable to perturb genomic DNA. In addition, a split BE should generally increase the specificity of editing compared to typical BEs by virtue of the fact that the split BE system requires the binding of a higher number of sequential/adjacent DNA bases, thereby decreasing the off-target effects conferred by off-target binding of either halfase on its own. CRISPR BE architectures are known to induce C-to-T mutations in human cells at some genomic sites that are imperfect matches to their gRNAs13, and since ZFs are known to bind with some capacity to off-target sites it stands to reason that a ZF-BE architecture would also induce off-target mutagenesis to some capacity14.
It is conceivable and likely that any CRISPR/Cas-based targeting system, including Cas9s from Streptococcus pyogenes or Stapholococcus aureus or Cpf1 proteins from various organisms could be used in place of the nCas9 portion of the sDA2-nCas9-UGI fusion protein, so long as the targeting mechanism results in specific DNA binding and the creation of an R-loop that exposes ssDNA to action by the reconstituted split deaminase. Table 1 contains a list of representative
CRISPR/Cas targeting systems and the residues/mutations therein known to be important for creating nickase and catalytically inactive (dead) mutants. Note that while Cpf1 nickases have yet to be described, catalytically null Cpf1 orthologs may replicate the targeting characteristics of nCas9 such that it could form the basis of a functional sDA2 halfase. In some embodiments, ZF domains are chosen as the DNA binding domain for sDA1 due to their small size, presumed lack of immunogenicity, and because, unlike CRISPR-based targeting systems, they do not create an R-loop upon binding and do not expose additional substrate ssDNA to the deaminase domain. In principle, however, use of any engineered DNA binding domain, such as a
CRISPR-based targeting complex or a TALE DNA binding domain, could still result in functional sDA1 halfase. In the examples shown herein, ZF domains targeting an integrated EGFP gene were used for the sDA1 halfases15. Programmable DNA Binding Domain
The present fusion proteins can include programmable DNA binding domains such as engineered C2H2 zinc-fingers, transcription activator effector-like effectors (TALEs), and Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) Cas RNA-guided nucleases (RGNs) and their variants, including ssDNA nickases (nCas9) or their analogs and catalytically inactive dead Cas9 (dCas9) and its analogs, and any engineered protospacer-adjacent motif (PAM) variants. A programmable DNA binding domain is one that can be engineered to bind to a selected target sequence. CRISPR-Cas Nucleases
Although herein we refer to nCas9, in general any Cas9-like nickase could be used based on any ortholog of the Cpf1 protein (including the related Cpf1 enzyme class), unless specifically indicated. TABLE 1: List of Exemplary Cas9 Orthologs
Figure imgf000019_0001
* predicted based on UniRule annotation on the UniProt database.
**May be determinable based on sequence alignment with other Cpf1 orthologs These orthologs, and mutants and variants thereof as known in the art, can be used in any of the fusion proteins described herein. See, e.g., WO 2017/040348 (which describes variants of SaCas9 and SpCas 9 with increased specificity) and WO 2016/141224 (which describes variants of SaCas9 and SpCas 9 with altered PAM specificity).
The Cas9 nuclease from S. pyogenes (hereafter simply Cas9) can be guided via simple base pair complementarity between 17-20 nucleotides of an engineered guide RNA (gRNA), e.g., a single guide RNA or crRNA/tracrRNA pair, and the complementary strand of a target genomic DNA sequence of interest that lies next to a protospacer adjacent motif (PAM), e.g., a PAM matching the sequence NGG or NAG (Shen et al., Cell Res (2013); Dicarlo et al., Nucleic Acids Res (2013); Jiang et al., Nat Biotechnol 31, 233-239 (2013); Jinek et al., Elife 2, e00471 (2013); Hwang et al., Nat Biotechnol 31, 227-229 (2013); Cong et al., Science 339, 819-823 (2013); Mali et al., Science 339, 823-826 (2013c); Cho et al., Nat Biotechnol 31, 230-232 (2013); Jinek et al., Science 337, 816-821 (2012)). The engineered CRISPR from Prevotella and Francisella 1 (Cpf1) nuclease can also be used, e.g., as described in Zetsche et al., Cell 163, 759-771 (2015); Schunder et al., Int J Med Microbiol 303, 51-60 (2013); Makarova et al., Nat Rev Microbiol 13, 722-736 (2015); Fagerlund et al., Genome Biol 16, 251 (2015). Unlike SpCas9, Cpf1 requires only a single 42-nt crRNA, which has 23 nt at its 3’ end that are complementary to the protospacer of the target DNA sequence (Zetsche et al., 2015). Furthermore, whereas SpCas9 recognizes an NGG PAM sequence that is 3’ of the protospacer, AsCpf1 and LbCp1 recognize TTTN PAMs that are found 5’ of the protospacer (Id.).
In some embodiments, the present system utilizes a wild type or variant Cas9 protein from S. pyogenes or Staphylococcus aureus, or a wild type Cpf1 protein from Acidaminococcus sp. BV3L6 or Lachnospiraceae bacterium ND2006 either as encoded in bacteria or codon-optimized for expression in mammalian cells and/or modified in its PAM recognition specificity and/or its genome-wide specificity. A number of variants have been described; see, e.g., WO 2016/141224,
PCT/US2016/049147, Kleinstiver et al., Nat Biotechnol.2016 Aug;34(8):869-74; Tsai and Joung, Nat Rev Genet.2016 May;17(5):300-12; Kleinstiver et al., Nature.2016 Jan 28;529(7587):490-5; Shmakov et al., Mol Cell.2015 Nov 5;60(3):385-97;
Kleinstiver et al., Nat Biotechnol.2015 Dec;33(12):1293-1298; Dahlman et al., Nat Biotechnol.2015 Nov;33(11):1159-61; Kleinstiver et al., Nature.2015 Jul
23;523(7561):481-5; Wyvekens et al., Hum Gene Ther.2015 Jul;26(7):425-31;
Hwang et al., Methods Mol Biol.2015;1311:317-34; Osborn et al., Hum Gene Ther. 2015 Feb;26(2):114-26; Konermann et al., Nature.2015 Jan 29;517(7536):583-8; Fu et al., Methods Enzymol.2014;546:21-45; and Tsai et al., Nat Biotechnol.2014 Jun;32(6):569-76, inter alia. The guide RNA is expressed or present in the cell together with the Cas9 or Cpf1. Either the guide RNA or the nuclease, or both, can be expressed transiently or stably in the cell or introduced as a purified protein or nucleic acid.
In some embodiments, the Cas9 also includes one of the following mutations, which reduce nuclease activity of the Cas9; e.g., for SpCas9, mutations at D10A or H840A (which creates a single-strand nickase).
In some embodiments, the SpCas9 variants also include mutations at one of the following amino acid positions, which destroy the nuclease activity of the Cas9: D10, E762, D839, H983, or D986 and H840 or N863, e.g., D10A/D10N and
H840A/H840N/H840Y, to render the nuclease portion of the protein catalytically inactive; substitutions at these positions could be alanine (as they are in Nishimasu al., Cell 156, 935–949 (2014)), or other residues, e.g., glutamine, asparagine, tyrosine, serine, or aspartate, e.g., E762Q, H983N, H983Y, D986N, N863D, N863S, or N863H (see WO 2014/152432).
In some embodiments, the Cas9 is fused to one or more Uracil glycosylase inhibitor (UGI) protein sequences; an exemplary UGI sequence is as follows:
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVM LLTSDAPEYKPWALVIQDSNGENKIKML (SEQ ID NO:4; Uniprot: P14739).
Typically, the UGIs are at the C-terminus of a BE fusion protein, but could
conceivably be at the N-terminus, or between the DNA binding domain and the sDA domain. Linkers as known in the art can be used to separate domains. TAL Effector Repeat Arrays
Transcription activator like effectors (TALEs) of plant pathogenic bacteria in the genus Xanthomonas play important roles in disease, or trigger defense, by binding host DNA and activating effector-specific host genes. Specificity depends on an effector-variable number of imperfect, typically ~33-35 amino acid repeats.
Polymorphisms are present primarily at repeat positions 12 and 13, which are referred to herein as the repeat variable-diresidue (RVD). The RVDs of TAL effectors correspond to the nucleotides in their target sites in a direct, linear fashion, one RVD to one nucleotide, with some degeneracy and no apparent context dependence. In some embodiments, the polymorphic region that grants nucleotide specificity may be expressed as a triresidue or triplet. Each DNA binding repeat can include a RVD that determines recognition of a base pair in the target DNA sequence, wherein each DNA binding repeat is responsible for recognizing one base pair in the target DNA sequence. In some embodiments, the RVD can comprise one or more of: HA for recognizing C; ND for recognizing C; HI for recognizing C; HN for recognizing G; NA for recognizing G; SN for recognizing G or A; YG for recognizing T; and NK for recognizing G, and one or more of: HD for recognizing C; NG for recognizing T; NI for recognizing A; NN for recognizing G or A; NS for recognizing A or C or G or T; N* for recognizing C or T, wherein * represents a gap in the second position of the RVD; HG for recognizing T; H* for recognizing T, wherein * represents a gap in the second position of the RVD; and IG for recognizing T.
TALE proteins may be useful in research and biotechnology as targeted chimeric nucleases that can facilitate homologous recombination in genome engineering (e.g., to add or enhance traits useful for biofuels or biorenewables in plants). These proteins also may be useful as, for example, transcription factors, and especially for therapeutic applications requiring a very high level of specificity such as therapeutics against pathogens (e.g., viruses) as non-limiting examples.
Methods for generating engineered TALE arrays are known in the art, see, e.g., the fast ligation-based automatable solid-phase high-throughput (FLASH) system described in USSN 61/610,212, and Reyon et al., Nature Biotechnology 30,460–465 (2012); as well as the methods described in Bogdanove & Voytas, Science 333, 1843- 1846 (2011); Bogdanove et al., Curr Opin Plant Biol 13, 394-401 (2010); Scholze & Boch, J. Curr Opin Microbiol (2011); Boch et al., Science 326, 1509-1512 (2009); Moscou & Bogdanove, Science 326, 1501 (2009); Miller et al., Nat Biotechnol 29, 143-148 (2011); Morbitzer et al., T. Proc Natl Acad Sci U S A 107, 21617-21622 (2010); Morbitzer et al., Nucleic Acids Res 39, 5790-5799 (2011); Zhang et al., Nat Biotechnol 29, 149-153 (2011); Geissler et al., PLoS ONE 6, e19509 (2011); Weber et al., PLoS ONE 6, e19722 (2011); Christian et al., Genetics 186, 757-761 (2010); Li et al., Nucleic Acids Res 39, 359-372 (2011); Mahfouz et al., Proc Natl Acad Sci U S A 108, 2623-2628 (2011); Mussolino et al., Nucleic Acids Res (2011); Li et al., Nucleic Acids Res 39, 6315-6325 (2011); Cermak et al., Nucleic Acids Res 39, e82 (2011); Wood et al., Science 333, 307 (2011); Hockemeye et al. Nat Biotechnol 29, 731-734 (2011); Tesson et al., Nat Biotechnol 29, 695-696 (2011); Sander et al., Nat Biotechnol 29, 697-698 (2011); Huang et al., Nat Biotechnol 29, 699-700 (2011); and Zhang et al., Nat Biotechnol 29, 149-153 (2011); all of which are incorporated herein by reference in their entirety.
Also suitable for use in the present methods are MegaTALs, which are a fusion of a meganuclease with a TAL effector; see, e.g., Boissel et al., Nucl. Acids Res.42(4):2591-2601 (2014); Boissel and Scharenberg, Methods Mol Biol.
2015;1239:171-96.
Zinc Fingers
Zinc finger (ZF) proteins are DNA-binding proteins that contain one or more zinc fingers, independently folded zinc-containing mini-domains, the structure of which is well known in the art and defined in, for example, Miller et al., 1985, EMBO J., 4:1609; Berg, 1988, Proc. Natl. Acad. Sci. USA, 85:99; Lee et al., 1989, Science. 245:635; and Klug, 1993, Gene, 135:83. Crystal structures of the zinc finger protein Zif268 and its variants bound to DNA show a semi-conserved pattern of interactions, in which typically three amino acids from the alpha-helix of the zinc finger contact three adjacent base pairs or a“subsite” in the DNA (Pavletich et al., 1991, Science, 252:809; Elrod-Erickson et al., 1998, Structure, 6:451). Thus, the crystal structure of Zif268 suggested that zinc finger DNA-binding domains might function in a modular manner with a one-to-one interaction between a zinc finger and a three-base-pair “subsite” in the DNA sequence. In naturally occurring zinc finger transcription factors, multiple zinc fingers are typically linked together in a tandem array to achieve sequence-specific recognition of a contiguous DNA sequence (Klug, 1993, Gene 135:83).
Multiple studies have shown that it is possible to artificially engineer the DNA binding characteristics of individual zinc fingers by randomizing the amino acids at the alpha-helical positions involved in DNA binding and using selection
methodologies such as phage display to identify desired variants capable of binding to DNA target sites of interest (Rebar et al., 1994, Science, 263:671; Choo et al., 1994 Proc. Natl. Acad. Sci. USA, 91:11163; Jamieson et al., 1994, Biochemistry 33:5689; Wu et al., 1995 Proc. Natl. Acad. Sci. USA, 92: 344). Such recombinant zinc finger proteins can be fused to functional domains, such as transcriptional activators, transcriptional repressors, methylation domains, and nucleases to regulate gene expression, alter DNA methylation, and introduce targeted alterations into genomes of model organisms, plants, and human cells (Carroll, 2008, Gene Ther., 15:1463-68; Cathomen, 2008, Mol. Ther., 16:1200-07; Wu et al., 2007, Cell. Mol. Life Sci., 64:2933-44).
One existing method for engineering zinc finger arrays, known as“modular assembly,” advocates the simple joining together of pre-selected zinc finger modules into arrays (Segal et al., 2003, Biochemistry, 42:2137-48; Beerli et al., 2002, Nat. Biotechnol., 20:135-141; Mandell et al., 2006, Nucleic Acids Res., 34:W516-523; Carroll et al., 2006, Nat. Protoc.1:1329-41; Liu et al., 2002, J. Biol. Chem.,
277:3850-56; Bae et al., 2003, Nat. Biotechnol., 21:275-280; Wright et al., 2006, Nat. Protoc., 1:1637-52). Although straightforward enough to be practiced by any researcher, recent reports have demonstrated a high failure rate for this method, particularly in the context of zinc finger nucleases (Ramirez et al., 2008, Nat.
Methods, 5:374-375; Kim et al., 2009, Genome Res.19:1279-88), a limitation that typically necessitates the construction and cell-based testing of very large numbers of zinc finger proteins for any given target gene (Kim et al., 2009, Genome Res.
19:1279-88).
Combinatorial selection-based methods that identify zinc finger arrays from randomized libraries have been shown to have higher success rates than modular assembly (Maeder et al., 2008, Mol. Cell, 31:294-301; Joung et al., 2010, Nat.
Methods, 7:91-92; Isalan et al., 2001, Nat. Biotechnol., 19:656-660). In preferred embodiments, the zinc finger arrays are described in, or are generated as described in, WO 2011/017293 and WO 2004/099366. Additional suitable zinc finger DBDs are described in U.S. Pat. Nos.6,511,808, 6,013,453, 6,007,988, and 6,503,717 and U.S. patent application 2002/0160940. Base Editors
In some embodiments, the base editor is a deaminase that modifies cytosine DNA bases, e.g., a cytosine deaminase from the apolipoprotein B mRNA-editing enzyme, catalytic polypeptide-like (APOBEC) family of deaminases, including APOBEC1, APOBEC2, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3D/E, APOBEC3F, APOBEC3G, APOBEC3H, APOBEC4 (see, e.g., Yang et al., J Genet Genomics.2017 Sep 20;44(9):423-437); activation-induced cytosine deaminase (AID), e.g., activation induced cytosine deaminase (AICDA), cytosine deaminase 1 (CDA1), and CDA2, and cytosine deaminase acting on tRNA (CDAT). The following Table 2 provides exemplary sequences; other sequences can also be used.
Table 2.
Figure imgf000025_0001
* from Saccharomyces cerevisiae S288C Exemplary split deaminase regions are shown in Table 3. Each split region listed in Table 3 represents a region of the enzyme either known to be a linker region devoid of secondary structure and positioned away from enzymatically important functions or predicted to be linker based on alignment with hAPOBEC3G where structural information is lacking (* indicates which proteins lack sufficient structural information). Unstructured recognition loops were not included due to their importance in determining substrate binding and specificity. All protein sequences acquired from uniprot.org. All positional information refers to positions within the full-length protein sequences as described below. Candidate split regions described only indicate our best attempt at a priori prediction of which splits will be functional. TABLE 3. Split Deaminase Regions
Figure imgf000026_0001
The split deaminase regions can include mutations that may enhance base editing, e.g., when made to the nCas9-UGI portion, e.g., mutations corresponding to W90, R126, or R132 of SEQ ID NO:46, e.g., corresponding to W90Y, R126E, R132E, of SEQ ID NO:46 (see, e.g., Kim et al.“Increasing the Genome-Targeting Scope and Precision of Base Editing with Engineered Cas9-Cytosine Deaminase Fusions.” Nature Biotechnology 35(4):371–376 (2017)). Alternatively or in addition, the split deaminase regions can include mutations at positions corresponding to one or more of N57, Y130, or K60 of SEQ ID NO:49, e.g., mutations corresponding to N57G, N57A, N57Q, Y130F, K60D of SEQ ID NO:49 (see, e.g., reference 17). Variants
In some embodiments, the components of the fusion proteins are at least 80%, e.g., at least 85%, 90%, 95%, 97%, or 99% identical to the amino acid sequence of a exemplary sequence (e.g., as provided herein), e.g., have differences at up to 1%, 2%, 5%, 10%, 15%, or 20% of the residues of the exemplary sequence replaced, e.g., with conservative mutations, e.g., including or in addition to the mutations described herein. In preferred embodiments, the variant retains desired activity of the parent, e.g., nickase activity, and/or the ability to interact with a guide RNA and/or target DNA, optionally with improved specificity or altered substrate specificity.
To determine the percent identity of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). The length of a reference sequence aligned for comparison purposes is at least 80% of the length of the reference sequence, and in some embodiments is at least 90% or 100%. The nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein nucleic acid“identity” is equivalent to nucleic acid“homology”). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. Percent identity between two
polypeptides or nucleic acid sequences is determined in various ways that are within the skill in the art, for instance, using publicly available computer software such as Smith Waterman Alignment (Smith, T. F. and M. S. Waterman (1981) J Mol Biol 147:195-7);“BestFit” (Smith and Waterman, Advances in Applied Mathematics, 482- 489 (1981)) as incorporated into GeneMatcher PlusTM, Schwarz and Dayhof (1979) Atlas of Protein Sequence and Structure, Dayhof, M.O., Ed, pp 353-358; BLAST program (Basic Local Alignment Search Tool; (Altschul, S. F., W. Gish, et al. (1990) J Mol Biol 215: 403-10), BLAST-2, BLAST-P, BLAST-N, BLAST-X, WU-BLAST- 2, ALIGN, ALIGN-2, CLUSTAL, or Megalign (DNASTAR) software. In addition, those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the length of the sequences being compared. In general, for proteins or nucleic acids, the length of comparison can be any length, up to and including full length (e.g., 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). For purposes of the present compositions and methods, at least 80% of the full length of the sequence is aligned.
For purposes of the present disclosure, the comparison of sequences and determination of percent identity between two sequences can be accomplished using a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
Also provided herein are isolated nucleic acids encoding the split deaminase fusion proteins, vectors comprising the isolated nucleic acids, optionally operably linked to one or more regulatory domains for expressing the variant proteins, and host cells, e.g., mammalian host cells, comprising the nucleic acids, and optionally expressing the variant proteins. In some embodiments, the host cells are stem cells, e.g., hematopoietic stem cells.
In some embodiments, the fusion proteins include a linker between the DNA binding domain (e.g., ZFN, TALE, or nCas9) and the BE domains. Linkers that can be used in these fusion proteins (or between fusion proteins in a concatenated structure) can include any sequence that does not interfere with the function of the fusion proteins. In preferred embodiments, the linkers are short, e.g., 2-20 amino acids, and are typically flexible (i.e., comprising amino acids with a high degree of freedom such as glycine, alanine, and serine). In some embodiments, the linker comprises one or more units consisting of GGGS (SEQ ID NO:5) or GGGGS (SEQ ID NO:6), e.g., two, three, four, or more repeats of the GGGS (SEQ ID NO:5) or GGGGS (SEQ ID NO:6) unit. Other linker sequences can also be used.
In some embodiments, the split deaminase fusion protein includes a cell- penetrating peptide sequence that facilitates delivery to the intracellular space, e.g., HIV-derived TAT peptide, penetratins, transportans, or hCT derived cell-penetrating peptides, see, e.g., Caron et al., (2001) Mol Ther.3(3):310-8; Langel, Cell-Penetrating Peptides: Processes and Applications (CRC Press, Boca Raton FL 2002); El- Andaloussi et al., (2005) Curr Pharm Des.11(28):3597-611; and Deshayes et al., (2005) Cell Mol Life Sci.62(16):1839-49. Cell penetrating peptides (CPPs) are short peptides that facilitate the movement of a wide range of biomolecules across the cell membrane into the cytoplasm or other organelles, e.g. the mitochondria and the nucleus. Examples of molecules that can be delivered by CPPs include therapeutic drugs, plasmid DNA, oligonucleotides, siRNA, peptide-nucleic acid (PNA), proteins, peptides,
nanoparticles, and liposomes. CPPs are generally 30 amino acids or less, are derived from naturally or non-naturally occurring protein or chimeric sequences, and contain either a high relative abundance of positively charged amino acids, e.g. lysine or arginine, or an alternating pattern of polar and non-polar amino acids. CPPs that are commonly used in the art include Tat (Frankel et al., (1988) Cell.55:1189-1193, Vives et al., (1997) J. Biol. Chem.272:16010-16017), penetratin (Derossi et al., (1994) J. Biol. Chem.269:10444-10450), polyarginine peptide sequences (Wender et al., (2000) Proc. Natl. Acad. Sci. USA 97:13003-13008, Futaki et al., (2001) J. Biol. Chem.276:5836-5840), and transportan (Pooga et al., (1998) Nat. Biotechnol.
16:857-861).
CPPs can be linked with their cargo through covalent or non-covalent strategies. Methods for covalently joining a CPP and its cargo are known in the art, e.g. chemical cross-linking (Stetsenko et al., (2000) J. Org. Chem.65:4900-4909, Gait et al. (2003) Cell. Mol. Life. Sci.60:844-853) or cloning a fusion protein (Nagahara et al., (1998) Nat. Med.4:1449-1453). Non-covalent coupling between the cargo and short amphipathic CPPs comprising polar and non-polar domains is established through electrostatic and hydrophobic interactions.
CPPs have been utilized in the art to deliver potentially therapeutic
biomolecules into cells. Examples include cyclosporine linked to polyarginine for immunosuppression (Rothbard et al., (2000) Nature Medicine 6(11):1253-1257), siRNA against cyclin B1 linked to a CPP called MPG for inhibiting tumorigenesis (Crombez et al., (2007) Biochem Soc. Trans.35:44-46), tumor suppressor p53 peptides linked to CPPs to reduce cancer cell growth (Takenobu et al., (2002) Mol. Cancer Ther.1(12):1043-1049, Snyder et al., (2004) PLoS Biol.2:E36), and dominant negative forms of Ras or phosphoinositol 3 kinase (PI3K) fused to Tat to treat asthma (Myou et al., (2003) J. Immunol.171:4399-4405).
CPPs have been utilized in the art to transport contrast agents into cells for imaging and biosensing applications. For example, green fluorescent protein (GFP) attached to Tat has been used to label cancer cells (Shokolenko et al., (2005) DNA Repair 4(4):511-518). Tat conjugated to quantum dots have been used to successfully cross the blood-brain barrier for visualization of the rat brain (Santra et al., (2005) Chem. Commun.3144-3146). CPPs have also been combined with magnetic resonance imaging techniques for cell imaging (Liu et al., (2006) Biochem. and Biophys. Res. Comm.347(1):133-140). See also Ramsey and Flynn, Pharmacol Ther. 2015 Jul 22. pii: S0163-7258(15)00141-2.
Alternatively or in addition, the split deaminase fusion proteins can include a nuclear localization sequence, e.g., SV40 large T antigen NLS (PKKKRRV (SEQ ID NO:7)) and nucleoplasmin NLS (KRPAATKKAGQAKKKK (SEQ ID NO:8)). Other NLSs are known in the art; see, e.g., Cokol et al., EMBO Rep.2000 Nov 15; 1(5): 411–415; Freitas and Cunha, Curr Genomics.2009 Dec; 10(8): 550–557.
In some embodiments, the split deaminase fusion proteins include a moiety that has a high affinity for a ligand, for example GST, FLAG or hexahistidine sequences. Such affinity tags can facilitate the purification of recombinant split deaminase fusion proteins.
The split deaminase fusion proteins described herein can be used for altering the genome of a cell. The methods generally include expressing or contacting the split deaminase fusion proteins in the cells; in versions using one or two Cas9s, the methods include using a guide RNA having a region complementary to a selected portion of the genome of the cell. Methods for selectively altering the genome of a cell are known in the art, see, e.g., US 8,993,233; US 20140186958; US 9,023,649; WO/2014/099744; WO 2014/089290; WO2014/144592; WO144288;
WO2014/204578; WO2014/152432; WO2115/099850; US8,697,359;
US20160024529; US20160024524; US20160024523; US20160024510;
US20160017366; US20160017301; US20150376652; US20150356239;
US20150315576; US20150291965; US20150252358; US20150247150;
US20150232883; US20150232882; US20150203872; US20150191744;
US20150184139; US20150176064; US20150167000; US20150166969;
US20150159175; US20150159174; US20150093473; US20150079681;
US20150067922; US20150056629; US20150044772; US20150024500;
US20150024499; US20150020223;; US20140356867; US20140295557;
US20140273235; US20140273226; US20140273037; US20140189896; US20140113376; US20140093941; US20130330778; US20130288251;
US20120088676; US20110300538; US20110236530; US20110217739;
US20110002889; US20100076057; US20110189776; US20110223638;
US20130130248; US20150050699; US20150071899; US20150050699; ;
US20150045546; US20150031134; US20150024500; US20140377868;
US20140357530; US20140349400; US20140335620; US20140335063;
US20140315985; US20140310830; US20140310828; US20140309487;
US20140304853; US20140298547; US20140295556; US20140294773;
US20140287938; US20140273234; US20140273232; US20140273231;
US20140273230; US20140271987; US20140256046; US20140248702;
US20140242702; US20140242700; US20140242699; US20140242664;
US20140234972; US20140227787; US20140212869; US20140201857;
US20140199767; US20140189896; US20140186958; US20140186919;
US20140186843; US20140179770; US20140179006; US20140170753;
WO/2008/108989; WO/2010/054108; WO/2012/164565; WO/2013/098244;
WO/2013/176772; US 20150071899; Makarova et al., "Evolution and classification of the CRISPR-Cas systems" 9(6) Nature Reviews Microbiology 467-477 (1-23) (Jun. 2011); Wiedenheft et al., "RNA-guided genetic silencing systems in bacteria and archaea" 482 Nature 331-338 (Feb.16, 2012); Gasiunas et al., "Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria" 109(39) Proceedings of the National Academy of Sciences USA E2579- E2586 (Sep.4, 2012); Jinek et al., "A Programmable Dual-RNA-Guided DNA
Endonuclease in Adaptive Bacterial Immunity" 337 Science 816-821 (Aug.17, 2012); Carroll, "A CRISPR Approach to Gene Targeting" 20(9) Molecular Therapy 1658- 1660 (Sep.2012); U.S. Appl. No.61/652,086, filed May 25, 2012; Al-Attar et al., Clustered Regularly Interspaced Short Palindromic Repeats (CRISPRs): The
Hallmark of an Ingenious Antiviral Defense Mechanism in Prokaryotes, Biol Chem. (2011) vol.392, Issue 4, pp.277-289; Hale et al., Essential Features and Rational Design of CRISPR RNAs That Function With the Cas RAMP Module Complex to Cleave RNAs, Molecular Cell, (2012) vol.45, Issue 3, 292-302.
For methods in which the split deaminase fusion proteins are delivered to cells, the proteins can be produced using any method known in the art, e.g., by in vitro translation, or expression in a suitable host cell from nucleic acid encoding the split deaminase fusion protein; a number of methods are known in the art for producing proteins. For example, the proteins can be produced in and purified from yeast, E. coli, insect cell lines, plants, transgenic animals, or cultured mammalian cells; see, e.g., Palomares et al.,“Production of Recombinant Proteins: Challenges and
Solutions,” Methods Mol Biol.2004;267:15-52. In addition, the split deaminase fusion proteins can be linked to a moiety that facilitates transfer into a cell, e.g., a lipid nanoparticle, optionally with a linker that is cleaved once the protein is inside the cell. See, e.g., LaFountaine et al., Int J Pharm.2015 Aug 13;494(1):180-194. Expression Systems
To use the split deaminase fusion proteins described herein, it may be desirable to express them from a nucleic acid that encodes them. This can be performed in a variety of ways. For example, the nucleic acid encoding the split deaminase fusion can be cloned into an intermediate vector for transformation into prokaryotic or eukaryotic cells for replication and/or expression. Intermediate vectors are typically prokaryote vectors, e.g., plasmids, or shuttle vectors, or insect vectors, for storage or manipulation of the nucleic acid encoding the split deaminase fusion for production of the split deaminase fusion protein. The nucleic acid encoding the split deaminase fusion protein can also be cloned into an expression vector, for
administration to a plant cell, animal cell, preferably a mammalian cell or a human cell, fungal cell, bacterial cell, or protozoan cell.
To obtain expression, a sequence encoding a split deaminase fusion protein is typically subcloned into an expression vector that contains a promoter to direct transcription. Suitable bacterial and eukaryotic promoters are well known in the art and described, e.g., in Sambrook et al., Molecular Cloning, A Laboratory Manual (3d ed.2001); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al., eds., 2010). Bacterial expression systems for expressing the engineered protein are available in, e.g., E. coli, Bacillus sp., and Salmonella (Palva et al., 1983, Gene 22:229-235). Kits for such expression systems are commercially available. Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available.
The promoter used to direct expression of a nucleic acid depends on the particular application. For example, a strong constitutive promoter is typically used for expression and purification of fusion proteins. In contrast, when the split deaminase fusion protein is to be administered in vivo for gene regulation, either a constitutive or an inducible promoter can be used, depending on the particular use of the split deaminase fusion protein. In addition, a preferred promoter for
administration of the split deaminase fusion protein can be a weak promoter, such as HSV TK or a promoter having similar activity. The promoter can also include elements that are responsive to transactivation, e.g., hypoxia response elements, Gal4 response elements, lac repressor response element, and small molecule control systems such as tetracycline-regulated systems and the RU-486 system (see, e.g., Gossen & Bujard, 1992, Proc. Natl. Acad. Sci. USA, 89:5547; Oligino et al., 1998, Gene Ther., 5:491-496; Wang et al., 1997, Gene Ther., 4:432-441; Neering et al., 1996, Blood, 88:1147-55; and Rendahl et al., 1998, Nat. Biotechnol., 16:757-761).
In addition to the promoter, the expression vector typically contains a transcription unit or expression cassette that contains all the additional elements required for the expression of the nucleic acid in host cells, either prokaryotic or eukaryotic. A typical expression cassette thus contains a promoter operably linked, e.g., to the nucleic acid sequence encoding the split deaminase fusion protein, and any signals required, e.g., for efficient polyadenylation of the transcript, transcriptional termination, ribosome binding sites, or translation termination. Additional elements of the cassette may include, e.g., enhancers, and heterologous spliced intronic signals.
The particular expression vector used to transport the genetic information into the cell is selected with regard to the intended use of the split deaminase fusion protein, e.g., expression in plants, animals, bacteria, fungus, protozoa, etc. Standard bacterial expression vectors include plasmids such as pBR322 based plasmids, pSKF, pET23D, and commercially available tag-fusion expression systems such as GST and LacZ.
Expression vectors containing regulatory elements from eukaryotic viruses are often used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors derived from Epstein-Barr virus. Other exemplary eukaryotic vectors include pMSG, pAV009/A+, pMTO10/A+, pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the SV40 early promoter, SV40 late promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
The vectors for expressing the split deaminase fusion protein can include RNA Pol III promoters to drive expression of the guide RNAs, e.g., the H1, U6 or 7SK promoters. These human promoters allow for expression of split deaminase fusion protein in mammalian cells following plasmid transfection.
Some expression systems have markers for selection of stably transfected cell lines such as thymidine kinase, hygromycin B phosphotransferase, and dihydrofolate reductase. High yield expression systems are also suitable, such as using a baculovirus vector in insect cells, with the gRNA encoding sequence under the direction of the polyhedrin promoter or other strong baculovirus promoters.
The elements that are typically included in expression vectors also include a replicon that functions in E. coli, a gene encoding antibiotic resistance to permit selection of bacteria that harbor recombinant plasmids, and unique restriction sites in nonessential regions of the plasmid to allow insertion of recombinant sequences.
Standard transfection methods are used to produce bacterial, mammalian, yeast or insect cell lines that express large quantities of protein, which are then purified using standard techniques (see, e.g., Colley et al., 1989, J. Biol. Chem., 264:17619-22; Guide to Protein Purification, in Methods in Enzymology, vol.182 (Deutscher, ed., 1990)). Transformation of eukaryotic and prokaryotic cells are performed according to standard techniques (see, e.g., Morrison, 1977, J. Bacteriol. 132:349-351; Clark-Curtiss & Curtiss, Methods in Enzymology 101:347-362 (Wu et al., eds, 1983).
Any of the known procedures for introducing foreign nucleotide sequences into host cells may be used. These include the use of calcium phosphate transfection, polybrene, protoplast fusion, electroporation, nucleofection, liposomes,
microinjection, naked DNA, plasmid vectors, viral vectors, both episomal and integrative, and any of the other well-known methods for introducing cloned genomic DNA, cDNA, synthetic DNA or other foreign genetic material into a host cell (see, e.g., Sambrook et al., supra). It is only necessary that the particular genetic engineering procedure used be capable of successfully introducing at least one gene into the host cell capable of expressing the split deaminase fusion protein. In methods wherein the fusion proteins include a Cas9 domain, the methods also include delivering a gRNA that interacts with the Cas9.
Alternatively, the methods can include delivering the split deaminase fusion protein and guide RNA together, e.g., as a complex. For example, the split deaminase fusion protein and gRNA can be can be overexpressed in a host cell and purified, then complexed with the guide RNA (e.g., in a test tube) to form a ribonucleoprotein (RNP), and delivered to cells. In some embodiments, the split deaminase fusion protein can be expressed in and purified from bacteria through the use of bacterial expression plasmids. For example, His-tagged split deaminase fusion protein can be expressed in bacterial cells and then purified using nickel affinity chromatography. The use of RNPs circumvents the necessity of delivering plasmid DNAs encoding the nuclease or the guide, or encoding the nuclease as an mRNA. RNP delivery may also improve specificity, presumably because the half-life of the RNP is shorter and there’s no persistent expression of the nuclease and guide (as you’d get from a plasmid). The RNPs can be delivered to the cells in vivo or in vitro, e.g., using lipid-mediated transfection or electroporation. See, e.g., Liang et al. "Rapid and highly efficient mammalian cell engineering via Cas9 protein transfection." Journal of biotechnology 208 (2015): 44-53; Zuris, John A., et al. "Cationic lipid-mediated delivery of proteins enables efficient protein-based genome editing in vitro and in vivo." Nature biotechnology 33.1 (2015): 73-80; Kim et al. "Highly efficient RNA-guided genome editing in human cells via delivery of purified Cas9 ribonucleoproteins." Genome research 24.6 (2014): 1012-1019.
The present invention also includes the vectors and cells comprising the vectors, as well as kits comprising the proteins and nucleic acids described herein, e.g., for use in a method described herein. EXAMPLES
The invention is further described in the following examples, which do not limit the scope of the invention described in the claims. Materials and Methods
The following materials and methods were used in the Examples below. Molecular Cloning
sDA1-containing expression plasmids were constructed by selectively amplifying desired regions of the rAPO1, hA3A, or BE3 genes, as well as DNA sequences encoding a 3AC3L-NLS or NLS only linker and desired EGFP-targeting ZFs, by the PCR method such that they had significant overlapping ends and using isothermal assembly (or“Gibson Assembly,” NEB) to assemble them in the desired order in a pCAG expression vector. sDA2-containing expression plasmids were constructed by truncating a BE3 gene by PCR and using Gibson assembly to put the resulting pieces into a pCAG expression plasmid. PCR was conducted using Q5 or Phusion polymerases (NEB).
Cell Culture and Transfections
A HEK293 cell line in which an integrated EGFP reporter gene has been integrated (unpublished) was grown in culture using media consisting of Advanced Dulbeccos Modified Medium (Gibco) supplemented with 10% heat inactivated fetal bovine serum (Gibco), 1% 10,000 U/ml penicillin-streptomycin solution (Gibco), and 1% Glutamax (Gibco). Cells were passaged every 3-4 days to maintain an actively growing population and avoid anoxic conditions. Transfections containing 1.0 microgram of transfection quality DNA (Qiagen Maxi- or Miniprep) were conducted by seeding 1.5x105 cells in 24-well TC-treated plates (Corning) and using TransIT- 293 reagent according to manufacturer’s protocol (Mirus Bio). For split deaminase experiments: of the 1.0 micrograms of DNA transfected, 400 nanograms contained the sDA1-encoding plasmid, 400 nanograms contained the sDA2-encoding plasmid, and 200 nanograms contained an expression plasmid encoding the SpCas9 gRNA targeting the EGFP reporter gene. For BE control experiments: 400 nanograms contained BE-expressing plasmid, 400 nanograms contained a pMax-GFP-encoding plasmid (Lonza), and 200 nanograms contained an expression plasmid encoding the SpCas9 gRNA targeting the EGFP reporter gene. For individual halfase controls: 400 nanograms contained the sDA-encoding plasmid, 400 nanograms contained a pMax- GFP-encoding plasmid (Lonza), and 200 nanograms contained an expression plasmid encoding the SpCas9 gRNA targeting the EGFP reporter gene. Genomic DNA was harvested 3 days post-transfection using the DNAdvance kit (Agencourt). High-throughput amplicon sequencing
Rates of base editing at target loci were determined by deep-sequencing of PCR amplicons amplified off of genomic DNA isolated from transfected cells. Target site genomic DNA was amplified using EGFP-specific DNA primers flanking the sDA2 nCas9 binding sites. Illumina TruSeq adapters were added to the ends of the amplicons either by PCR or NEBNext Ultra II kit (NEB) and molecularly indexed with NEBNext Dual Index Primers (NEB). Samples were combined into libraries and sequenced on the Illumina MiSeq machine using the MiSeq Reagent Micro Kit v2 (Illumina). Sequencing results were analyzed using a batch version of the software CRISPResso (crispresso.rocks).
Figure imgf000037_0001
Relevant protein sequences
In the following sequences,“X” indicates an undetermined amino acid residue, indicating the variable regions of a ZF that are responsible for specific DNA binding.
Figure imgf000037_0002
Figure imgf000038_0001
Figure imgf000039_0001
Figure imgf000040_0001
Figure imgf000041_0001
Figure imgf000042_0001
Figure imgf000043_0001
Figure imgf000044_0001
Figure imgf000045_0001
Figure imgf000046_0001
Figure imgf000047_0001
Figure imgf000048_0001
Figure imgf000049_0001
Figure imgf000050_0001
Figure imgf000051_0001
Figure imgf000052_0001
Figure imgf000053_0001
Figure imgf000054_0001
Figure imgf000055_0001
Figure imgf000056_0001
Figure imgf000057_0001
Figure imgf000058_0001
Example 1.
Since multiple mammalian deaminases may constitute functional BE proteins, and multiple truncation points may result in functional split BEs, we sought to examine an extensive set of split BE candidate pairs (Table 2, above, shows a representative list of deaminases that may be suitable for BE applications). Deaminase truncation points were chosen by evaluating structural information and determining which amino acid residues within the deaminase domains were unlikely to contribute to meaningful secondary structural components and were thus unlikely to affect the functionality of an intact enzyme. We chose six potential truncations regions for six mammalian deaminases (a full table of predicted split regions is included in Table 3, above). Each split region corresponds to homologous regions in each of the listed deaminases based on protein alignment. sDA1 halfases that contain a truncation variant from split region X are referred to as sDA1.X, and sDA2 halfases are similarly named. Tables 4-6 show the exact truncation variants that we have created and evaluated. In addition to exactly reciprocal halfase pairs (in which the sDA1 and sDA2 portions of the BE contain truncation variants of a deaminase perfectly bisected by a defined split site), we also tested split BEs in which the halfases shared overlapping peptide sequences. We reasoned that this“extra” overlap may enable proper folding of the constituent halfases so as to enable functional reconstitution of the deamniase, and also noted that the most functional split yCD pair included a significant overlap in peptide sequence12. Table 4. Exact sDA split sites chosen.
Figure imgf000059_0001
Split sites chosen and examined in this study so far, by deaminase domain. Amino acid positions of each species is given, according to the sequences given at the end of this document.
Table 5. rAPOBEC1 sDA BE combination pairs examined
Figure imgf000059_0002
Table 6. hAPOBEC3A sDA BE combination pairs examined
Figure imgf000059_0003
Several split BE halfase combinations showed activity when targeted to adjacent DNA sequences in a human HEK293 cell line in which the EGFP reporter gene has been integrated. Each rAPOBEC1 pair was tested in two different orientations with regards to the ZF and gRNA binding sites, with two different ZF domains and two different gRNAs for 4 total orientation pairs. Only directly reciprocal hAPOBEC3A pairs were tested (e.g. sDA1.1 with sDA2.1). Activity of each BE halfase pair when co-delivered by plasmid transfection with an approximate ratio of 1:1 for each halfase is shown in Figures 4-16 (Figure 17 is a positive BE3 control for comparison) for each orientation of rAPO1 sDA pairs and Figure 20 for hA3A pairs. A summary of the cumulative editing efficiencies (the sum of the editing rates at the cytosines within the gRNA editing window) of all rAPO1 halfase pairs in each orientation is given in Figure 21. The target site configurations for and all DNA targeting proteins used for rAPO1 experiments is shown in Figure 22. All rAPO1 split BEs shown include an sDA1 halfase with an sDA1-3AC3L-NLS-ZF
configuration, while all hA3A split BEs include an sDA1 with an sDA1-NLS-ZF configuration. In particular, and in various orientations, rAPO1 sDA1.1 + rAPO1 sDA2.1, rAPO1 sDA1.2 + rAPO1 sDA2.1, rAPO1 sDA1.2 + rAPO1 sDA2.2, hA3A sDA1.1 + sDA2.1, and hA3A 1.6 + hA3A 2.6 show significant activity compared to a positive BE3 control (Figures 4, 6, 7, 20, and 21).
It is conceivable and likely that optimizations of several parameters - including the nature of the protein linker between the sDA components and the targeting domains, the spacing between the sDA1 and sDA2 binding sites, the exact sites at which the sDAs are split, the relative concentrations of the sDA components, the source deaminase, the source of the nCas9 targeting mechanism, and the type of targeting domain used for the sDA1 component– could influence, change, or enhance the nature of a split BE platform. Furthermore, it is likely that split base editor pairs that do not include an sDA2 fused to an nCas9-UGI domain as in previously described base editors will still retain some limited mutagentic capacity so long as their DNA targeting proteins are brought to adjacent sequences of DNA, since the reconstituted deaminase domain will still be active around such target sites.
Importantly, none of the individual rAPO1 halfases are active on their own, suggesting a requirement for both halfases for genuine reconstitution of the functional deaminase domain (Figures 18 and 19). Furthermore, the fact that functional combinations seem to prefer certain orientations over others (for instance, rAPO1 sDA1.1 + rAPO1 sDA2.1 is mostly functional in one of the orientations tested) suggests that the deaminase domains genuinely require adjacent binding of their DNA-targeting domains to function, making it unlikely that the deaminase domain can become reconstituted at other sites in the genome and thus unlikely to cause spurious genomic deamination. References
1. Komor, Alexis C., Yongjoo B. Kim, Michael S. Packer, John A. Zuris, and David R. Liu. "Programmable Editing of a Target Base in Genomic DNA without Double-stranded DNA Cleavage." Nature 533.7603 (2016): 420-24. 2. Yang, Luhan, Adrian W. Briggs, Wei Leong Chew, Prashant Mali, Marc Guell, John Aach, Daniel Bryan Goodman, David Cox, Yinan Kan, Emal Lesha, Venkataramanan Soundararajan, Feng Zhang, and George Church. "Engineering and Optimising Deaminase Fusions for Genome Editing." Nature Communications 7 (2016): 13330.
3. Jasin, Maria, and Rodney Rothstein. "Repair of strand breaks by homologous recombination." Cold Spring Harbor perspectives in biology 5.11 (2013): a012740.
4. Harris, Reuben S., Svend K. Petersen-Mahrt, and Michael S. Neuberger.
"RNA Editing Enzyme APOBEC1 and Some of Its Homologs Can Act as DNA Mutators." Molecular Cell 10.5 (2002): 1247-253.
5. Nishida, K., T. Arazoe, N. Yachie, S. Banno, M. Kakimoto, M. Tabata, M.
Mochizuki, A. Miyabe, M. Araki, K. Y. Hara, Z. Shimatani, and A. Kondo. "Targeted Nucleotide Editing Using Hybrid Prokaryotic and Vertebrate Adaptive Immune Systems." Science 353.6305 (2016).
6. Santos-Pereira, José M., and Andrés Aguilera. "R Loops: New Modulators of Genome Dynamics and Function." Nature Reviews Genetics 16.10 (2015): 583-97.
7. Rebhandl, Stefan, Michael Huemer, Richard Greil, and Roland Geisberger.
"AID/APOBEC Deaminases and Cancer." Oncoscience 2 (2015): 320.
8. Suspene, Rodolphe, et al. "Recovery of APOBEC3-edited human
immunodeficiency virus G→ A hypermutants by differential DNA denaturation PCR." Journal of general virology 86.1 (2005): 125-129. 9. Aynaud, Marie-Ming, et al. "Human Tribbles 3 protects nuclear DNA from cytidine deamination by APOBEC3A." Journal of Biological Chemistry 287.46 (2012): 39182-39192.
10. Shinohara, Masanobu, et al. "APOBEC3B can impair genomic stability by inducing base substitutions in genomic DNA in human cells." Scientific reports 2 (2012): 806.
11. Holtz, Colleen M., Holly A. Sadler, and Louis M. Mansky. "APOBEC3G cytosine deamination hotspots are defined by both sequence context and single-stranded DNA secondary structure." Nucleic acids research (2013): gkt246.
12. Ear, Po Hien, and Stephen W. Michnick. "A General Life-death Selection Strategy for Dissecting Protein Functions." Nature Methods 6.11 (2009): 813- 16.
13. Rees, Holly A., et al. "Improving the DNA specificity and applicability of base editing through protein engineering and protein delivery." Nature Communications 8 (2017): ncomms15790.
14. Pattanayak, Vikram, et al.“Revealing off-Target Cleavage Specificities of Zinc-Finger Nucleases by in Vitro Selection.” Nature Methods, vol.8, no.9, July 2011, pp.765–770., doi:10.1038/nmeth.1670.
15. Maeder, Morgan L., et al.“Rapid‘Open-Source’ Engineering of Customized Zinc-Finger Nucleases for Highly Efficient Gene Modification.” Molecular Cell, vol.31, no.2, 2008, pp.294–301., doi:10.1016/j.molcel.2008.06.016. 16. Jason M. Gerhke, Oliver R. Cervantes, M. Kendell Clement, Luca Pinello, J.
Keith Joung,“High-precision CRISPR-Cas9 base editors with minimized bystander and off-target mutations,” bioRxiv 273938; doi:
doi.org/10.1101/273938.
17. CA2915837A1
18. Friedland, Ari E., et al.“Characterization of Staphylococcus Aureus Cas9: a Smaller Cas9 for All-in-One Adeno-Associated Virus Delivery and Paired Nickase Applications.” Genome Biology, vol.16, no.1, 2015,
doi:10.1186/s13059-015-0817-8.
19. Gasiunas, G., et al.“Cas9-CrRNA Ribonucleoprotein Complex Mediates Specific DNA Cleavage for Adaptive Immunity in Bacteria.” Proceedings of the National Academy of Sciences, vol.109, no.39, Apr.2012,
doi:10.1073/pnas.1208507109.
20. Yamada, Mari, et al.“Crystal Structure of the Minimal Cas9 from
Campylobacter Jejuni Reveals the Molecular Diversity in the CRISPR-Cas9 Systems.” Molecular Cell, vol.65, no.6, 2017,
doi:10.1016/j.molcel.2017.02.007.
21. Zetsche, Bernd, et al.“Cpf1 Is a Single RNA-Guided Endonuclease of a Class 2 CRISPR-Cas System.” Cell, vol.163, no.3, 2015, pp.759–771., doi:10.1016/j.cell.2015.09.038.
22. Hirano, H., et al.“Crystal Structure of Francisella Novicida Cas9 RHA in Complex with sgRNA and Target DNA (TGG PAM).” Feb.2016,
doi:10.2210/pdb5b2q/pdb.
23. Yamano, T., et al.“Crystal Structure of Acidaminococcus Sp. Cpf1 in
Complex with CrRNA and Target DNA.” Apr.2016, doi:10.2210/pd
24. Tang, Xu, et al.“A CRISPR–Cpf1 System for Efficient Genome Editing and Transcriptional Repression in Plants.” Nature Plants, vol.3, no.7, 2017, p. 17103., doi:10.1038/nplants.2017.103. OTHER EMBODIMENTS
It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.

Claims

WHAT IS CLAIMED IS: 1. A fusion protein comprising:
(i) a first portion of a split deaminase (sDA1) enzyme fused to a
programmable DNA-binding domain, selected from the group consisting of zinc fingers (ZFs), transcription activator effector-like effectors (TALEs), and Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) Cas RNA-guided nucleases (RGNs), and catalytically inactive Cas9 (dCas9) nicking Cas9 (nCas9), wherein the sDA1 is an N-terminal truncated, catalytically inactive or deficient derivative of a parental deaminase selected from the group consisting of hAID, rAPOBEC1, mAPOBEC3, hAPOBEC3A, hAPOBEC3B, hAPOBEC3C, hAPOBEC3F, hAPOBEC3G, hAPOBEC3H, and variants thereof, and optionally one or more uracil glycosylase inhibitor (UGI) sequences; or
(ii) a second portion of a split deaminase (sDA2) fused to nCas9, and one or more uracil glycosylase inhibitor (UGI) proteins, or any orthogonal DNA targeting domain as the one used for its complementary sDA1 portion, wherein the sDA2 is a C-terminal truncated, catalytically inactive or deficient derivative of hAID, rAPOBEC1*, mAPOBEC3, hAPOBEC3A,
hAPOBEC3B, hAPOBEC3C, hAPOBEC3F, hAPOBEC3G, hAPOBEC3H, and variants thereof;
wherein the co-expression of the fusion protein of (i) with the fusion protein of (ii) in eukaryotic cells and their subsequent co-localization at adjacent genomic target sites provides a catalytically active base editor.
2. A pair of the fusion proteins of claim 1, comprising:
(i) a first fusion protein comprising a first portion of a split deaminase (sDA1) enzyme fused to one or more ZFs, wherein the sDA1 is an N-terminal truncated, catalytically inactive or deficient derivative of a parental deaminase selected from the group consisting of hAID, rAPOBEC1, mAPOBEC3, hAPOBEC3A, hAPOBEC3B, hAPOBEC3C, hAPOBEC3F, hAPOBEC3G, or hAPOBEC3H, and variants thereof that have altered substrate specificities or activities and optionally one or more UGI sequences; and
(ii) a second fusion protein comprising a second portion of a split deaminase (sDA2) fused to an nCas9 protein and one or more UGI proteins, wherein the sDA2 is a C-terminal truncated, catalytically inactive or deficient derivative of the same parental deaminase as SDA1,
wherein the co-expression of the fusion protein of (i) with the fusion protein of (ii) in eukaryotic cells and their subsequent co-localization at adjacent genomic target sites provides a catalytically active base-editor.
3. A nucleic acid encoding a fusion protein of claim 1.
4. A composition comprising one or more nucleic acids, wherein the nucleic acids encode the pair of fusion proteins of claim 2.
5. A method of targeted deamination of one or more selected cytosines in a
nucleic acid, the method comprising contacting the nucleic acid with the pair of fusion proteins of claim 2, and one or more gRNAs that interact with Cas9 domains in the fusion proteins, preferably wherein one of the fusion proteins comprises nCas9, the other fusion protein comprises ZF or TALE, the ZF or TALE is targeted to a sequence of 9-24bp adjacent to the target site of the gRNA for the nCas9, wherein the gRNA binds to the nucleic acid comprising the selected cytosine.
6. The method of claim 5, wherein the nucleic acid is in a cell, and the method comprises contact the cell with the fusion proteins or expressing the fusion proteins in the cell.
7. The method of claim 6, wherein the cell is a eukaryotic cell.
8. A method of improving specificity of targeted deamination in a cell, the
method comprising expressing in the cell, or contacting the cell with, the pair of fusion proteins of claim 2, and one or more gRNAs that interact with Cas9 domains in the fusion proteins, preferably wherein one of the fusion proteins comprises nCas9, the other fusion protein comprises ZF or TALE, the ZF or TALE is targeted to a sequence of 9-24bp adjacent to the target site of the gRNA for the nCas9, wherein the gRNA binds to the nucleic acid comprising the selected cytosine.
9. The method of claims 5-8, wherein the fusion protein is delivered as a ribonucleoprotein (RNP) complex with one or more gRNAs that interact with Cas9 domains in the fusion proteins, mRNA, or plasmid.
10. A method of deaminating one or more selected cytosines in a nucleic acid, the method comprising contacting the nucleic acid with the pair of fusion proteins of claim 2.
11. A composition comprising a purified fusion protein of claim 1, or the pair of fusion proteins of claim 2.
12. The composition of claim 11, comprising one or more ribonucleoprotein
(RNP) complexes.
13. A vector comprising the nucleic acid of claim 3.
14. An isolated host cell comprising the nucleic acid of claim 13.
15. The host cell of claim 14, which is a stem cell.
16. The host cell of claim 15, wherein the stem cell is hematopoietic stem cell.
PCT/US2018/034687 2017-05-25 2018-05-25 Using split deaminases to limit unwanted off-target base editor deamination Ceased WO2018218166A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
CA3063449A CA3063449A1 (en) 2017-05-25 2018-05-25 Using split deaminases to limit unwanted off-target base editor deamination
EP18805050.4A EP3630198A4 (en) 2017-05-25 2018-05-25 USE OF SPLIT DEAMINASES TO LIMIT UNWANTED DIFFERENT BASE EDITOR DEAMINATIONS
CN201880045766.8A CN111093714A (en) 2017-05-25 2018-05-25 Deamination using a split deaminase to restrict unwanted off-target base editors
AU2018273968A AU2018273968A1 (en) 2017-05-25 2018-05-25 Using split deaminases to limit unwanted off-target base editor deamination
US16/615,538 US20200172895A1 (en) 2017-05-25 2018-05-25 Using split deaminases to limit unwanted off-target base editor deamination
JP2019564864A JP2020521451A (en) 2017-05-25 2018-05-25 Use of split deaminase to limit unwanted off-target base editor deamination
JP2023111873A JP2023126956A (en) 2017-05-25 2023-07-07 Use of split deaminase to limit unwanted off-target base editor deamination

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201762511296P 2017-05-25 2017-05-25
US62/511,296 2017-05-25
US201762541544P 2017-08-04 2017-08-04
US62/541,544 2017-08-04
US201862622676P 2018-01-26 2018-01-26
US62/622,676 2018-01-26

Publications (1)

Publication Number Publication Date
WO2018218166A1 true WO2018218166A1 (en) 2018-11-29

Family

ID=64397083

Family Applications (3)

Application Number Title Priority Date Filing Date
PCT/US2018/034742 Ceased WO2018218206A1 (en) 2017-05-25 2018-05-25 Bipartite base editor (bbe) architectures and type-ii-c-cas9 zinc finger editing
PCT/US2018/034719 Ceased WO2018218188A2 (en) 2017-05-25 2018-05-25 Base editors with improved precision and specificity
PCT/US2018/034687 Ceased WO2018218166A1 (en) 2017-05-25 2018-05-25 Using split deaminases to limit unwanted off-target base editor deamination

Family Applications Before (2)

Application Number Title Priority Date Filing Date
PCT/US2018/034742 Ceased WO2018218206A1 (en) 2017-05-25 2018-05-25 Bipartite base editor (bbe) architectures and type-ii-c-cas9 zinc finger editing
PCT/US2018/034719 Ceased WO2018218188A2 (en) 2017-05-25 2018-05-25 Base editors with improved precision and specificity

Country Status (7)

Country Link
US (4) US20200172895A1 (en)
EP (3) EP3630849A4 (en)
JP (5) JP2020521451A (en)
CN (3) CN110959040B (en)
AU (4) AU2018273968A1 (en)
CA (3) CA3063733A1 (en)
WO (3) WO2018218206A1 (en)

Cited By (58)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10465176B2 (en) 2013-12-12 2019-11-05 President And Fellows Of Harvard College Cas variants for gene editing
CN110564752A (en) * 2019-09-30 2019-12-13 北京市农林科学院 Application of differential agent technology in enrichment of C.T base substitution cells
US10508298B2 (en) 2013-08-09 2019-12-17 President And Fellows Of Harvard College Methods for identifying a target site of a CAS9 nuclease
US10597679B2 (en) 2013-09-06 2020-03-24 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US10682410B2 (en) 2013-09-06 2020-06-16 President And Fellows Of Harvard College Delivery system for functional nucleases
US10704062B2 (en) 2014-07-30 2020-07-07 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
WO2020191242A1 (en) * 2019-03-19 2020-09-24 The Broad Institute, Inc. Methods and compositions for editing nucleotide sequences
CN112048497A (en) * 2019-06-06 2020-12-08 中国科学院脑科学与智能技术卓越创新中心 Novel single base editing technology and application thereof
US10858639B2 (en) 2013-09-06 2020-12-08 President And Fellows Of Harvard College CAS9 variants and uses thereof
US10947530B2 (en) 2016-08-03 2021-03-16 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
CN112725348A (en) * 2019-10-28 2021-04-30 安徽省农业科学院水稻研究所 Gene and method for improving single-base editing efficiency of rice and application of gene
US11028429B2 (en) 2015-09-11 2021-06-08 The General Hospital Corporation Full interrogation of nuclease DSBs and sequencing (FIND-seq)
WO2021113611A1 (en) * 2019-12-06 2021-06-10 The General Hospital Corporation Split deaminase base editors
US11046948B2 (en) 2013-08-22 2021-06-29 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
JP2021536229A (en) * 2018-08-23 2021-12-27 サンガモ セラピューティクス, インコーポレイテッド Manipulated target-specific base editor
US11214780B2 (en) 2015-10-23 2022-01-04 President And Fellows Of Harvard College Nucleobase editors and uses thereof
WO2022008466A1 (en) 2020-07-06 2022-01-13 Wageningen Universiteit Base editing tools
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
WO2022050377A1 (en) 2020-09-04 2022-03-10 国立大学法人広島大学 Method for editing target dna, method for producing cell having edited target dna, and dna edition system for use in said methods
US11286468B2 (en) 2017-08-23 2022-03-29 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with altered PAM specificity
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
KR20220053097A (en) * 2020-10-21 2022-04-29 성균관대학교산학협력단 Vector expressing cytosine base editor without off-target effect without reduction of on-target efficiency in industrial strains and uses thereof
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
JP2022526695A (en) * 2019-02-02 2022-05-26 シャンハイテック ユニバーシティ Inhibition of unintentional mutations in gene editing
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
WO2023122722A1 (en) * 2021-12-22 2023-06-29 Sangamo Therapeutics, Inc. Novel zinc finger fusion proteins for nucleobase editing
EP4031190A4 (en) * 2019-09-17 2023-08-09 Rutgers, the State University of New Jersey Highly efficient dna base editors mediated by rna-aptamer recruitment for targeted genome modification and uses thereof
US11725228B2 (en) 2017-10-11 2023-08-15 The General Hospital Corporation Methods for detecting site-specific and spurious genomic deamination induced by base editing technologies
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
US11845987B2 (en) 2018-04-17 2023-12-19 The General Hospital Corporation Highly sensitive in vitro assays to define substrate preferences and sites of nucleic acid cleaving agents
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
EP4093879A4 (en) * 2020-01-25 2024-02-28 The Trustees of the University of Pennsylvania Compositions for small molecule control of precise base editing of target nucleic acids and methods of use thereof
EP4103705A4 (en) * 2020-02-14 2024-02-28 Ohio State Innovation Foundation NUCLEOBASE EDITORS AND METHODS OF USE THEREOF
US11946040B2 (en) 2019-02-04 2024-04-02 The General Hospital Corporation Adenine DNA base editor variants with reduced off-target RNA editing
US12006520B2 (en) 2011-07-22 2024-06-11 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US12031129B2 (en) 2018-08-28 2024-07-09 Flagship Pioneering Innovations Vi, Llc Methods and compositions for modulating a genome
US12037602B2 (en) 2020-03-04 2024-07-16 Flagship Pioneering Innovations Vi, Llc Methods and compositions for modulating a genome
US12065666B2 (en) 2017-01-05 2024-08-20 Rutgers, The State University Of New Jersey Targeted gene editing platform independent of DNA double strand break and uses thereof
US12104207B2 (en) 2014-06-23 2024-10-01 The General Hospital Corporation Genomewide unbiased identification of DSBs evaluated by sequencing (GUIDE-Seq)
WO2024226156A1 (en) * 2023-04-27 2024-10-31 University Of Massachusetts Cas-embedded cytidine deaminase ribonucleoprotein complexes having improved base editing specificity and efficiency
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
US12188043B2 (en) 2015-07-15 2025-01-07 Rutgers, The State University Of New Jersey Nuclease-independent targeted gene editing platform and uses thereof
US20250011748A1 (en) * 2020-01-28 2025-01-09 The Broad Institute, Inc. Base editors, compositions, and methods for modifying the mitochondrial genome
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
US12319938B2 (en) 2020-07-24 2025-06-03 The General Hospital Corporation Enhanced virus-like particles and methods of use thereof for delivery to cells
US12351814B2 (en) 2019-06-13 2025-07-08 The General Hospital Corporation Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof

Families Citing this family (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3630849A4 (en) 2017-05-25 2021-01-13 The General Hospital Corporation ARCHITECTURES OF TWO-PART BASE EDITOR (BBE) AND TYPE II-C-CAS9-ZINKFINGER-EDITING
US11884947B2 (en) * 2018-02-23 2024-01-30 Shanghaitech University Fusion proteins for base editing
AU2019265019B2 (en) 2018-05-11 2025-11-06 Beam Therapeutics Inc. Methods of substituting pathogenic amino acids using programmable base editor systems
WO2020051562A2 (en) 2018-09-07 2020-03-12 Beam Therapeutics Inc. Compositions and methods for improving base editing
EP3847254A4 (en) 2018-09-07 2022-08-10 Beam Therapeutics Inc. Compositions and methods for delivering a nucleobase editing system
WO2020160517A1 (en) * 2019-01-31 2020-08-06 Beam Therapeutics Inc. Nucleobase editors having reduced off-target deamination and methods of using same to modify a nucleobase target sequence
AU2020215730A1 (en) 2019-01-31 2021-07-29 Beam Therapeutics Inc. Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors
CN120174005A (en) 2019-02-13 2025-06-20 比姆医疗股份有限公司 Modified immune cells with adenosine deaminase base editors for modifying nucleobases in target sequences
CN110804628B (en) * 2019-02-28 2023-05-12 中国科学院脑科学与智能技术卓越创新中心 High-specificity off-target-free single-base gene editing tool
WO2021030344A1 (en) * 2019-08-12 2021-02-18 Lifeedit, Inc. Rna-guided nucleases and active fragments and variants thereof and methods of use
WO2021046155A1 (en) 2019-09-03 2021-03-11 Voyager Therapeutics, Inc. Vectorized editing of nucleic acids to correct overt mutations
EP4034138A4 (en) 2019-09-27 2024-07-31 Beam Therapeutics, Inc. COMPOSITIONS AND METHODS FOR TREATING BLOOD CANCER
WO2021155166A1 (en) * 2020-01-31 2021-08-05 University Of Massachusetts A cas9-pdbd base editor platform with improved targeting range and specificity
WO2021163587A1 (en) * 2020-02-13 2021-08-19 Beam Therapeutics Inc. Compositions and methods for engraftment of base edited cells
BR112022017704A2 (en) * 2020-03-04 2022-11-01 Suzhou Qi Biodesign Biotechnology Company Ltd MULTIPLEX GENOME EDITING METHOD AND SYSTEM
JP2023517890A (en) * 2020-03-04 2023-04-27 スージョウ チー バイオデザイン バイオテクノロジー カンパニー リミテッド Improved cytosine base editing system
CN116134141A (en) * 2020-09-04 2023-05-16 国立大学法人神户大学 Complex for double-stranded DNA modification comprising miniaturized cytidine deaminase
CN116261594A (en) * 2020-09-25 2023-06-13 桑格摩生物治疗股份有限公司 Zinc finger fusion proteins for nucleobase editing
CA3196831A1 (en) 2020-09-25 2022-03-31 Beam Therapeutics Inc. Fratricide resistant modified immune cells and methods of using the same
US12123006B2 (en) * 2021-05-18 2024-10-22 Shanghaitech University Base editing tool and use thereof
US20240327859A1 (en) * 2021-07-02 2024-10-03 University Of Maryland, College Park Cytidine deaminases and methods of genome editing using the same
CN113774085B (en) * 2021-08-20 2023-08-15 中国科学院广州生物医药与健康研究院 Single base editing tool TaC9-ABE and application thereof
WO2023050169A1 (en) * 2021-09-29 2023-04-06 深圳先进技术研究院 Method for achieving tag-to-taa conversion on genome with high throughput
CN116355885A (en) * 2021-12-28 2023-06-30 复旦大学 Deaminase mutants and base editors based on deaminase mutants
CN119013310A (en) * 2022-02-17 2024-11-22 正序(上海)生物科技有限公司 Mutant cytosine deaminase with improved editing accuracy
JP2023131616A (en) * 2022-03-09 2023-09-22 国立大学法人広島大学 DNA editing system, method for editing target DNA using the same, and method for producing cells with edited target DNA
CN114774399B (en) * 2022-03-25 2024-01-30 武汉大学 Method for artificially modifying single-base resolution positioning analysis of 5-hydroxymethylcytosine modification in deaminase-assisted DNA
CN114686456B (en) * 2022-05-10 2023-02-17 中山大学 Base editing system based on bimolecular deaminase complementation and application thereof
US20250304940A1 (en) * 2022-05-13 2025-10-02 Huidagene Therapeutics (Singapore) Pte. Ltd. Programmable adenine base editor and uses thereof
CN117384885B (en) 2022-12-15 2025-06-10 中国科学院遗传与发育生物学研究所 Base editor and application thereof
JP2026501648A (en) * 2022-12-30 2026-01-16 北京大学 Base editor systems and methods of use thereof
CN117659210A (en) * 2023-11-30 2024-03-08 华南农业大学 A recombinant fusion protein used as a plant double base editor and its application
WO2025213929A1 (en) * 2024-04-11 2025-10-16 上海交通大学医学院附属松江医院 Engineered cytosine deaminase, preparation method therefor and use thereof
CN119912582B (en) * 2024-06-17 2025-11-04 中国农业大学 Single base editor, deaminase used by same and application of deaminase
CN119431603B (en) * 2024-10-09 2026-02-17 中山大学 A fusion protein and its applications
CN119505015B (en) * 2024-11-15 2025-10-17 北京大学 Fusion protein and application method thereof

Citations (78)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6007988A (en) 1994-08-20 1999-12-28 Medical Research Council Binding proteins for recognition of DNA
US6294330B1 (en) * 1997-01-31 2001-09-25 Odyssey Pharmaceuticals Inc. Protein fragment complementation assays for the detection of biological or drug interactions
US20020160940A1 (en) 1999-01-12 2002-10-31 Case Casey C. Modulation of endogenous gene expression in cells
US6503717B2 (en) 1999-12-06 2003-01-07 Sangamo Biosciences, Inc. Methods of using randomized libraries of zinc finger proteins for the identification of gene function
US6511808B2 (en) 2000-04-28 2003-01-28 Sangamo Biosciences, Inc. Methods for designing exogenous regulatory molecules
WO2004099366A2 (en) 2002-10-23 2004-11-18 The General Hospital Corporation Context sensitive parallel optimization of zinc finger dna binding domains
WO2008108989A2 (en) 2007-03-02 2008-09-12 Danisco A/S Cultures with improved phage resistance
US20100076057A1 (en) 2008-09-23 2010-03-25 Northwestern University TARGET DNA INTERFERENCE WITH crRNA
WO2010054108A2 (en) 2008-11-06 2010-05-14 University Of Georgia Research Foundation, Inc. Cas6 polypeptides and methods of use
WO2011017293A2 (en) 2009-08-03 2011-02-10 The General Hospital Corporation Engineering of zinc finger arrays by context-dependent assembly
US20110104787A1 (en) * 2009-11-05 2011-05-05 President And Fellows Of Harvard College Fusion Peptides That Bind to and Modify Target Nucleic Acid Sequences
US20110189776A1 (en) 2008-07-25 2011-08-04 University Of Georgia Research Foundation, Inc. PROKARYOTIC RNAi-LIKE SYSTEM AND METHODS OF USE
US20110223638A1 (en) 2010-03-10 2011-09-15 Blake Wiedenheft Methods of Generating Nucleic Acid Fragments
US20110236530A1 (en) 2008-12-12 2011-09-29 Danisco A/S Genetic Cluster of Strains of Streptococcus Thermophilus Having Unique Rheological Properties for Dairy Fermentation
US20110300538A1 (en) 2008-11-07 2011-12-08 Danisco A/S Bifidobacteria crispr sequences
US20120088676A1 (en) 2007-12-28 2012-04-12 Institut Pasteur Molecular typing and subtyping of salmonella by identification of the variable nucleotide sequences of the crispr loci
WO2012164565A1 (en) 2011-06-01 2012-12-06 Yeda Research And Development Co. Ltd. Compositions and methods for downregulating prokaryotic genes
US20130130248A1 (en) 2010-05-10 2013-05-23 The Regents Of The University Of California Endoribonuclease compositions and methods of use thereof
WO2013098244A1 (en) 2011-12-30 2013-07-04 Wageningen Universiteit Modified cascade ribonucleoproteins and uses thereof
US20130288251A1 (en) 2010-10-20 2013-10-31 Dupont Nutrition Biosciences Aps Lactococcus crispr-cas sequences
WO2013176772A1 (en) 2012-05-25 2013-11-28 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US20130330778A1 (en) 2012-06-11 2013-12-12 Agilent Technologies, Inc. Method of adaptor-dimer subtraction using a crispr cas6 protein
WO2014004288A1 (en) 2012-06-27 2014-01-03 J2 Global, Inc. Facilitating network login
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
WO2014089290A1 (en) 2012-12-06 2014-06-12 Sigma-Aldrich Co. Llc Crispr-based genome modification and regulation
WO2014099744A1 (en) 2012-12-17 2014-06-26 President And Fellows Of Harvard College Rna-guided human genome engineering
US20140179006A1 (en) 2012-12-12 2014-06-26 Massachusetts Institute Of Technology Crispr-cas component systems, methods and compositions for sequence manipulation
US20140179770A1 (en) 2012-12-12 2014-06-26 Massachusetts Institute Of Technology Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
US20140186958A1 (en) 2012-12-12 2014-07-03 Feng Zhang Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
US20140186919A1 (en) 2012-12-12 2014-07-03 Feng Zhang Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US20140186843A1 (en) 2012-12-12 2014-07-03 Massachusetts Institute Of Technology Methods, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof
US20140201857A1 (en) 2013-01-14 2014-07-17 Recombinetics, Inc. Hornless livestock
US20140199767A1 (en) 2005-08-26 2014-07-17 Dupont Nutrition Biosciences Aps Use
US20140212869A1 (en) 2013-01-25 2014-07-31 Agilent Technologies, Inc. Nucleic Acid Proximity Assay Involving the Formation of a Three-way junction
US20140234972A1 (en) 2012-12-12 2014-08-21 Massachusetts Institute Of Technology CRISPR-CAS Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes
US20140242664A1 (en) 2012-12-12 2014-08-28 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US20140242702A1 (en) 2013-02-25 2014-08-28 Sigma Aldrich Co. Llc Methods and compositions for enhancing nuclease-mediated gene disruption
US20140273230A1 (en) 2013-03-15 2014-09-18 Sigma-Aldrich Co., Llc Crispr-based genome modification and regulation
WO2014144592A2 (en) 2013-03-15 2014-09-18 The General Hospital Corporation Using truncated guide rnas (tru-grnas) to increase specificity for rna-guided genome editing
US20140273235A1 (en) 2013-03-15 2014-09-18 Regents Of The University Of Minnesota ENGINEERING PLANT GENOMES USING CRISPR/Cas SYSTEMS
US20140273226A1 (en) 2013-03-15 2014-09-18 System Biosciences, Llc Crispr/cas systems for genomic modification and gene modulation
US20140287938A1 (en) 2013-03-15 2014-09-25 The Broad Institute, Inc. Recombinant virus and preparations thereof
US20140298547A1 (en) 2012-12-13 2014-10-02 Dow Agrosciences Llc Dna detection methods for site specific nuclease activity
US20140304853A1 (en) 2013-04-05 2014-10-09 Sangamo Biosciences, Inc. Methods and compositions for integration of an exogenous sequence within the genome of plants
US20140310828A1 (en) 2013-04-16 2014-10-16 Regeneron Pharmaceuticals, Inc. Targeted modification of rat genome
US20140315985A1 (en) 2013-03-14 2014-10-23 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US20140335063A1 (en) 2013-05-10 2014-11-13 Sangamo Biosciences, Inc. Delivery methods and compositions for nuclease-mediated genome engineering
US20140349400A1 (en) 2013-03-15 2014-11-27 Massachusetts Institute Of Technology Programmable Modification of DNA
US20140357530A1 (en) 2012-12-12 2014-12-04 The Broad Institute Inc. Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof
US20140356867A1 (en) 2013-05-29 2014-12-04 Agilent Technologies, Inc. Nucleic acid enrichment using cas9
WO2014204578A1 (en) 2013-06-21 2014-12-24 The General Hospital Corporation Using rna-guided foki nucleases (rfns) to increase specificity for rna-guided genome editing
CA2915837A1 (en) 2013-06-17 2014-12-24 The Broad Institute, Inc. Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation
US20140377868A1 (en) 2013-03-15 2014-12-25 The General Hospital Corporation Rna-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci
US20150024500A1 (en) 2013-07-19 2015-01-22 Larix Bioscience, Llc Methods and compositions for producing double allele knock outs
US20150044772A1 (en) 2013-08-09 2015-02-12 Sage Labs, Inc. Crispr/cas system-based novel fusion protein and its applications in genome editing
US20150045546A1 (en) 2012-03-20 2015-02-12 Vilnius University RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX
US20150056629A1 (en) 2013-04-14 2015-02-26 Katriona Guthrie-Honea Compositions, systems, and methods for detecting a DNA sequence
US20150067922A1 (en) 2013-05-30 2015-03-05 The Penn State Research Foundation Gene targeting and genetic modification of plants via rna-guided genome editing
US20150071899A1 (en) 2013-09-06 2015-03-12 President And Fellows Of Harvard College Cas9-foki fusion proteins and uses thereof
US20150159174A1 (en) 2013-12-11 2015-06-11 Regeneron Pharmaceutical, Inc. Methods and Compositions for the Targeted Modification of a Genome
US20150166969A1 (en) 2012-02-24 2015-06-18 Fred Hutchinson Cancer Research Center Compositions and methods for the treatment of hemoglobinopathies
US20150176064A1 (en) 2012-06-14 2015-06-25 Agence Nationale de Securite Sanitaire de I'Alimentation, de I'Environnement et du Travail Method for Detecting and Identifying Enterohemorrhagic Escherichia coli
US20150174169A1 (en) * 2013-10-17 2015-06-25 Sangamo Biosciences, Inc. Delivery methods and compositions for nuclease-mediated genome engineering in hematopoietic stem cells
WO2015099850A1 (en) 2013-12-26 2015-07-02 The General Hospital Corporation Multiplex guide rnas
US20150191744A1 (en) 2013-12-17 2015-07-09 University Of Massachusetts Cas9 effector-mediated regulation of transcription, differentiation and gene editing/labeling
US20150232883A1 (en) 2013-12-12 2015-08-20 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components
US20150252358A1 (en) 2014-03-10 2015-09-10 Editas Medicine, Inc. Crispr/cas-related methods and compositions for treating leber's congenital amaurosis 10 (lca10)
US20150315576A1 (en) 2012-11-01 2015-11-05 Massachusetts Institute Of Technology Genetic device for the controlled destruction of dna
US20150356239A1 (en) 2012-12-12 2015-12-10 The Broad Institute Inc. Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof
US20150376652A1 (en) 2013-02-27 2015-12-31 Helmholtz Zentrum München Deutsches Forschungszentrum Für Gesundheit Und Umwelt Gene editing in the oocyte by cas9 nucleases
US20160017301A1 (en) 2013-08-29 2016-01-21 Temple University Of The Commonwealth System Of Higher Education Methods and compositions for rna-guided treatment of hiv infection
US20160024510A1 (en) 2013-02-07 2016-01-28 The Rockefeller University Sequence specific antimicrobials
US20160024529A1 (en) 2013-03-09 2016-01-28 Agilent Technologies, Inc. Methods of in vivo engineering of large sequences using multiple crispr/cas selections of recombineering events
WO2016028682A1 (en) * 2014-08-17 2016-02-25 The Broad Institute Inc. Genome editing using cas9 nickases
WO2016112242A1 (en) * 2015-01-08 2016-07-14 President And Fellows Of Harvard College Split cas9 proteins
WO2016141224A1 (en) 2015-03-03 2016-09-09 The General Hospital Corporation Engineered crispr-cas9 nucleases with altered pam specificity
WO2017040348A1 (en) 2015-08-28 2017-03-09 The General Hospital Corporation Engineered crispr-cas9 nucleases
WO2018035387A1 (en) * 2016-08-17 2018-02-22 The Broad Institute, Inc. Novel crispr enzymes and systems

Family Cites Families (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2059122B1 (en) 2006-08-28 2012-06-20 University of Rochester Methods and compositions related to apobec-1 expression
WO2010132092A2 (en) * 2009-05-12 2010-11-18 The Scripps Research Institute Cytidine deaminase fusions and related methods
US9526784B2 (en) * 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
US10190106B2 (en) * 2014-12-22 2019-01-29 Univesity Of Massachusetts Cas9-DNA targeting unit chimeras
EP3237017A4 (en) * 2014-12-24 2018-08-01 Dana-Farber Cancer Institute, Inc. Systems and methods for genome modification and regulation
US20180291372A1 (en) * 2015-05-14 2018-10-11 Massachusetts Institute Of Technology Self-targeting genome editing system
JP7044373B2 (en) * 2015-07-15 2022-03-30 ラトガース,ザ ステート ユニバーシティ オブ ニュージャージー Nuclease-independent targeted gene editing platform and its uses
US9926546B2 (en) 2015-08-28 2018-03-27 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
IL310721B2 (en) * 2015-10-23 2025-11-01 Harvard College Nucleobase editors and their uses
WO2017173092A1 (en) * 2016-03-31 2017-10-05 The Regents Of The University Of California Methods for genome editing in zygotes
AU2017257274B2 (en) * 2016-04-19 2023-07-13 Massachusetts Institute Of Technology Novel CRISPR enzymes and systems
CN110214183A (en) 2016-08-03 2019-09-06 哈佛大学的校长及成员们 Adenosine nucleobase editing machine and application thereof
US11542496B2 (en) * 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
KR20240116572A (en) 2017-03-23 2024-07-29 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 Nucleobase editors comprising nucleic acid programmable dna binding proteins
US11591589B2 (en) 2017-04-21 2023-02-28 The General Hospital Corporation Variants of Cpf1 (Cas12a) with altered PAM specificity
EP3630849A4 (en) 2017-05-25 2021-01-13 The General Hospital Corporation ARCHITECTURES OF TWO-PART BASE EDITOR (BBE) AND TYPE II-C-CAS9-ZINKFINGER-EDITING
CA3073448A1 (en) 2017-08-23 2019-02-28 The General Hospital Corporation Engineered crispr-cas9 nucleases with altered pam specificity
US20210395730A1 (en) 2018-10-10 2021-12-23 The General Hospital Corporation Selective Curbing of Unwanted RNA Editing (SECURE) DNA Base Editor Variants
US11946040B2 (en) 2019-02-04 2024-04-02 The General Hospital Corporation Adenine DNA base editor variants with reduced off-target RNA editing
WO2021042062A2 (en) 2019-08-30 2021-03-04 Joung J Keith Combinatorial adenine and cytosine dna base editors
US20220411777A1 (en) 2019-08-30 2022-12-29 The General Hospital Corporation C-to-G Transversion DNA Base Editors
US20230024833A1 (en) 2019-12-06 2023-01-26 The General Hospital Corporation Split deaminase base editors

Patent Citations (120)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6013453A (en) 1994-08-20 2000-01-11 Medical Research Council Binding proteins for recognition of DNA
US6007988A (en) 1994-08-20 1999-12-28 Medical Research Council Binding proteins for recognition of DNA
US6294330B1 (en) * 1997-01-31 2001-09-25 Odyssey Pharmaceuticals Inc. Protein fragment complementation assays for the detection of biological or drug interactions
US20020160940A1 (en) 1999-01-12 2002-10-31 Case Casey C. Modulation of endogenous gene expression in cells
US6503717B2 (en) 1999-12-06 2003-01-07 Sangamo Biosciences, Inc. Methods of using randomized libraries of zinc finger proteins for the identification of gene function
US6511808B2 (en) 2000-04-28 2003-01-28 Sangamo Biosciences, Inc. Methods for designing exogenous regulatory molecules
WO2004099366A2 (en) 2002-10-23 2004-11-18 The General Hospital Corporation Context sensitive parallel optimization of zinc finger dna binding domains
US20140199767A1 (en) 2005-08-26 2014-07-17 Dupont Nutrition Biosciences Aps Use
US20110002889A1 (en) 2007-03-02 2011-01-06 Rodolphe Barrangou Cultures with Improved Phage Resistance
WO2008108989A2 (en) 2007-03-02 2008-09-12 Danisco A/S Cultures with improved phage resistance
US20150093473A1 (en) 2007-03-02 2015-04-02 Dupont Nutrition Biosciences Aps Cultures with improved phage resistance
US20120088676A1 (en) 2007-12-28 2012-04-12 Institut Pasteur Molecular typing and subtyping of salmonella by identification of the variable nucleotide sequences of the crispr loci
US20140093941A1 (en) 2008-07-25 2014-04-03 University Of Georgia Research Foundation, Inc. PROKARYOTIC RNAi-LIKE SYSTEM AND METHODS OF USE
US20110189776A1 (en) 2008-07-25 2011-08-04 University Of Georgia Research Foundation, Inc. PROKARYOTIC RNAi-LIKE SYSTEM AND METHODS OF USE
US20100076057A1 (en) 2008-09-23 2010-03-25 Northwestern University TARGET DNA INTERFERENCE WITH crRNA
WO2010054108A2 (en) 2008-11-06 2010-05-14 University Of Georgia Research Foundation, Inc. Cas6 polypeptides and methods of use
US20110217739A1 (en) 2008-11-06 2011-09-08 University Of Georgia Research Foundation, Inc. Cas6 polypeptides and methods of use
US20110300538A1 (en) 2008-11-07 2011-12-08 Danisco A/S Bifidobacteria crispr sequences
US20110236530A1 (en) 2008-12-12 2011-09-29 Danisco A/S Genetic Cluster of Strains of Streptococcus Thermophilus Having Unique Rheological Properties for Dairy Fermentation
US20140271987A1 (en) 2008-12-12 2014-09-18 Dupont Nutrition Bioscienses APS Genetic Cluster of Strains of Streptococcus Thermophilus Having Unique Rheological Properties for Dairy Fermentation
WO2011017293A2 (en) 2009-08-03 2011-02-10 The General Hospital Corporation Engineering of zinc finger arrays by context-dependent assembly
US20110104787A1 (en) * 2009-11-05 2011-05-05 President And Fellows Of Harvard College Fusion Peptides That Bind to and Modify Target Nucleic Acid Sequences
US20110223638A1 (en) 2010-03-10 2011-09-15 Blake Wiedenheft Methods of Generating Nucleic Acid Fragments
US20130130248A1 (en) 2010-05-10 2013-05-23 The Regents Of The University Of California Endoribonuclease compositions and methods of use thereof
US20130288251A1 (en) 2010-10-20 2013-10-31 Dupont Nutrition Biosciences Aps Lactococcus crispr-cas sequences
WO2012164565A1 (en) 2011-06-01 2012-12-06 Yeda Research And Development Co. Ltd. Compositions and methods for downregulating prokaryotic genes
US20140113376A1 (en) 2011-06-01 2014-04-24 Rotem Sorek Compositions and methods for downregulating prokaryotic genes
WO2013098244A1 (en) 2011-12-30 2013-07-04 Wageningen Universiteit Modified cascade ribonucleoproteins and uses thereof
US20150024499A1 (en) 2011-12-30 2015-01-22 Wageningen Universiteit Modified cascade ribonucleoproteins and uses thereof
US20140294773A1 (en) 2011-12-30 2014-10-02 Wageningen Universiteit Modified cascade ribonucleoproteins and uses thereof
US20150166969A1 (en) 2012-02-24 2015-06-18 Fred Hutchinson Cancer Research Center Compositions and methods for the treatment of hemoglobinopathies
US20150050699A1 (en) 2012-03-20 2015-02-19 Vilnius University RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX
US20150045546A1 (en) 2012-03-20 2015-02-12 Vilnius University RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX
WO2013176772A1 (en) 2012-05-25 2013-11-28 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US20130330778A1 (en) 2012-06-11 2013-12-12 Agilent Technologies, Inc. Method of adaptor-dimer subtraction using a crispr cas6 protein
US20150176064A1 (en) 2012-06-14 2015-06-25 Agence Nationale de Securite Sanitaire de I'Alimentation, de I'Environnement et du Travail Method for Detecting and Identifying Enterohemorrhagic Escherichia coli
WO2014004288A1 (en) 2012-06-27 2014-01-03 J2 Global, Inc. Facilitating network login
US20150315576A1 (en) 2012-11-01 2015-11-05 Massachusetts Institute Of Technology Genetic device for the controlled destruction of dna
US20160017366A1 (en) 2012-12-06 2016-01-21 Sigma-Aldrich Co. Llc Crispr-based genome modification and regulation
WO2014089290A1 (en) 2012-12-06 2014-06-12 Sigma-Aldrich Co. Llc Crispr-based genome modification and regulation
US20140186843A1 (en) 2012-12-12 2014-07-03 Massachusetts Institute Of Technology Methods, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof
US20150203872A1 (en) 2012-12-12 2015-07-23 The Broad Institute Inc. Crispr-cas systems and methods for altering expression of gene products
US20140234972A1 (en) 2012-12-12 2014-08-21 Massachusetts Institute Of Technology CRISPR-CAS Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes
US20140242664A1 (en) 2012-12-12 2014-08-28 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US20150291965A1 (en) 2012-12-12 2015-10-15 The Broad Institute, Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
US20140242700A1 (en) 2012-12-12 2014-08-28 Massachusetts Institute Of Technology Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US20140242699A1 (en) 2012-12-12 2014-08-28 Massachusetts Institute Of Technology Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
US20140248702A1 (en) 2012-12-12 2014-09-04 The Broad Institute, Inc. CRISPR-Cas Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes
US20140256046A1 (en) 2012-12-12 2014-09-11 Massachusetts Institute Of Technology Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
US20140273234A1 (en) 2012-12-12 2014-09-18 The Board Institute, Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US20140273232A1 (en) 2012-12-12 2014-09-18 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US20150247150A1 (en) 2012-12-12 2015-09-03 The Broad Institute Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US20150356239A1 (en) 2012-12-12 2015-12-10 The Broad Institute Inc. Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof
US20140273231A1 (en) 2012-12-12 2014-09-18 The Broad Institute, Inc. Crispr-cas component systems, methods and compositions for sequence manipulation
US20150232882A1 (en) 2012-12-12 2015-08-20 The Broad Institute Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US20140227787A1 (en) 2012-12-12 2014-08-14 The Broad Institute, Inc. Crispr-cas systems and methods for altering expression of gene products
US20150184139A1 (en) 2012-12-12 2015-07-02 The Broad Institute Inc. Crispr-cas systems and methods for altering expression of gene products
US20140189896A1 (en) 2012-12-12 2014-07-03 Feng Zhang Crispr-cas component systems, methods and compositions for sequence manipulation
US20140357530A1 (en) 2012-12-12 2014-12-04 The Broad Institute Inc. Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof
US20140186919A1 (en) 2012-12-12 2014-07-03 Feng Zhang Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US20140186958A1 (en) 2012-12-12 2014-07-03 Feng Zhang Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
US20140179770A1 (en) 2012-12-12 2014-06-26 Massachusetts Institute Of Technology Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
US8993233B2 (en) 2012-12-12 2015-03-31 The Broad Institute Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
US20150020223A1 (en) 2012-12-12 2015-01-15 The Broad Institute Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
US20150079681A1 (en) 2012-12-12 2015-03-19 The Broad Institute Inc. Crispr-cas component systems, methods and compositions for sequence manipulation
US20140310830A1 (en) 2012-12-12 2014-10-16 Feng Zhang CRISPR-Cas Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes
US20140179006A1 (en) 2012-12-12 2014-06-26 Massachusetts Institute Of Technology Crispr-cas component systems, methods and compositions for sequence manipulation
US20140170753A1 (en) 2012-12-12 2014-06-19 Massachusetts Institute Of Technology Crispr-cas systems and methods for altering expression of gene products
US20150031134A1 (en) 2012-12-12 2015-01-29 The Broad Institute Inc. Crispr-cas component systems, methods and compositions for sequence manipulation
US20140335620A1 (en) 2012-12-12 2014-11-13 The Broad Institute, Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US20140298547A1 (en) 2012-12-13 2014-10-02 Dow Agrosciences Llc Dna detection methods for site specific nuclease activity
US9023649B2 (en) 2012-12-17 2015-05-05 President And Fellows Of Harvard College RNA-guided human genome engineering
WO2014099744A1 (en) 2012-12-17 2014-06-26 President And Fellows Of Harvard College Rna-guided human genome engineering
US20140201857A1 (en) 2013-01-14 2014-07-17 Recombinetics, Inc. Hornless livestock
US20140212869A1 (en) 2013-01-25 2014-07-31 Agilent Technologies, Inc. Nucleic Acid Proximity Assay Involving the Formation of a Three-way junction
US20160024510A1 (en) 2013-02-07 2016-01-28 The Rockefeller University Sequence specific antimicrobials
US20140242702A1 (en) 2013-02-25 2014-08-28 Sigma Aldrich Co. Llc Methods and compositions for enhancing nuclease-mediated gene disruption
US20150376652A1 (en) 2013-02-27 2015-12-31 Helmholtz Zentrum München Deutsches Forschungszentrum Für Gesundheit Und Umwelt Gene editing in the oocyte by cas9 nucleases
US20160024529A1 (en) 2013-03-09 2016-01-28 Agilent Technologies, Inc. Methods of in vivo engineering of large sequences using multiple crispr/cas selections of recombineering events
US20140315985A1 (en) 2013-03-14 2014-10-23 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
US20140273037A1 (en) 2013-03-15 2014-09-18 System Biosciences, Llc Compositions and methods directed to crispr/cas genomic engineering systems
US20150167000A1 (en) 2013-03-15 2015-06-18 Regents Of The University Of Minnesota ENGINEERING PLANT GENOMES USING CRISPR/Cas SYSTEMS
US20140273230A1 (en) 2013-03-15 2014-09-18 Sigma-Aldrich Co., Llc Crispr-based genome modification and regulation
WO2014144592A2 (en) 2013-03-15 2014-09-18 The General Hospital Corporation Using truncated guide rnas (tru-grnas) to increase specificity for rna-guided genome editing
US20140349400A1 (en) 2013-03-15 2014-11-27 Massachusetts Institute Of Technology Programmable Modification of DNA
US20140273235A1 (en) 2013-03-15 2014-09-18 Regents Of The University Of Minnesota ENGINEERING PLANT GENOMES USING CRISPR/Cas SYSTEMS
US20140273226A1 (en) 2013-03-15 2014-09-18 System Biosciences, Llc Crispr/cas systems for genomic modification and gene modulation
US20140295556A1 (en) 2013-03-15 2014-10-02 The General Hospital Corporation Using RNA-guided FokI Nucleases (RFNs) to Increase Specificity for RNA-Guided Genome Editing
US20140295557A1 (en) 2013-03-15 2014-10-02 The General Hospital Corporation Using Truncated Guide RNAs (tru-gRNAs) to Increase Specificity for RNA-Guided Genome Editing
US20140287938A1 (en) 2013-03-15 2014-09-25 The Broad Institute, Inc. Recombinant virus and preparations thereof
US20160024524A1 (en) 2013-03-15 2016-01-28 The General Hospital Corporation Increasing Specificity for RNA-Guided Genome Editing
US20140377868A1 (en) 2013-03-15 2014-12-25 The General Hospital Corporation Rna-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci
WO2014152432A2 (en) 2013-03-15 2014-09-25 The General Hospital Corporation Rna-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci
US20160024523A1 (en) 2013-03-15 2016-01-28 The General Hospital Corporation Using Truncated Guide RNAs (tru-gRNAs) to Increase Specificity for RNA-Guided Genome Editing
US20140304853A1 (en) 2013-04-05 2014-10-09 Sangamo Biosciences, Inc. Methods and compositions for integration of an exogenous sequence within the genome of plants
US20150056629A1 (en) 2013-04-14 2015-02-26 Katriona Guthrie-Honea Compositions, systems, and methods for detecting a DNA sequence
US20140309487A1 (en) 2013-04-16 2014-10-16 Regeneron Pharmaceuticals, Inc. Targeted modification of rat genome
US20140310828A1 (en) 2013-04-16 2014-10-16 Regeneron Pharmaceuticals, Inc. Targeted modification of rat genome
US20140335063A1 (en) 2013-05-10 2014-11-13 Sangamo Biosciences, Inc. Delivery methods and compositions for nuclease-mediated genome engineering
US20140356867A1 (en) 2013-05-29 2014-12-04 Agilent Technologies, Inc. Nucleic acid enrichment using cas9
US20150067922A1 (en) 2013-05-30 2015-03-05 The Penn State Research Foundation Gene targeting and genetic modification of plants via rna-guided genome editing
CA2915837A1 (en) 2013-06-17 2014-12-24 The Broad Institute, Inc. Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation
WO2014204578A1 (en) 2013-06-21 2014-12-24 The General Hospital Corporation Using rna-guided foki nucleases (rfns) to increase specificity for rna-guided genome editing
US20150024500A1 (en) 2013-07-19 2015-01-22 Larix Bioscience, Llc Methods and compositions for producing double allele knock outs
US20150044772A1 (en) 2013-08-09 2015-02-12 Sage Labs, Inc. Crispr/cas system-based novel fusion protein and its applications in genome editing
US20160017301A1 (en) 2013-08-29 2016-01-21 Temple University Of The Commonwealth System Of Higher Education Methods and compositions for rna-guided treatment of hiv infection
US20150071899A1 (en) 2013-09-06 2015-03-12 President And Fellows Of Harvard College Cas9-foki fusion proteins and uses thereof
US20150174169A1 (en) * 2013-10-17 2015-06-25 Sangamo Biosciences, Inc. Delivery methods and compositions for nuclease-mediated genome engineering in hematopoietic stem cells
US20150159174A1 (en) 2013-12-11 2015-06-11 Regeneron Pharmaceutical, Inc. Methods and Compositions for the Targeted Modification of a Genome
US20150159175A1 (en) 2013-12-11 2015-06-11 Regeneron Pharmaceutical, Inc. Methods and compositions for the targeted modification of a genome
US20150232883A1 (en) 2013-12-12 2015-08-20 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components
US20150191744A1 (en) 2013-12-17 2015-07-09 University Of Massachusetts Cas9 effector-mediated regulation of transcription, differentiation and gene editing/labeling
WO2015099850A1 (en) 2013-12-26 2015-07-02 The General Hospital Corporation Multiplex guide rnas
US20150252358A1 (en) 2014-03-10 2015-09-10 Editas Medicine, Inc. Crispr/cas-related methods and compositions for treating leber's congenital amaurosis 10 (lca10)
WO2016028682A1 (en) * 2014-08-17 2016-02-25 The Broad Institute Inc. Genome editing using cas9 nickases
WO2016112242A1 (en) * 2015-01-08 2016-07-14 President And Fellows Of Harvard College Split cas9 proteins
WO2016141224A1 (en) 2015-03-03 2016-09-09 The General Hospital Corporation Engineered crispr-cas9 nucleases with altered pam specificity
WO2017040348A1 (en) 2015-08-28 2017-03-09 The General Hospital Corporation Engineered crispr-cas9 nucleases
WO2018035387A1 (en) * 2016-08-17 2018-02-22 The Broad Institute, Inc. Novel crispr enzymes and systems

Non-Patent Citations (139)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", 2010
AL-ATTAR ET AL.: "Clustered Regularly Interspaced Short Palindromic Repeats (CRISPRs): The Hallmark of an Ingenious Antiviral Defense Mechanism in Prokaryotes", BIOL CHEM, vol. 392, 2011, pages 277 - 289
ALTSCHUL, S. F.W. GISH ET AL., J MOL BIOL, vol. 215, 1990, pages 403 - 10
AYNAUD, MARIE-MING ET AL.: "Human Tribbles 3 protects nuclear DNA from cytidine deamination by APOBEC3A", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 287, no. 46, 2012, pages 39182 - 39192
BAE ET AL., NAT. BIOTECHNOL., vol. 21, 2003, pages 275 - 280
BEERLI ET AL., NAT. BIOTECHNOL., vol. 20, 2002, pages 135 - 141
BERG, PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 99
BOGDANOVE ET AL., 20URRO PIN PLANT BIOL, vol. 13, 2010, pages 394 - 401
BOGDANOVEVOYTAS, SCIENCE, vol. 333, 2011, pages 1843 - 1846
BOISSEL ET AL., NUCL. ACIDS RES., vol. 42, no. 4, 2014, pages 2591 - 2601
BOISSELSCHARENBERG, METHODS MOL BIOL., vol. 1239, 2015, pages 171 - 96
CARON ET AL., MOL THER., vol. 3, no. 3, 2001, pages 310 - 8
CARROLL ET AL., NAT. PROTOC., vol. 1, 2006, pages 1637 - 52
CARROLL, GENE THER., vol. 15, 2008, pages 1463 - 68
CARROLL: "A CRISPR Approach to Gene Targeting", MOLECULAR THERAPY, vol. 20, no. 9, September 2012 (2012-09-01), pages 1658 - 1660, XP055106489, DOI: 10.1038/mt.2012.171
CATHOMEN, MOL. THER., vol. 16, 2008, pages 1200 - 07
CHOO ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 11163
CHRISTIAN ET AL., GENETICS, vol. 186, 2010, pages 757 - 761
CLARK-CURTISSCURTISS ET AL.: "Methods in Enzymology", vol. 101, 1983, pages: 347 - 362
COKOL ET AL., EMBO REP., vol. 1, no. 5, 15 November 2000 (2000-11-15), pages 411 - 415
COLLEY ET AL., J. BIOL. CHEM., vol. 264, 1989, pages 17619 - 22
CROMBEZ ET AL., BIOCHEM SOC. TRANS., vol. 35, 2007, pages 44 - 46
DAHLMAN ET AL., NAT BIOTECHNOL., vol. 33, no. 11, November 2015 (2015-11-01), pages 1159 - 61
DEROSSI ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 10444 - 10450
DESHAYES ET AL., CELL MOL LIFE SCI., vol. 62, no. 16, 2005, pages 1839 - 49
DICARLO ET AL., NUCLEIC ACIDS RES, 2013
EAR, PO HIENSTEPHEN W. MICHNICK: "A General Life-death Selection Strategy for Dissecting Protein Functions", NATURE METHODS, vol. 6, no. 11, 2009, pages 813 - 16
EL-ANDALOUSSI ET AL., CURR PHARM DES., vol. 11, no. 28, 2005, pages 3597 - 611
ELROD-ERICKSON ET AL., STRUCTURE, vol. 6, 1998, pages 451
FAGERLUND ET AL., GENOME BIOL, vol. 16, 2015, pages 251
FRANKEL ET AL., CELL, vol. 55, 1988, pages 1189 - 1193
FREITASCUNHA, CURR GENOMICS, vol. 10, no. 8, December 2009 (2009-12-01), pages 550 - 557
FRIEDLAND, ARI E. ET AL.: "Characterization of Staphylococcus Aureus Cas9: a Smaller Cas9 for All-in-One Adeno-Associated Virus Delivery and Paired Nickase Applications", GENOME BIOLOGY, vol. 16, no. 1, 2015, XP055347837, DOI: 10.1186/s13059-015-0817-8
FU ET AL., METHODS ENZYMOL., vol. 546, 2014, pages 21 - 45
FUTAKI ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 5836 - 5840
GAIT ET AL., CELL. MOL. LIFE. SCI., vol. 60, 2003, pages 844 - 853
GASIUNAS ET AL.: "Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES USA, vol. 109, no. 39, 4 September 2012 (2012-09-04), pages E2579 - E2586, XP055569955, DOI: 10.1073/pnas.1208507109
GASIUNAS, G. ET AL.: "Cas9-CrRNA Ribonucleoprotein Complex Mediates Specific DNA Cleavage for Adaptive Immunity in Bacteria", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 109, no. 39, April 2012 (2012-04-01)
GEISSLER ET AL., PLOS ONE, vol. 6, 2011, pages e19722
GOSSENBUJARD, PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 5547
HALE ET AL.: "Essential Features and Rational Design of CRISPR RNAs That Function With the Cas RAMP Module Complex to Cleave RNAs", MOLECULAR CELL, vol. 45, 2012, pages 292 - 302, XP055038620, DOI: 10.1016/j.molcel.2011.10.023
HARRIS, REUBEN S.SVEND K. PETERSEN-MAHRTMICHAEL S. NEUBERGER: "RNA Editing Enzyme APOBEC1 and Some of Its Homologs Can Act as DNA Mutators", MOLECULAR CELL, vol. 10, no. 5, 2002, pages 1247 - 253, XP001166837, DOI: 10.1016/S1097-2765(02)00742-6
HIRANO, H. ET AL., CRYSTAL STRUCTURE OF FRANCISELLA NOVICIDA CAS9 RHA IN COMPLEX WITH SGRNA AND TARGET DNA (TGG PAM, February 2016 (2016-02-01)
HOCKEMEYE ET AL., NAT BIOTECHNOL, vol. 29, 2011, pages 699 - 700
HOLTZ, COLLEEN M.HOLLY A. SADLERLOUIS M. MANSKY: "APOBEC3G cytosine deamination hotspots are defined by both sequence context and single-stranded DNA secondary structure", NUCLEIC ACIDS RESEARCH, 2013, pages 246
HWANG ET AL., NAT BIOTECHNOL, vol. 31, 2013, pages 230 - 232
ISALAN ET AL., NAT. BIOTECHNOL., vol. 19, 2001, pages 656 - 660
JAMIESON ET AL., BIOCHEMISTRY, vol. 33, 1994, pages 5689
JASIN, MARIARODNEY ROTHSTEIN: "Repair of strand breaks by homologous recombination", COLD SPRING HARBOR PERSPECTIVES IN BIOLOGY, vol. 5, no. 11, 2013, pages a012740, XP055269842, DOI: 10.1101/cshperspect.a012740
JASON M. GERHKEOLIVER R. CERVANTESM. KENDELL CLEMENTLUCA PINELLOJ. KEITH JOUNG: "High-precision CRISPR-Cas9 base editors with minimized bystander and off-target mutations", BIORXIV, pages 273938
JINEK ET AL., ELIFE, vol. 2, 2013, pages e00471
JINEK ET AL., SCIENCE, vol. 337, 2012, pages 816 - 821
JINEK ET AL.: "A Programmable Dual-RNA-Guided DNA Endonuclease in Adaptive Bacterial Immunity", SCIENCE, vol. 337, 17 August 2012 (2012-08-17), pages 816 - 821, XP055229606, DOI: 10.1126/science.1225829
JOUNG ET AL., NAT. METHODS, vol. 7, 2010, pages 91 - 92
KIM ET AL., GENOME RES., vol. 19, 2009, pages 1279 - 88
KIM ET AL.: "Highly efficient RNA-guided genome editing in human cells via delivery of purified Cas9 ribonucleoproteins", GENOME RESEARCH, vol. 24, no. 6, 2014, pages 1012 - 1019, XP055277723, DOI: 10.1101/gr.171322.113
KIM ET AL.: "Increasing the Genome-Targeting Scope and Precision of Base Editing with Engineered Cas9-Cytosine Deaminase Fusions", NATURE BIOTECHNOLOGY, vol. 35, no. 4, 2017, pages 371 - 376
KLEINSTIVER ET AL., NAT BIOTECHNOL., vol. 33, no. 12, December 2015 (2015-12-01), pages 1293 - 1298
KLEINSTIVER ET AL., NAT BIOTECHNOL., vol. 34, no. 8, August 2016 (2016-08-01), pages 869 - 74
KLEINSTIVER ET AL., NATURE, vol. 523, no. 7561, 23 July 2015 (2015-07-23), pages 481 - 5
KLEINSTIVER ET AL., NATURE, vol. 529, no. 7587, 28 January 2016 (2016-01-28), pages 490 - 5
KLUG, GENE, vol. 135, 1993, pages 83
KOMOR ET AL.: "Programmable Editing of a Target Base in Genomic DNA Without Double-Stranded DNA Cleavage", NATURE, vol. 533, no. 7603, 31 May 2016 (2016-05-31), pages 420 - 424, XP055548777 *
KOMOR, ALEXIS C.YONGJOO B. KIMMICHAEL S. PACKERJOHN A. ZURISDAVID R. LIU: "Programmable Editing of a Target Base in Genomic DNA without Double-stranded DNA Cleavage", NATURE, vol. 533, no. 7603, 2016, pages 420 - 24, XP093078921, DOI: 10.1038/nature17946
KONERMANN ET AL., NATURE, vol. 517, no. 7536, 29 January 2015 (2015-01-29), pages 583 - 8
KRIEGLER: "Gene Transfer and Expression: A Laboratory Manual", vol. 182, 1990, article "Guide to Protein Purification"
LAFOUNTAINE ET AL., INT J PHARM., vol. 494, no. 1, 13 August 2015 (2015-08-13), pages 180 - 194
LEE ET AL., SCIENCE, vol. 245, 1989, pages 635
LIANG ET AL.: "Rapid and highly efficient mammalian cell engineering via Cas9 protein transfection", JOURNAL OF BIOTECHNOLOGY, vol. 208, 2015, pages 44 - 53, XP055196365, DOI: 10.1016/j.jbiotec.2015.04.024
LIU ET AL., BIOCHEM. AND BIOPHYS. RES. COMM., vol. 347, no. 1, 2006, pages 133 - 140
LIU ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 3850 - 56
MAEDER ET AL., MOL. CELL, vol. 31, 2008, pages 294 - 301
MAEDER, MORGAN L.: "Rapid 'Open-Source' Engineering of Customized Zinc-Finger Nucleases for Highly Efficient Gene Modification", CELL, vol. 31, no. 2, 2008, pages 294 - 301, XP055143755, DOI: 10.1016/j.molcel.2008.06.016
MAHFOUZ ET AL., PROC NATL ACAD SCI U S A, vol. 108, 2011, pages 2623 - 2628
MAKAROVA ET AL., NAT REV MICROBIOL, vol. 13, 2015, pages 722 - 736
MAKAROVA ET AL.: "Evolution and classification of the CRISPR-Cas systems", NATURE REVIEWS MICROBIOLOGY, vol. 9, no. 6, June 2011 (2011-06-01), pages 467 - 477, XP055932744, DOI: 10.1038/nrmicro2577
MALI ET AL., SCIENCE, vol. 339, 2013, pages 823 - 826
MANDELL ET AL., NUCLEIC ACIDS RES., vol. 34, 2006, pages W516 - 523
MICHNICK ET AL.: "Chapter 25: Protein-Fragment Complementation Assays for Large-Scale Analysis, Functional Dissection and Dynamic Studies of Protein-Protein Interactions in Living Cells", SIGNAL TRANSDUCTION PROTOCOLS, METHODS IN MOLECULAR BIOLOGY, vol. 756, 1 July 2011 (2011-07-01), pages 395 - 425, XP009165787 *
MILLER ET AL., EMBO J., vol. 4, 1985, pages 1609
MORBITZER ET AL., T. PROC NATL ACAD SCI U S A, vol. 107, 2010, pages 21617 - 21622
MORRISON, J. BACTERIOL., vol. 132, 1977, pages 349 - 351
MOSCOUBOGDANOVE, SCIENCE, vol. 326, 2009, pages 1501 - 1512
MUSSOLINO ET AL., NUCLEIC ACIDS RES, vol. 39, 2011, pages 6315 - 6325
MYOU ET AL., J. IMMUNOL., vol. 171, 2003, pages 4399 - 4405
NAGAHARA ET AL., NAT. MED., vol. 4, 1998, pages 1449 - 1453
NEERING ET AL., BLOOD, vol. 88, 1996, pages 1147 - 55
NISHIDA, K., T. ARAZOE, N. YACHIE, S. BANNO, M. KAKIMOTO, M. TABATA, M.MOCHIZUKI, A. MIYABE, M. ARAKI, K. Y. HARA, Z. SHIMATANI, A: "Targeted Nucleotide Editing Using Hybrid Prokaryotic and Vertebrate Adaptive Immune Systems", SCIENCE, vol. 353, no. 6305, 2016, XP055482712, DOI: 10.1126/science.aaf8729
NISHIMASU, CELL, vol. 156, 2014, pages 935 - 949
OLIGINO ET AL., GENE THER., vol. 5, 1998, pages 491 - 496
OSBORN ET AL., HUM GENE THER., vol. 26, no. 2, February 2015 (2015-02-01), pages 114 - 26
PALOMARES ET AL.: "Production of Recombinant Proteins: Challenges and Solutions", METHODS MOL BIOL., vol. 267, 2004, pages 15 - 52
PALVA ET AL., GENE, vol. 22, 1983, pages 229 - 235
PATTANAYAK, VIKRAM ET AL.: "Revealing off-Target Cleavage Specificities of Zinc-Finger Nucleases by in Vitro Selection", NATURE METHODS, vol. 8, July 2011 (2011-07-01), pages 765 - 770, XP055650557, DOI: 10.1038/nmeth.1670
PAVLETICH ET AL., SCIENCE, vol. 252, 1991, pages 809
RAMIREZ ET AL., NAT. METHODS, vol. 5, 2008, pages 374 - 375
RAMSEYFLYNN, PHARMACOL THER, 22 July 2015 (2015-07-22)
REBAR ET AL., SCIENCE, vol. 263, 1994, pages 671
REBHANDL, STEFANMICHAEL HUEMERRICHARD GREILROLAND GEISBERGER: "AID/APOBEC Deaminases and Cancer", ONCOSCIENCE, vol. 2, 2015, pages 320
REES, HOLLY A. ET AL.: "Improving the DNA specificity and applicability of base editing through protein engineering and protein delivery", NATURE, vol. 8, 2017, pages 15790, XP055597104, DOI: 10.1038/ncomms15790
RENDAHL ET AL., NAT. BIOTECHNOL., vol. 16, 1998, pages 757 - 761
REYON ET AL., NATURE BIOTECHNOLOGY, vol. 30, 2012, pages 460 - 465
ROTHBARD ET AL., NATURE MEDICINE, vol. 6, no. 11, 2000, pages 1253 - 1257
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 2001
SANTOS-PEREIRA, JOSE M.ANDRES AGUILERA: "R Loops: New Modulators of Genome Dynamics and Function", NATURE REVIEWS GENETICS, vol. 16, no. 10, 2015, pages 583 - 97
SANTRA ET AL., CHEM. COMMUN., 2005, pages 3144 - 3146
SCHOLZEBOCH, J. 21URRO PIN MICROBIOL, 2011
SCHUNDER ET AL., INT J MED MICROBIOL, vol. 303, 2013, pages 51 - 60
SCHWARZDAYHOF: "Atlas of Protein Sequence and Structure", 1979, pages: 353 - 358
See also references of EP3630198A4
SEGAL ET AL., BIOCHEMISTRY, vol. 42, 2003, pages 2137 - 48
SHEN ET AL., CELL RES, 2013
SHINOHARA, MASANOBU ET AL.: "APOBEC3B can impair genomic stability by inducing base substitutions in genomic DNA in human cells", SCIENTIFIC REPORTS, vol. 2, 2012, pages 806
SHMAKOV ET AL., MOL CELL., vol. 60, no. 3, 5 November 2015 (2015-11-05), pages 385 - 97
SHOKOLENKO ET AL., DNA REPAIR, vol. 4, no. 4, 2005, pages 511 - 518
SMITH, T. F.M. S. WATERMAN, J MOL BIOL, vol. 147, 1981, pages 195 - 7
SMITHWATERMAN, ADVANCES IN APPLIED MATHEMATICS, 1981, pages 482 - 489
SNYDER ET AL., PLOS BIOL, vol. 2, 2004, pages E36
STETSENKO ET AL., J. ORG. CHEM., vol. 65, 2000, pages 4900 - 4909
SUSPENE, RODOLPHE ET AL.: "Recovery of APOBEC3-edited human immunodeficiency virus G—> A hypermutants by differential DNA denaturation PCR", JOURNAL OF GENERAL VIROLOGY, vol. 86, no. 1, 2005, pages 125 - 129, XP002505773, DOI: 10.1099/VIR.0.80426-0
TAKENOBU ET AL., MOL. CANCER THER., vol. 1, no. 12, 2002, pages 1043 - 1049
TANG, XU ET AL.: "A CRISPR-Cpfl System for Efficient Genome Editing and Transcriptional Repression in Plants", NATURE PLANTS, vol. 3, no. 7, 2017, pages 17103
TSAI ET AL., NAT BIOTECHNOL., vol. 32, no. 6, June 2014 (2014-06-01), pages 569 - 76
TSAIJOUNG, NAT REV GENET., vol. 17, no. 5, May 2016 (2016-05-01), pages 300 - 12
VIVES ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 16010 - 16017
WANG ET AL., GENE THER., vol. 4, 1997, pages 432 - 441
WENDER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 13003 - 13008
WIEDENHEFT ET AL.: "RNA-guided genetic silencing systems in bacteria and archaea", NATURE, vol. 482, no. 331-338, 16 February 2012 (2012-02-16)
WU ET AL., CELL. MOL. LIFE SCI., vol. 64, 2007, pages 2933 - 44
WU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 92, 1995, pages 344
WYVEKENS ET AL., HUM GENE THER., vol. 26, no. 7, July 2015 (2015-07-01), pages 425 - 31
YAMADA, MARI ET AL.: "Crystal Structure of the Minimal Cas9 from Campylobacter Jejuni Reveals the Molecular Diversity in the CRISPR-Cas9 Systems", MOLECULAR CELL, vol. 65, no. 6, 2017
YAMANO, T. ET AL., CRYSTAL STRUCTURE OF ACIDAMINOCOCCUS SP. CPFL IN COMPLEX WITH CRRNA AND TARGET DNA, April 2016 (2016-04-01)
YANG ET AL., J GENET GENOMICS, vol. 44, no. 9, 20 September 2017 (2017-09-20), pages 423 - 437
YANG ET AL.: "Engineering and Optimising Deaminase Fusions for Genome Editing", NATURE COMMUNICATIONS, vol. 7, 2 November 2016 (2016-11-02), pages 1 - 12, XP055548773 *
YANG ET AL.: "Engineering and Optimising Deaminase Fusions for Genome Editing", NATURE COMMUNICATIONS, vol. 7, 2 November 2016 (2016-11-02), pages 1 - 12, XP055548773, DOI: 10.1038/ncomms13330
YANG, LUHANADRIAN W. BRIGGSWEI LEONG CHEWPRASHANT MALIMARC GUELLJOHN AACHDANIEL BRYAN GOODMANDAVID COXYINAN KANEMAL LESHA: "Engineering and Optimising Deaminase Fusions for Genome Editing", NATURE COMMUNICATIONS, vol. 7, 2016, pages 13330, XP055415680, DOI: 10.1038/ncomms13330
ZETSCHE, BERND ET AL.: "Cpfl Is a Single RNA-Guided Endonuclease of a Class 2 CRISPR-Cas System", CELL, vol. 163, no. 3, 2015, pages 759 - 771
ZURIS, JOHN A. ET AL.: "Cationic lipid-mediated delivery of proteins enables efficient protein-based genome editing in vitro and in vivo", NATURE BIOTECHNOLOGY, vol. 33, no. 1, 2015, pages 73 - 80, XP093037310, DOI: 10.1038/nbt.3081

Cited By (111)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12006520B2 (en) 2011-07-22 2024-06-11 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US10954548B2 (en) 2013-08-09 2021-03-23 President And Fellows Of Harvard College Nuclease profiling system
US11920181B2 (en) 2013-08-09 2024-03-05 President And Fellows Of Harvard College Nuclease profiling system
US10508298B2 (en) 2013-08-09 2019-12-17 President And Fellows Of Harvard College Methods for identifying a target site of a CAS9 nuclease
US11046948B2 (en) 2013-08-22 2021-06-29 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US10912833B2 (en) 2013-09-06 2021-02-09 President And Fellows Of Harvard College Delivery of negatively charged proteins using cationic lipids
US11299755B2 (en) 2013-09-06 2022-04-12 President And Fellows Of Harvard College Switchable CAS9 nucleases and uses thereof
US12584118B2 (en) 2013-09-06 2026-03-24 President And Fellows Of Harvard College Cas9 variants and uses thereof
US12473573B2 (en) 2013-09-06 2025-11-18 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US10858639B2 (en) 2013-09-06 2020-12-08 President And Fellows Of Harvard College CAS9 variants and uses thereof
US10682410B2 (en) 2013-09-06 2020-06-16 President And Fellows Of Harvard College Delivery system for functional nucleases
US10597679B2 (en) 2013-09-06 2020-03-24 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US12215365B2 (en) 2013-12-12 2025-02-04 President And Fellows Of Harvard College Cas variants for gene editing
US10465176B2 (en) 2013-12-12 2019-11-05 President And Fellows Of Harvard College Cas variants for gene editing
US11053481B2 (en) 2013-12-12 2021-07-06 President And Fellows Of Harvard College Fusions of Cas9 domains and nucleic acid-editing domains
US11124782B2 (en) 2013-12-12 2021-09-21 President And Fellows Of Harvard College Cas variants for gene editing
US12104207B2 (en) 2014-06-23 2024-10-01 The General Hospital Corporation Genomewide unbiased identification of DSBs evaluated by sequencing (GUIDE-Seq)
US10704062B2 (en) 2014-07-30 2020-07-07 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US12398406B2 (en) 2014-07-30 2025-08-26 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US11578343B2 (en) 2014-07-30 2023-02-14 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US12188043B2 (en) 2015-07-15 2025-01-07 Rutgers, The State University Of New Jersey Nuclease-independent targeted gene editing platform and uses thereof
US11028429B2 (en) 2015-09-11 2021-06-08 The General Hospital Corporation Full interrogation of nuclease DSBs and sequencing (FIND-seq)
US12043852B2 (en) 2015-10-23 2024-07-23 President And Fellows Of Harvard College Evolved Cas9 proteins for gene editing
US12344869B2 (en) 2015-10-23 2025-07-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US11214780B2 (en) 2015-10-23 2022-01-04 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US11999947B2 (en) 2016-08-03 2024-06-04 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US10947530B2 (en) 2016-08-03 2021-03-16 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11702651B2 (en) 2016-08-03 2023-07-18 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US12084663B2 (en) 2016-08-24 2024-09-10 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
US11820969B2 (en) 2016-12-23 2023-11-21 President And Fellows Of Harvard College Editing of CCR2 receptor gene to protect against HIV infection
US12065666B2 (en) 2017-01-05 2024-08-20 Rutgers, The State University Of New Jersey Targeted gene editing platform independent of DNA double strand break and uses thereof
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12516308B2 (en) 2017-03-09 2026-01-06 President And Fellows Of Harvard College Suppression of pain by gene editing
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
US12435331B2 (en) 2017-03-10 2025-10-07 President And Fellows Of Harvard College Cytosine to guanine base editor
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
US12359218B2 (en) 2017-07-28 2025-07-15 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11286468B2 (en) 2017-08-23 2022-03-29 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with altered PAM specificity
US11624058B2 (en) 2017-08-23 2023-04-11 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with altered PAM specificity
US12241096B2 (en) 2017-08-23 2025-03-04 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with altered PAM specificity
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11932884B2 (en) 2017-08-30 2024-03-19 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11725228B2 (en) 2017-10-11 2023-08-15 The General Hospital Corporation Methods for detecting site-specific and spurious genomic deamination induced by base editing technologies
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
US12601009B2 (en) 2018-04-17 2026-04-14 The General Hospital Corporation Highly sensitive in vitro assays to define substrate preferences and sites of nucleic-acid binding, modifying, and cleaving agents
US11976324B2 (en) 2018-04-17 2024-05-07 The General Hospital Corporation Highly sensitive in vitro assays to define substrate preferences and sites of nucleic-acid binding, modifying, and cleaving agents
US11845987B2 (en) 2018-04-17 2023-12-19 The General Hospital Corporation Highly sensitive in vitro assays to define substrate preferences and sites of nucleic acid cleaving agents
US11898203B2 (en) 2018-04-17 2024-02-13 The General Hospital Corporation Highly sensitive in vitro assays to define substrate preferences and sites of nucleic-acid binding, modifying, and cleaving agents
US12606867B2 (en) 2018-04-17 2026-04-21 The General Hospital Corporation Highly sensitive in vitro assays to define substrate preferences and sites of nucleic-acid binding, modifying, and cleaving agents
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof
US11834686B2 (en) 2018-08-23 2023-12-05 Sangamo Therapeutics, Inc. Engineered target specific base editors
JP2021536229A (en) * 2018-08-23 2021-12-27 サンガモ セラピューティクス, インコーポレイテッド Manipulated target-specific base editor
JP7541508B2 (en) 2018-08-23 2024-08-28 サンガモ セラピューティクス, インコーポレイテッド Engineered target-specific base editors
US12398392B2 (en) 2018-08-28 2025-08-26 Flagship Pioneering Innovations Vi, Llc Methods and compositions for modulating a genome
US12031129B2 (en) 2018-08-28 2024-07-09 Flagship Pioneering Innovations Vi, Llc Methods and compositions for modulating a genome
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
JP2024109660A (en) * 2019-02-02 2024-08-14 シャンハイテック ユニバーシティ Preventing unintended mutations in gene editing
JP7761294B2 (en) 2019-02-02 2025-10-28 シャンハイテック ユニバーシティ Preventing unintended mutations in gene editing
JP2022526695A (en) * 2019-02-02 2022-05-26 シャンハイテック ユニバーシティ Inhibition of unintentional mutations in gene editing
JP7518549B2 (en) 2019-02-02 2024-07-18 シャンハイテック ユニバーシティ Preventing unintended mutations in gene editing
EP3918083A4 (en) * 2019-02-02 2023-03-29 Shanghaitech University INHIBITION OF UNINTENDED MUTATIONS IN GENE EDITING
US11946040B2 (en) 2019-02-04 2024-04-02 The General Hospital Corporation Adenine DNA base editor variants with reduced off-target RNA editing
WO2020191242A1 (en) * 2019-03-19 2020-09-24 The Broad Institute, Inc. Methods and compositions for editing nucleotide sequences
US12281303B2 (en) 2019-03-19 2025-04-22 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11643652B2 (en) 2019-03-19 2023-05-09 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12509680B2 (en) 2019-03-19 2025-12-30 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11795452B2 (en) 2019-03-19 2023-10-24 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12570972B2 (en) 2019-03-19 2026-03-10 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11447770B1 (en) 2019-03-19 2022-09-20 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
WO2020244122A1 (en) * 2019-06-06 2020-12-10 中国科学院脑科学与智能技术卓越创新中心 New-type single-base editing technique and use thereof
CN112048497B (en) * 2019-06-06 2023-11-03 辉大(上海)生物科技有限公司 Novel single-base editing technology and application thereof
CN112048497A (en) * 2019-06-06 2020-12-08 中国科学院脑科学与智能技术卓越创新中心 Novel single base editing technology and application thereof
US12404525B2 (en) 2019-06-13 2025-09-02 The General Hospital Corporation Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells
US12351815B2 (en) 2019-06-13 2025-07-08 The General Hospital Corporation Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells
US12351814B2 (en) 2019-06-13 2025-07-08 The General Hospital Corporation Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells
EP4031190A4 (en) * 2019-09-17 2023-08-09 Rutgers, the State University of New Jersey Highly efficient dna base editors mediated by rna-aptamer recruitment for targeted genome modification and uses thereof
CN110564752A (en) * 2019-09-30 2019-12-13 北京市农林科学院 Application of differential agent technology in enrichment of C.T base substitution cells
CN110564752B (en) * 2019-09-30 2021-07-16 北京市农林科学院 Application of differential surrogate technology in enrichment of C·T base substitution cells
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
CN112725348A (en) * 2019-10-28 2021-04-30 安徽省农业科学院水稻研究所 Gene and method for improving single-base editing efficiency of rice and application of gene
CN112725348B (en) * 2019-10-28 2022-04-01 安徽省农业科学院水稻研究所 Gene and method for improving single-base editing efficiency of rice and application of gene
WO2021113611A1 (en) * 2019-12-06 2021-06-10 The General Hospital Corporation Split deaminase base editors
EP4069282A4 (en) * 2019-12-06 2023-11-08 The General Hospital Corporation FRACTIONATED DEAMINASE BASE EDITORS
EP4093879A4 (en) * 2020-01-25 2024-02-28 The Trustees of the University of Pennsylvania Compositions for small molecule control of precise base editing of target nucleic acids and methods of use thereof
US20250011748A1 (en) * 2020-01-28 2025-01-09 The Broad Institute, Inc. Base editors, compositions, and methods for modifying the mitochondrial genome
EP4103705A4 (en) * 2020-02-14 2024-02-28 Ohio State Innovation Foundation NUCLEOBASE EDITORS AND METHODS OF USE THEREOF
US12416001B2 (en) 2020-02-14 2025-09-16 Ohio State Innovation Foundation Nucleobase editors and methods of use thereof
US12565666B2 (en) 2020-03-04 2026-03-03 Flagship Pioneering Innovations Vi, Llc Methods and compositions for modulating a genome
US12065669B2 (en) 2020-03-04 2024-08-20 Flagship Pioneering Innovations Vi, Llc Methods and compositions for modulating a genome
US12037602B2 (en) 2020-03-04 2024-07-16 Flagship Pioneering Innovations Vi, Llc Methods and compositions for modulating a genome
US12031126B2 (en) 2020-05-08 2024-07-09 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
WO2022008466A1 (en) 2020-07-06 2022-01-13 Wageningen Universiteit Base editing tools
US12319938B2 (en) 2020-07-24 2025-06-03 The General Hospital Corporation Enhanced virus-like particles and methods of use thereof for delivery to cells
WO2022050377A1 (en) 2020-09-04 2022-03-10 国立大学法人広島大学 Method for editing target dna, method for producing cell having edited target dna, and dna edition system for use in said methods
KR20230058482A (en) 2020-09-04 2023-05-03 고쿠리츠다이가쿠호진 히로시마다이가쿠 Target DNA editing method, target DNA-edited cell production method, and DNA editing system used therefor
KR20220053097A (en) * 2020-10-21 2022-04-29 성균관대학교산학협력단 Vector expressing cytosine base editor without off-target effect without reduction of on-target efficiency in industrial strains and uses thereof
KR102399035B1 (en) 2020-10-21 2022-05-17 성균관대학교산학협력단 Vector expressing cytosine base editor without off-target effect without reduction of on-target efficiency in industrial strains and uses thereof
WO2023122722A1 (en) * 2021-12-22 2023-06-29 Sangamo Therapeutics, Inc. Novel zinc finger fusion proteins for nucleobase editing
WO2024226156A1 (en) * 2023-04-27 2024-10-31 University Of Massachusetts Cas-embedded cytidine deaminase ribonucleoprotein complexes having improved base editing specificity and efficiency

Also Published As

Publication number Publication date
EP3630849A4 (en) 2021-01-13
US20200140842A1 (en) 2020-05-07
CA3063733A1 (en) 2018-11-29
EP3630849A1 (en) 2020-04-08
AU2018273986A1 (en) 2019-12-12
JP2020521446A (en) 2020-07-27
US20200172885A1 (en) 2020-06-04
CA3063449A1 (en) 2018-11-29
EP3630198A4 (en) 2021-04-21
EP3630970A2 (en) 2020-04-08
EP3630198A1 (en) 2020-04-08
JP7324713B2 (en) 2023-08-10
AU2018272067B2 (en) 2024-07-18
AU2018272067A1 (en) 2019-11-28
WO2018218188A2 (en) 2018-11-29
CN110959040A (en) 2020-04-03
CA3064828A1 (en) 2018-11-29
WO2018218206A1 (en) 2018-11-29
US20200172895A1 (en) 2020-06-04
JP2023113672A (en) 2023-08-16
JP2023126956A (en) 2023-09-12
JP2020521451A (en) 2020-07-27
CN110997728A (en) 2020-04-10
AU2018273968A1 (en) 2019-11-28
JP2020521454A (en) 2020-07-27
CN111093714A (en) 2020-05-01
EP3630970A4 (en) 2020-12-30
US20220275356A1 (en) 2022-09-01
US11326157B2 (en) 2022-05-10
WO2018218188A3 (en) 2019-01-03
CN110959040B (en) 2024-11-12
AU2024227270A1 (en) 2024-10-31

Similar Documents

Publication Publication Date Title
US20200172895A1 (en) Using split deaminases to limit unwanted off-target base editor deamination
US12590299B2 (en) Variants of CRISPR from Prevotella and Francisella 1 (Cpf1)
US11946040B2 (en) Adenine DNA base editor variants with reduced off-target RNA editing
US10633642B2 (en) Engineered CRISPR-Cas9 nucleases
EP4021945A2 (en) Combinatorial adenine and cytosine dna base editors
US20200172899A1 (en) Epigenetically Regulated Site-Specific Nucleases
EP4022053A1 (en) C-to-g transversion dna base editors
US20170058271A1 (en) Engineered CRISPR-Cas9 Nucleases
WO2020077138A2 (en) Selective curbing of unwanted rna editing (secure) dna base editor variants
US20230024833A1 (en) Split deaminase base editors
WO2024086845A2 (en) Engineered casphi2 nucleases
BASE Adenine Dna Base Editor Variants With Reduced Off-target Rna Editing
WO2025171041A1 (en) Engineered casphi2 (cas12j-2) proteins

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18805050

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3063449

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019564864

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018273968

Country of ref document: AU

Date of ref document: 20180525

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018805050

Country of ref document: EP

Effective date: 20200102

WWW Wipo information: withdrawn in national office

Ref document number: 2018805050

Country of ref document: EP