WO2018203060A2 - Novel formulations - Google Patents

Novel formulations Download PDF

Info

Publication number
WO2018203060A2
WO2018203060A2 PCT/GB2018/051178 GB2018051178W WO2018203060A2 WO 2018203060 A2 WO2018203060 A2 WO 2018203060A2 GB 2018051178 W GB2018051178 W GB 2018051178W WO 2018203060 A2 WO2018203060 A2 WO 2018203060A2
Authority
WO
WIPO (PCT)
Prior art keywords
formulation according
formulation
insulin
zinc
compound
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2018/051178
Other languages
English (en)
French (fr)
Other versions
WO2018203060A3 (en
Inventor
Jan Jezek
David GERRING
Sarah HOWELL
Leon ZAKRZEWSKI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Arecor Ltd
Original Assignee
Arecor Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Arecor Ltd filed Critical Arecor Ltd
Priority to EP18723926.4A priority Critical patent/EP3618804A2/en
Priority to US16/610,805 priority patent/US20200093894A1/en
Priority to CN201880029092.2A priority patent/CN110636832A/zh
Priority to JP2019560362A priority patent/JP7534850B2/ja
Publication of WO2018203060A2 publication Critical patent/WO2018203060A2/en
Publication of WO2018203060A3 publication Critical patent/WO2018203060A3/en
Anticipated expiration legal-status Critical
Priority to JP2023014791A priority patent/JP2023071660A/ja
Priority to US19/009,689 priority patent/US20250268987A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/28Insulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/455Nicotinic acids, e.g. niacin; Derivatives thereof, e.g. esters, amides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/02Inorganic compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/10Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/12Carboxylic acids; Salts or anhydrides thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/08Solutions

Definitions

  • This invention relates inter alia to rapid acting aqueous liquid formulations of insulin and insulin analogues.
  • Such formulations are suitable for the treatment of subjects suffering from diabetes mellitus, especially Type 1 diabetes mellitus.
  • Diabetes mellitus is a metabolic disorder associated with poor control of blood sugar levels leading to hypo or hyperglycemia. Untreated diabetes can lead to serious microvascular and macrovascular complications including coronary artery disease, peripheral artery disease, stroke, diabetic nephropathy, neuropathy and retinopathy.
  • the two main types of diabetes are (i) Type 1 diabetes resulting from the pancreas not producing insulin for which the usual treatment is insulin replacement therapy and (ii) Type 2 diabetes where patients either produce insufficient insulin or have insulin resistance and for which treatments include insulin sensitising agents (such as metformin or pioglitazone), traditional insulin
  • GLP-1 agonists such as exenatide and dulaglutide
  • DPPIV inhibitors such as sitagliptin or vildagliptin
  • a range of therapeutic options are possible.
  • the use of recombinant human insulin has in recent times been overtaken by use of insulin analogues which have modified properties, for example, are longer acting or faster acting than normal insulin.
  • a common regimen for a patient involves receiving a long acting basal insulin supplemented by a rapid acting insulin around mealtimes.
  • Insulin is a peptide hormone formed of two chains (A chain and B chain, respectively 21 and 30 amino acids in length) linked via disulfide bridges. Insulin normally exists at neutral pH in the form of a hexamer, each hexamer comprising three dimers bound together by zinc ions. Histidine residues on the insulin are known to be involved in the interaction with the zinc ions. Insulin is stored in the body in the hexameric form but the monomer form is the active form. Traditionally, therapeutic compositions of insulin have also been formulated in hexameric form in the presence of zinc ions. Typically, there are approximately three zinc cations per one insulin hexamer. It has been appreciated that the hexameric form is absorbed from the injection site considerably more slowly than the monomeric and dimeric form.
  • a first is insulin lispro (Humalog®) in which residues 28 and 29 of the B chain (Pro and Lys respectively) are reversed
  • a second is insulin aspart (NovoLog®) in which residue 28 of the B chain, normally Pro, is replaced by Asp
  • a third is insulin glulisine (Apidra®) in which residue 3 of the B chain, normally Asn, is replaced by Lys and residue 29 of the B chain, normally Lys, is replaced by Glu.
  • US5,866,538 (Norup) describes insulin preparations of superior chemical stability comprising human insulin or an analogue or derivative thereof, glycerol and/or mannitol and 5 to 100 mM of a halogenide (e.g. NaCI).
  • US7,205,276 (Boderke) addresses the stability problems associated with preparing zinc free formulations of insulin and insulin derivatives and analogues and describes an aqueous liquid formulation comprising at least one insulin derivative, at least one surfactant, optionally at least one preservative and optionally at least one of an isotonicizing agent, a buffer and an excipient, wherein the formulation is stable and free from or contains less than 0.4% (e.g. less than 0.2%) by weight of zinc based on the insulin content of the formulation.
  • the preferred surfactant appears to be polysorbate 20 (polyoxyethylene (20) sorbitan monolaurate).
  • polypeptides including insulin which contain an alkylglycoside, which component is said to reduce aggregation and immunogenicity.
  • WO2012/006283 describes formulations containing insulin together with a zinc chelator such as ethylenediaminetetraacetate (EDTA). Modulating the type and quantity of EDTA is said to change the insulin absorption profile.
  • EDTA ethylenediaminetetraacetate
  • Modulating the type and quantity of EDTA is said to change the insulin absorption profile.
  • Calcium EDTA is the preferred form of EDTA since it is said to be associated with reduced pain at the injection site and is less likely to remove calcium from the body.
  • Preferred formulations also contain citrate which is said to further enhance absorption and to improve the chemical stability of the formulation.
  • US2010/0227795 describes a composition comprising insulin, a dissociating agent such as citric acid or sodium citrate, and a zinc chelator such as EDTA wherein the formulation has a physiological pH and is a clear aqueous solution.
  • the formulations are said to have improved stability and rapid onset of action.
  • WO2015/120457 (Wilson) describes stabilized ultra-rapid acting insulin formulations comprising insulin in combination with a zinc chelator such as EDTA, a dissolution/stabilization agent such as citric acid, a magnesium salt, a zinc compound and optionally additional excipients.
  • WO91 /09617 J0rgensen reports that nicotinamide or nicotinic acid or a salt thereof increases the speed of absorption of insulin from aqueous preparations administered parenterally.
  • WO2010/149772 (Olsen) describes a formulation comprising insulin, a nicotinic compound and arginine. The presence of arginine is said to improve the chemical stability of the formulation.
  • WO2015/171484 (Christe) describes rapid acting formulations of insulin wherein onset of action and/or absorption of insulin is faster due to the presence of treprostinil.
  • US2013/0231281 describes an aqueous solution composition comprising insulin or an insulin analogue and at least one oligosaccharide whose average degree of polymerisation is between 3 and 13 and whose polydispersity index is above 1 .0, said oligosaccharide having partially substituted carboxyl functional groups, the unsubstituted carboxyl functional groups being salifiable.
  • a formulation is said to be rapid acting.
  • an aqueous liquid pharmaceutical formulation comprising (i) an insulin compound, (ii) ionic zinc, (iii) a nicotinic compound (iv) a non-ionic surfactant; and (v) a salt selected from the salts formed between Group 1 metals and a mono or divalent anion ("the formulation of the invention").
  • formulations of the invention provide insulin in a form which is rapid or ultra-rapid acting with good physical and chemical stability.
  • Formulations of the invention may be used in treatment of subjects suffering from diabetes mellitus, particularly Type 1 diabetes mellitus especially for
  • SEQ ID NO: 1 A chain of human insulin
  • SEQ ID NO: 2 B chain of human insulin
  • SEQ ID NO: 3 B chain of insulin lispro
  • SEQ ID NO: 4 B chain of insulin aspart
  • SEQ ID NO: 5 B chain of insulin glulisine
  • insulin compound refers to insulin and insulin analogues.
  • insulin refers to native human insulin having an A chain and a B chain as set out in SEQ ID NOs. 1 and 2 and containing and connected by disulfide bridges as in the native molecule (Cys A6-Cys A1 1 , Cys B7 to Cys A7 and Cys-B19-Cys A20). Insulin is suitably recombinant insulin.
  • Insulin analogue refers to an analogue of insulin which is an insulin receptor agonist and has a modified amino acid sequence, such as containing 1 or 2 amino acid changes in the sequence of the A or B chain (especially the B chain). Desirably such amino acid modifications are intended to reduce affinity of the molecule for zinc and thus increase speed of action.
  • Exemplary insulin analogues include faster acting analogues such as insulin lispro, insulin aspart and insulin glulisine. These forms of insulin have the human insulin A chain but variant B chains - see SEQ ID NOs. 3-5. Further faster acting analogues are described in EP0214826, EP0375437 and EP0678522 the contents of which are herein incorporated by reference in their entirety.
  • an insulin analogue has a speed of action which is the same as or preferably greater than that of insulin.
  • the speed of action of insulin or an insulin analogue may be determined in the Diabetic Pig
  • the insulin compound is recombinant human insulin. In another embodiment it is insulin lispro. In another embodiment it is insulin aspart. In another embodiment it is insulin glulisine.
  • nicotinic compound refers to nicotinic acid and salts thereof and derivatives including esters and amides thereof such as nicotinamide.
  • exemplary salts of nicotinic acid include sodium, potassium, calcium and magnesium salts.
  • aqueous pharmaceutical formulation refers to a formulation suitable for therapeutic use in which the aqueous component is or comprises water, preferably distilled water, deionized water, water for injection, sterile water for injection or bacteriostatic water for injection.
  • the aqueous pharmaceutical formulations of the invention are solution formulations in which all components are dissolved in water.
  • the term "monovalent or divalent anion” refers to an anion having one or more ionisable groups capable of being deprotonated in the formulation such that the anion has a charge of minus 1 or minus 2 and which anion does not contain any atoms or groups capable of being positively charged in the formulation.
  • the scope of the term excludes all zwitterions and all amino acids.
  • Other anions specifically excluded from the scope of this term include trivalent anions such as nitrate, citrate and phosphate.
  • the concentration of insulin compound in the formulation will typically be in the range 10-1000 U/ml, such as 50-500 U/ml e.g. 50-200 U/ml.
  • An exemplary formulation contains insulin compound at a concentration of 100 U/ml (around 3.6 mg/ml).
  • Another range of interest is 500-1000 U/ml e.g. 800-1000 U/ml and another exemplary formulation contains insulin compound at a concentration of 1000 U/ml (around 36 mg/ml).
  • the formulations of the invention contain ionic zinc i.e. Zn 2+ ions.
  • the source of the ionic zinc will typically be a water soluble zinc salt such as ZnCI 2 , ZnO, ZnS0 , Zn(N0 3 ) 2 or Zn(acetate) 2 and most suitably ZnCI 2 or ZnO.
  • the concentration of the ionic zinc in the formulation will typically be 0.05% or more e.g. 0.1 % or more e.g. 0.2% or more, 0.3% or more or 0.4% or more by weight of zinc based on the weight of insulin compound in the formulation.
  • concentration of the ionic zinc in the formulation may be 0.5% or more by weight of zinc based on the weight of insulin compound in the formulation, for example 0.5- 1 %, e.g. 0.5-0.75%, e.g. 0.5-0.6% by weight of zinc based on the weight of insulin compound in the formulation.
  • the weight of the counter ion to zinc is excluded.
  • concentration of the ionic zinc will typically be more than 0.015 mM e.g. more than 0.03 mM e.g. more than 0.06 mM, more than 0.09 mM or more than 0.12 mM.
  • concentration of the ionic zinc in the formulation may be more than 0.15 mM, for example 0.15-0.60 mM, e.g. 0.20-0.45 mM, e.g. 0.25-0.35 mM.
  • concentration of the ionic zinc will typically be more than 0.15 mM e.g. more than 0.3 mM e.g. more than 0.6 mM, more than 0.9 mM or more than 1 .2 mM.
  • concentration of the ionic zinc in the formulation may be more than 1 .5 mM, for example 1 .5-6.0 mM, e.g. 2.0-4.5 mM, e.g. 2.5-3.5 mM.
  • the formulations of the invention comprise a nicotinic compound which is expected to increase the speed of onset of action of insulin formulated in
  • the nicotinic compound is nicotinamide.
  • it is nicotinic acid or a salt of nicotinic acid e.g. the sodium salt.
  • the concentration of nicotinic compound is in the range 10-150 mM, preferably in the range 20-100 mM, e.g. 50-100 mM such as around 80 mM.
  • the formulations of the invention contain a non-ionic surfactant.
  • a suitable class of non-ionic surfactants is the alkyl glycosides, especially dodecyl maltoside.
  • Other alkyl glycosides include dodecyl glucoside, octyl glucoside, octyl maltoside, decyl glucoside, decyl maltoside, tridecyl glucoside, tridecyl maltoside, tetradecyl glucoside, tetradecyl maltoside, hexadecyl glucoside, hexadecyl maltoside, sucrose monooctanoate, sucrose mono decanoate, sucrose
  • polysorbates fatty acid esters of ethoxylated sorbitan
  • polysorbate 80 is polysorbate 80 is a mono ester formed from oleic acid and polyoxyethylene (20) sorbitan in which the number 20 indicates the number of oxyethylene groups in the molecule.
  • Polysorbate 80 is known under a range of brand names including in particular Tween 80, and also Alkest TW 80.
  • Polysorbate 20 is a mono ester formed from lauric acid and polyoxyethylene (20) sorbitan in which the number 20 indicates the number of oxyethylene groups in the molecule.
  • Polysorbate 20 is known under a range of brand names including in particular Tween 20, and also Alkest TW 20.
  • Other suitable polysorbates include polysorbate 40 and polysorbate 60.
  • non-ionic surfactants is block copolymers of polyethylene glycol and polypropylene glycol, also known as poloxamers, especially poloxamer 188, poloxamer 407, poloxamer 171 and poloxamer 185.
  • Poloxamers are also known under brand names Pluronics or Koliphors.
  • Pluronics or Koliphors.
  • poloxamer 188 is marketed as Pluronic F-68.
  • alkyl ethers of polyethylene glycol especially those known under a brand name Brij, such as selected from polyethylene glycol (2) hexadecyl ether (Brij 52), polyethylene glycol (2) oleyl ether (Brij 93) and polyethylene glycol (2) dodecyl ether (Brij L4).
  • Other suitable Brij surfactants include polyethylene glycol (4) lauryi ether (Brij 30), polyethylene glycol (10) lauryl ether (Brij 35), polyethylene glycol (20) hexadecyl ether (Brij 58) and polyethylene glycol (10) stearyl ether (Brij 78).
  • alkylphenyl ethers of polyethylene glycol especially 4-(1 , 1 ,3,3-tetramethylbutyl)phenyl-polyethylene glycol, also known under a brand name Triton X-100.
  • non-ionic surfactants with molecular weight of less than 1000 g/mole, especially less than 600 g/mole, such as 4-(1 , 1 ,3,3- tetramethylbutyl)phenyl-polyethylene glycol (Triton X-100) (647 g/mole), dodecyl maltoside (51 1 g/mole), octyl glucoside (292 g/mole), polyethylene glycol (2) dodecyl ether (Brij L4) (362 g/mole), polyethylene glycol (2) oleyl ether (Brij 93) (357 g/mole) and polyethylene glycol (2) hexadecyl ether (Brij 52) (330 g/mole).
  • Triton X-100 Triton X-100
  • Triton X-100 Triton X-100
  • dodecyl maltoside 51 1 g/mole
  • the concentration of the non-ionic surfactant in the formulation will typically be in the range 1 -1000 pg/rnl, e.g. 5-500 pg/rnl, e.g. 10-200 pg/rnl, such as 10-100 pg/ml especially around 50 pg/ml.
  • the formulations of the invention comprise a salt selected from the salts formed between Group 1 metals and mono or divalent anions.
  • Suitable Group 1 metals include sodium and potassium, especially sodium.
  • Anions are preferably monovalent anions.
  • Anions may be inorganic or organic however are preferably inorganic.
  • Example inorganic anions include halides such as chloride or bromide (preferably chloride) and sulfate.
  • Example organic anions include ions derived from mono or divalent carboxylic acids especially monocarboxylic acids such as acetate and benzoate and dicarboxylic acids such as succinate, maleate and malate.
  • a preferred organic anion is acetate.
  • Exemplary salts include sodium chloride, potassium chloride and sodium acetate. The preferred salt is sodium chloride.
  • the salt selected from the salts formed between Group 1 metals and mono or divalent anions may suitably be present in the formulation at a concentration of 30- 200 mM e.g. 50-200 mM e.g. 50-120 mM e.g. 65-75 mM e.g. around 70 mM.
  • the pH of the aqueous formulations of the invention is in the range 5.5-9.0 especially 6.5-8.0 e.g. 7.0-7.5.
  • the pH is preferably close to physiological pH (around pH 7.4).
  • Another pH range of interest is 7.6-8.0 e.g. around 7.8.
  • the formulation of the invention comprises a buffer in order to stabilise the pH of the formulation, which can also be selected to enhance protein stability.
  • a buffer is selected to have a pKa close to the pH of the formulation; for example histidine is suitably employed as a buffer when the pH of the formulation is in the range 5.0-7.0.
  • Histidine is suitably employed as a buffer when the pH of the formulation is in the range 5.0-7.0.
  • Such a buffer may be employed in a concentration of 0.5-20 mM e.g. 2-5 mM.
  • phosphate is suitably employed as a buffer when the pH of the formulation is in the range 6.1 -8.1 .
  • Such a buffer may be employed in a concentration of 0.5-20 mM e.g. 2-5 mM.
  • Another possible buffer is citrate.
  • the formulation of the invention is further stabilised as disclosed in WO2008/084237 (herein incorporated in its entirety by reference), which describes a formulation comprising a protein and one or more additives, characterised in that the system is substantially free of a
  • the pH of the formulation is set to a value at which the formulation has maximum measurable stability with respect to pH; the one or more additives (displaced buffers) are capable of exchanging protons with the insulin compound and have pKa values at least 1 unit more or less than the pH of the formulation at the intended temperature range of storage of the formulation.
  • the additives may have ionisable groups having pKa between 1 to 5 pH units, preferably between 1 to 3 pH units, most preferably from 1.5 to 2.5 pH units, of the pH of the aqueous formulation at the intended temperature range of storage of the formulation (e.g. 25 °C). Such additives may typically be employed at a concentration of 0.5-10 mM e.g. 2-5 mM.
  • the aqueous formulations of the present invention cover a wide range of osmolarity, including hypotonic, isotonic and hypertonic formulations.
  • the formulations of the invention are substantially isotonic.
  • the osmolarity of the formulation is selected to minimize pain according to the route of administration e.g. upon injection.
  • Preferred formulations have an osmolarity in the range of about 200 to about 500 mOsm/L.
  • the osmolarity is in the range of about 250 to about 350 mOsm/L. More preferably, the osmolarity is about 300 mOsm/L.
  • tonicity of the formulation may be further adjusted with an uncharged tonicity modifying agent.
  • uncharged tonicity modifying agents include sugars, sugar alcohols and other polyols, such as trehalose, sucrose, mannitol, glycerol, 1 ,2-propanediol, raffinose, lactose, dextrose, sorbitol or lactitol (especially trehalose, mannitol, glycerol or 1 ,2-propanediol, particularly glycerol).
  • Uncharged tonicity modifying agent is preferably used at a concentration of 20-200 mM, e.g. 50- 150 mM, e.g. around 80 mM.
  • the contribution of the insulin compound itself should be ignored for the purposes of the calculation.
  • the absolute value of the charge is the total charge excluding polarity, e.g. for glycine the possible ions have absolute charge of 0, 1 or 2 and for aspartate the possible ions have absolute charge of 0, 1 , 2 or 3.
  • the ionic strength of the formulation is suitably in the range of around 30 mM up to around 500 mM.
  • the ionic strength of the formulation is suitably kept to a minimum level since higher ionic strength formulations are less stable than lower ionic strength formulations.
  • the ionic strength taking account of ions in the formulation except for the zinc binding species and the insulin compound is less than 60 mM, e.g. less than 50 mM, e.g. less than 40 mM such as 30-40 mM.
  • the insulin compound is insulin aspart at a concentration of > 500 U/ml
  • the ionic strength of the formulation is suitably kept to a minimum level since higher ionic strength formulations are less stable than lower ionic strength formulations.
  • the ionic strength taking account of ions in the formulation except for the zinc binding species and the insulin compound is less than 60 mM, e.g. less than 50 mM, e.g. less than 40 mM such as 30-40 mM.
  • the ionic strength of the formulation may be high.
  • the ionic strength taking account of ions in the formulation except for the zinc binding species and the insulin compound is more than 50 mM, e.g. more than 100 mM, e.g. 50-500 mM or 100-500 mM or 100-300 mM such as around 150 mM.
  • the formulations of the invention can optionally include preservative, preferably phenol, m-cresol, chlorocresol, benzyl alcohol, propylparaben,
  • methylparaben benzalkonium chloride or benzethonium chloride.
  • Formulations of the invention may optionally include other beneficial components including stabilising agents.
  • the formulations of the invention comprise zinc binding species.
  • Zinc binding species should be capable of complexing ionic zinc and will be selected from species having a logK metal binding stability constant with respect to zinc ion binding of 4.5 or more (e.g. 4.5-12.3 or 4.5-10) as determined at 25 °C.
  • Metal binding stability constants listed in the National Institute of Standards and Technology reference database 46 can be used. The database typically lists logK constants determined at 25 °C.
  • the suitability of a zinc binding species to be optionally included in formulations of the invention can be determined based on its logK metal binding stability constant with respect to zinc binding, as measured at 25 °C and as quoted by the database.
  • Exemplary zinc binding species having a logK with respect to zinc ion binding of 4.5 or more to be optionally included include polydendate organic anions.
  • the zinc binding species have a logK with respect to zinc ion binding of 4.5-12.3 e.g. 4.5-10, such as citrate.
  • references to citrate, pyrophosphate, glutamate, ethylenediaminetetracetate etc. refers to the or an ionised form of the corresponding acid such as citric acid, pyrophosphoric acid, glutamic acid, ethylenediaminetetracetic acid etc.
  • Zinc ion binding species which have acid forms e.g. citric acid
  • a salt of the acid such as a sodium salt (e.g. sodium citrate).
  • they can be introduced in the form of the acid with subsequent adjustment of pH to the required level.
  • Formulations which comprise zinc binding species selected from species having a logK with respect to zinc ion binding of 4.5 or more at 25 °C e.g. may do so at a concentration of at least 1 mM, such as at least 2 mM or at least 5 mM.
  • concentration of the zinc binding species in the formulation in the formulation may typically be in the range 1 -50 mM, more preferably 5-50 mM e.g. 10- 50 mM e.g. 10-30 mM, more preferably around 20 mM (e.g. 22 mM), especially when the zinc binding species is citrate or histidine and especially for insulin compound 100 U/ml formulations.
  • the concentration of the zinc binding species in the formulation is 10-50 mM e.g. 30-50 mM e.g. 40-50 mM, more preferably around 44 mM when the zinc binding species is citrate or histidine for insulin compound 1000 U/ml formulations.
  • the concentration of the zinc binding species is 10 mM or more.
  • Anionic zinc binding species may be employed as the free acid or a salt form, such as a salt form with sodium or calcium ions, especially sodium ions.
  • a mixture of zinc binding species may be employed, although a single zinc binding species is preferred.
  • the molar ratio of ionic zinc to zinc binding species in the formulation may be in the range 1 : 1 to 1000 e.g.1 : 1 to 1 :500 e.g. 1 : 1 to 1 :250 or 1 :3 to 1 :500 e.g.1 :3 to 1 : 175.
  • a suitable molar ratio of ionic zinc to zinc binding species is 1 : 10- 1 :500 e.g. 1 :20-1 :500 e.g. 1 :20-1 : 100 or 1 :40-1 :250, e.g. 1 :40-1 :90 or 1 :60-1 :200, e.g. 1 :60-1 :80, especially for citrate or histidine as zinc binding species.
  • the following ranges are particularly of interest especially for citrate or histidine as zinc binding species: 1 : 10-1 :500 e.g. 1 : 10-1 :200 e.g. 1 : 10 to 1 : 100 e.g. 1 : 10-1 :50, e.g. 1 : 10 to 1 :30 (especially for insulin compound 1000 U/ml formulation) or 1 :50-1 : 100, e.g. 1 :60-1 :80 (especially for insulin compound 100 U/ml formulation).
  • a formulation containing 100 U/ml of insulin compound may contain around 0.3 mM of ionic zinc (i.e. around 19.7 pg/ml of ionic zinc, i.e. around 0.54% by weight of zinc based on the weight of insulin compound in the formulation) and around 15-30 mM e.g. 20-30 mM zinc binding species (especially citrate).
  • ionic zinc i.e. around 19.7 pg/ml of ionic zinc, i.e. around 0.54% by weight of zinc based on the weight of insulin compound in the formulation
  • 15-30 mM e.g. 20-30 mM zinc binding species (especially citrate).
  • a formulation containing 1000 U/ml of insulin compound may contain around 3 mM of ionic zinc (i.e. around 197 pg/ml of ionic zinc, i.e. around 0.54% by weight of zinc based on the weight of insulin compound in the formulation) and around 30-60 mM e.g. 40-60 mM zinc binding species (especially citrate).
  • ionic zinc i.e. around 197 pg/ml of ionic zinc, i.e. around 0.54% by weight of zinc based on the weight of insulin compound in the formulation
  • 30-60 mM e.g. 40-60 mM zinc binding species (especially citrate).
  • the formulations of the invention are free of zinc binding species selected from species having a logK with respect to zinc ion binding of 4.5 or more at 25 °C or contain a concentration of zinc binding species selected from species having a logK with respect to zinc ion binding of 4.5 or more at 25 °C which is less than 1 mM e.g. less than 0.5 mM.
  • the formulations are substantially free of or free of zinc binding species selected from species having a logK with respect to zinc ion binding of 4.5 or more at 25 °C.
  • Substantially free in this context means that the concentration of zinc binding species selected from species having a logK with respect to zinc ion binding of 4.5 or more at 25 °C is less than 0.1 mM, such as less than 0.05 mM or less than 0.04 mM or less than 0.01 mM.
  • the formulations of the invention may be substantially free of zinc binding species selected from species having a logK with respect to zinc ion binding of more than 10 e.g. more than 12.3 at 25 °C for example are substantially free of EDTA.
  • “Substantially free” in this context means that the concentration of zinc binding species referred to is less than 0.1 mM, such as less than 0.05 mM or less than 0.04 mM or less than 0.01 mM.
  • the formulations are free of amino acids such as glutamic acid and are also free of the corresponding ionic forms of these acids.
  • the formulations are free of arginine.
  • the formulations are free of protamine and protamine salts.
  • the formulations are free of magnesium ions.
  • the formulations are free of calcium ions. In an embodiment of the invention the formulations are free of mannitol.
  • the formulations are free of glycerol.
  • high molecular weight species refers to any irreversibly formed component of the protein content which has an apparent molecular weight at least about double the molecular weight of the parent insulin compound, as detected by a suitable analytical method, such as size-exclusion chromatography. That is, high molecular weight species are multimeric aggregates of the parent insulin compound. The multimeric aggregates may comprise the parent protein molecules with considerably altered conformation or they may be an assembly of the parent protein units in the native or near-native conformation.
  • the determination of high molecular weight species can be done using methods known in the art, including size exclusion chromatography, electrophoresis, analytical ultracentrifugation, light scattering, dynamic light scattering, static light scattering and field flow fractionation.
  • the formulations of the invention are sufficiently stable that they remain substantially free of visible particles after storage at 30°C for at least one, two or three months. Visible particles are suitably detected using the 2.9.20. European Pharmacepoeia Monograph (Particulate Contamination: Visible Particles).
  • the formulations of the invention are sufficiently stable that the concentration of related species remains low upon extended storage.
  • related species refers to any component of the protein content formed by a chemical modification of the parent insulin compound, particularly desamido or cyclic imide forms of insulin.
  • Related species are suitably detected by RP-HPLC.
  • the formulation of the invention retains at least 95%, e.g. at least 96%, e.g. at least 97%, e.g. at least 98%, e.g. at least 99% parent insulin compound (by weight of total protein) after storage at 30°C for one, two or three months.
  • the percentage of insulin compound (by weight of total protein) may be determined by size-exclusion chromatography or RP-HPLC.
  • the formulation of the invention comprises no more than 4% (by weight of total protein), preferably no more than 2% high molecular weight species after storage at 30° C for one, two or three months.
  • the formulation of the invention comprises no more than 4% (by weight of total protein), preferably no more than 2%, preferably no more than 1 % A-21 desamido form of the insulin compound after storage at 30°C for one, two or three months.
  • a formulation of the present invention should exhibit an increase in high molecular weight species during storage which is at least 10% lower, preferably at least 25% lower, more preferably at least 50% lower, than a formulation lacking the non-ionic surfactant but otherwise identical, following storage under the same conditions (e.g. 30°C) and length of time (e.g. one, two or three months).
  • a formulation of the present invention should exhibit an increase in related species during storage which is at least 10% lower, preferably at least 25% lower, more preferably at least 50% lower, than a formulation lacking the non-ionic surfactant but otherwise identical, following storage under the same conditions (e.g. 30°C) and length of time (e.g. one, two or three months).
  • a formulation of the present invention should exhibit a T ma x (i.e. time to peak insulin concentration) that is at least 10% shorter, preferably at least 20% shorter, more preferably at least 30% shorter than a formulation lacking the nicotinic compound but otherwise identical, using the model.
  • a formulation of the present invention should exhibit an area under the curve on the pharmacodynamics profile within the first 45 minutes after injection that is at least 10% greater, preferably at least 20% greater, more preferably at least 30% greater than a formulation lacking the nicotinic compound but otherwise identical, using the model.
  • a formulation of the invention for use in the treatment of a subject suffering from diabetes mellitus.
  • a method of treatment of diabetes mellitus which comprises administering to a subject in need thereof an effective amount of a formulation of the invention.
  • a typical dose of the formulation of the invention is 2-30 U, e.g. 5-15 U.
  • Administration should suitably occur in the window between 15 minutes before eating (i.e. before start of a meal) and 15 minutes after eating (i.e. after end of a meal).
  • An aspect of the invention is a container e.g. made of plastics or glass containing one dose or a plurality of doses of the formulation of the invention.
  • the container can, for example, be a cartridge designed to be a replaceable item for use with an injection device.
  • the formulations of the invention may suitably be packaged for injection, especially sub-cutaneous or intramuscular injection.
  • Sub-cutaneous injection is preferred.
  • Injection may be by conventional syringe or more preferably via a pen device adapted for use by diabetic subjects.
  • Exemplary pen devices include the Kwikpen® device and the Flexpen® device.
  • an aspect of the invention is an injection device, particularly a device adapted for subcutaneous or intramuscular injection, for single or multiple use comprising a container containing one dose or a plurality of doses of the formulation of the invention together with an injection needle.
  • the container is a replaceable cartridge which contains a plurality of doses.
  • the needle is replaceable e.g. after each occasion of use.
  • Another aspect of the invention is a medical device comprising a reservoir comprising plurality of doses of the formulation of the invention and a pump adapted for automatic or remote operation such that upon automatic or remote operation one or more doses of the formulation of the invention is administered to the body e.g. subcutaneously or intramuscularly.
  • a medical device comprising a reservoir comprising plurality of doses of the formulation of the invention and a pump adapted for automatic or remote operation such that upon automatic or remote operation one or more doses of the formulation of the invention is administered to the body e.g. subcutaneously or intramuscularly.
  • Such devices may be worn on the outside of the body or implanted in the body.
  • Formulations of the invention may be prepared by mixing the ingredients.
  • the insulin compound may be dissolved in an aqueous formulation comprising the other components.
  • the insulin compound may be dissolved in a strong acid (typically HCI), after dissolution diluted with an aqueous formulation comprising the other components, and then pH adjusted to the desired pH with addition of alkali (e.g. NaOH).
  • a step of neutralising the acid solution may be performed before the dilution step and it may then not be necessary to adjust the pH after the dilution step (or a small adjustment only may be necessary).
  • a dry solid pharmaceutical composition suitable for reconstitution with an aqueous medium which comprises (i) an insulin compound, (ii) ionic zinc, (iii) a nicotinic compound, (iv) a non-ionic surfactant; and (v) a salt selected from the salts formed between Group 1 metals and a mono or divalent anion.
  • a formulation of the invention may be prepared by dissolving such a dry solid pharmaceutical composition in an aqueous medium e.g. water or saline.
  • Such a dry solid pharmaceutical composition may be prepared by dehydrating (e.g. freeze drying) a formulation of the invention.
  • the invention also provides a container containing one dose or a plurality of doses of such a dry solid pharmaceutical composition.
  • composition comprising (i) an insulin compound, (ii) ionic zinc, (iii) a nicotinic compound and (iv) a salt selected from the salts formed between Group 1 metals and a mono or divalent anion which comprises adding a non-ionic surfactant to the formulation;
  • a non-ionic surfactant to improve the storage stability of an aqueous liquid pharmaceutical formulation comprising (i) an insulin compound, (ii) ionic zinc, (iii) a nicotinic compound and (iv) a salt selected from the salts formed between Group 1 metals and a mono or divalent anion;
  • a pharmaceutical formulation comprising (i) an insulin compound, (ii) ionic zinc and (iii) a nicotinic compound which comprises adding a non-ionic surfactant and a salt selected from the salts formed between Group 1 metals and a mono or divalent anion to the formulation; and • Use of a non-ionic surfactant and a salt selected from the salts formed between Group 1 metals and a mono or divalent anion to improve the storage stability of an aqueous liquid pharmaceutical formulation comprising (i) an insulin compound, (ii) ionic zinc and (iii) a nicotinic compound.
  • An aqueous liquid pharmaceutical formulation comprising (i) an insulin compound, (ii) ionic zinc, (iii) a nicotinic compound (iv) a non-ionic surfactant; and (v) a salt selected from the salts formed between Group 1 metals and a mono or divalent anion.
  • Clause 10 The formulation according to any one of clauses 1 to 9 wherein the non- ionic surfactant is an alkyl glycoside.
  • Clause 12 The formulation according to any one of clauses 1 to 9 wherein the non- ionic surfactant is a polysorbate surfactant.
  • surfactant is polysorbate 20 or polysorbate 80.
  • Clause 14 The formulation according to any one of clauses 1 to 9 wherein the non- ionic surfactant is an alkyl ether of polyethylene glycol.
  • polyethylene glycol is selected from polyethylene glycol (2) dodecyl ether, polyethylene glycol (2) oleyl ether and polyethylene glycol (2) hexadecyl ether.
  • Clause 16 The formulation according to any one of clauses 1 to 9 wherein the non- ionic surfactant is a block copolymer of polyethylene glycol and polypropylene glycol.
  • Clause 18 The formulation according to any one of clauses 1 to 9 wherein the non- ionic surfactant is an alkylphenyl ether of polyethylene glycol.
  • Clause 21 The formulation according to any clause 20 wherein the surfactant is present at a concentration of 10-100 pg/ml.
  • Clause 22 The formulation according to any one of clauses 1 to 21 wherein the salt selected from the salts formed between Group 1 metals and a mono or divalent anion is a sodium salt of a mono or divalent anion.
  • Clause 23 The formulation according to any one of clauses 1 to 22 wherein the anion is a monovalent anion.
  • Clause 26 The formulation according to clause 24 wherein the anion is chloride.
  • Clause 27 The formulation according to clause 25 wherein the anion is acetate.
  • Clause 28 The formulation according to any one of clauses 1 to 27 wherein the salt selected from the salts formed between Group 1 metals and mono or divalent anions is present in the formulation at a concentration of 30-200 mM
  • Clause 29 The formulation according to any one of clauses 1 to 28, wherein ionic zinc is present in the formulation at a concentration of 0.05% or more by weight of zinc based on the weight of insulin compound in the formulation.
  • Clause 30 The formulation according to clause 29, wherein the ionic zinc is
  • Clause 31 The formulation according to any one of clauses 1 to 30 comprising an uncharged tonicity modifying agent.
  • Clause 32 The formulation according to clause 31 , wherein the uncharged tonicity modifying agent is selected from the group consisting of trehalose, mannitol, glycerol or 1 ,2-propanediol.
  • Clause 33 The formulation according to clause 32, wherein the uncharged tonicity modifying agent is glycerol.
  • Clause 34 The formulation according to any one of clauses 1 to 33, wherein the formulation is isotonic.
  • Clause 35 The formulation according to any one of clauses 1 to 34, wherein the pH is in the range 5.5 to 9.0.
  • Clause 36 The formulation according to any of clauses 1 to 35, comprising a preservative.
  • Clause 37 The formulation according to clause 36, wherein the preservative is selected from the group consisting of phenol, m-cresol, chlorocresol, benzyl alcohol, propylparaben, methylparaben, benzalkonium chloride and
  • Clause 38 The formulation according to any one of clauses 1 to 37 comprising zinc binding species selected from species having a logK with respect to zinc ion binding of 4.5 or more at 25 °C
  • substantially free of zinc binding species selected from species having a logK with respect to zinc ion binding of 4.5 or more at 25 °C.
  • Clause 40 A formulation according to any one of clauses 1 to 39 for use in the treatment of a subject suffering from diabetes mellitus.
  • a method of treatment of diabetes mellitus which comprises
  • An injection device for single or multiple use comprising a container containing one dose or a plurality of doses of the formulation according to any one of clauses 1 to 39 together with an injection needle.
  • a medical device comprising a reservoir comprising plurality of doses of the formulation according to any one of clauses 1 to 39 and a pump adapted for automatic or remote operation such that upon automatic or remote operation one or more doses of the formulation is administered to the body.
  • a dry solid pharmaceutical composition suitable for reconstitution with an aqueous medium which comprises (i) an insulin compound, (ii) ionic zinc, (iii) a nicotinic compound (iv) a non-ionic surfactant; and (v) a salt selected from the salts formed between Group 1 metals and a mono or divalent anion.
  • a method of preparing a formulation according to any one of clauses 1 to 39 which comprises dissolving a dry solid pharmaceutical composition according to clause 44 in an aqueous medium.
  • composition comprising (i) an insulin compound, (ii) ionic zinc,
  • a nicotinic compound (iii) a nicotinic compound and (iv) a salt selected from the salts formed between Group 1 metals and a mono or divalent anion which comprises adding a non-ionic surfactant to the formulation.
  • aqueous liquid pharmaceutical formulation comprising (i) an insulin compound,
  • composition comprising (i) an insulin compound, (ii) ionic zinc and (iii) a nicotinic compound which comprises adding a non-ionic surfactant and a salt selected from the salts formed between Group 1 metals and a mono or divalent anion to the formulation.
  • Clause 50 Use of a non-ionic surfactant and a salt selected from the salts formed between Group 1 metals and a mono or divalent anion to improve the storage stability of an aqueous liquid pharmaceutical formulation comprising (i) an insulin compound, (ii) ionic zinc and (iii) a nicotinic compound.
  • 10 male diabetic Yucatan miniature pigs are used. Pigs are injected subcutaneously with a sample of the test formulation and blood is taken (1 or 2 ml) at the following time-points (min) with respect to the injection: -30 (or -15), 0, 5, 10, 15, 20, 30, 40, 50, 60, 75, 90, 105, 120, 150, 180, 210 and 240.
  • -30 or -15
  • min time-points
  • serum is analysed for glucose (using a commercially available glucometer).
  • insulin concentration is determined in the serum using an immunoassay.
  • Visible particles are suitably detected using the 2.9.20. European Pharmacepoeia Monograph (Particulate Contamination: Visible Particles).
  • the apparatus required consists of a viewing station comprising:
  • an adjustable lampholder fitted with a suitable, shaded, white-light source and with a suitable light diffuser (a viewing illuminator containing two 13 W fluorescent tubes, each 525 mm in length, is suitable).
  • the intensity of illumination at the viewing point is maintained between 2000 lux and 3750 lux.
  • Any adherent labels are removed from the container and the outside washed and dried.
  • the container is gently swirled or inverted, ensuring that air bubbles are not introduced, and observed for about 5 s in front of the white panel.
  • the procedure is repeated in front of the black panel. The presence of any particles is recorded.
  • Visual score 1 Clear solution, virtually free of particles
  • samples with visual score 1 -3 Whilst the particles in samples with visual scores 4 and 5 are clearly detectable on casual visual assessment under normal light, samples with visual score 1 -3 generally appear as clear solutions on the same assessment. Samples with visual scores 1 -3 are considered to be “Pass”; samples with visual score 4-5 are considered to be "Fail"
  • Ultra-high performance size exclusion chromatography of insulin preparations was performed using the Waters ACQUITY H-class Bio U PLC ® system with a 1 .7 pm Ethylene Bridged Hybrid 125 A pore packing material in a 300mm by 4.6mm column.
  • the column was equilibrated in 0.65 mg/ml L-arginine, 20% v/v acetonitrile, 15%v/v glacial acetic acid mobile phase and 10 ⁇ of sample, acidified with 0.01 M HCI, was analysed at 0.4mL/min, with 276 nm UV detection. All analyses were performed at ambient temperature. Results are expressed as % high molecular weight species (HMWS) with respect to the total protein content.
  • HMWS high molecular weight species
  • Ultra-high performance reverse phase chromatography was performed using the Waters ACQUITY H-class Bio UPLC ® system with a 1 .7 pm Ethyene Bridged Hybrid particle, 130 A pore resin trifunctionally immobilised with a C18 ligand in a 50 mm by 2.1 mm column. Insulin samples were bound in a 82%w/v Na 2 S0 , 18% v/v acetonitrile, pH 2.3 mobile phase and eluted in 50% w/v Na 2 S0 , 50% v/v acetonitrile gradient flow. 2 ⁇ of sample was acidified with 0.01 M HCI and analysed at 0.61 mL/min, with 214 nm UV detection. All analyses were performed at 40°C.
  • Insulin compound 100 U/ml
  • Ionic zinc (as ZnCI 2 ) 19.7 pg/ml (0.3 mM), equals 0.55% (w/w) based on the weight of insulin compound in the formulation
  • Insulin compound 100 U/ml
  • Ionic zinc (as ZnCI 2 ) 19.7 pg/ml (0.3 mM), equals 0.55% (w/w) based on the weight of insulin compound in the formulation
  • Insulin compound 1000 U/ml
  • Ionic zinc (as ZnCI 2 ) 19.7 pg/ml (0.3 mM), equals 0.55% (w/w) based on the weight of insulin compound in the formulation
  • Insulin compound 1000 U/ml
  • Ionic zinc (as ZnCI 2 ) 19.7 pg/ml (0.3 mM), equals 0.55% (w/w) based on the weight of insulin compound in the formulation
  • Insulin compound 100 U/ml
  • Ionic zinc (as ZnCI 2 ) 19.7 pg/ml (0.3 mM), equals 0.55% (w/w) based on the weight of insulin compound in the formulation
  • Insulin compound 1000 U/ml
  • Ionic zinc (as ZnCI 2 ) 19.7 pg/ml (0.3 mM), equals 0.55% (w/w) based on the weight of insulin compound in the formulation
  • Insulin compound 100 U/ml
  • Ionic zinc (as ZnCI 2 ) 19.7 pg/ml (0.3 mM), equals 0.55% (w/w) based on the weight of insulin compound in the formulation
  • Insulin compound 1000 U/ml
  • Ionic zinc (as ZnCI 2 ) 19.7 pg/ml (0.3 mM), equals 0.55% (w/w) based on the weight of insulin compound in the formulation
  • Insulin compound 100 U/ml
  • Ionic zinc (as ZnCI 2 ) 19.7 pg/ml (0.3 mM), equals 0.55% (w/w) based on the weight of insulin compound in the formulation
  • Insulin compound insulin aspart or insulin lispro or insulin glulisine or recombinant human insulin
  • Insulin powder is added to water and HCI is added until the powder is fully dissolved (pH has to be ⁇ 3 in order to achieve full dissolution).
  • ZnCI 2 is added to the required level. Once dissolved, pH is adjusted to approximately 7 and volume is adjusted with water so that the insulin concentration is 2* the required concentration.
  • the composition is then mixed 1 : 1 (v/v) with a mixture of additional excipients (all at 2* the required concentration).
  • formulation F1 in Table 1 The stability of insulin aspart in the formulation of currently marketed NovoRapid® rapid-acting product was compared with that of insulin aspart in a number of nicotinamide-containing formulations (formulations F2-F17 in Table 1 ) following storage at 37°C.
  • Formulation F2 contained arginine and was based on formulation K in Table 1 of WO2010/149772, which was shown to have an ultra-rapid acting pharmacodynamic/pharmacokinetic profile.
  • the only difference between formulation F2 and formulation K of WO2010/149772 is the use of phosphate buffer instead of TRIS in order to eliminate a buffer effect in comparing with currently marketed NovoRapid®.
  • Formulations F3-F17 were designed to study the effect on insulin aspart stability of (1 ) salts (2) polyols and (3) non-ionic surfactants.
  • Table 1 Compositions of formulations F1 -F17 of insulin aspart tested. All formulations comprised insulin aspart (100 U/ml), ionic zinc (0.3 mM) as ZnCI 2 , phenol (16 mM) and m-cresol (16 mM) and were adjusted to pH 7.4. Other components are listed in the table.
  • HMWS in formulations F1 -F17 Formation of HMWS in formulations F1 -F17 is shown in Table 3 and formation of chemically related species is shown in Table 4.
  • the arginine-containing formulation F2 resulted in a lower rate of HMWS and chemically related species compared with formulation F1 (i.e. formulation of NovoRapid®).
  • Removal of arginine from formulation F3 led to an impairment of stability, both with respect to HMWS and with respect to chemically related species (F4 vs. F3).
  • Increasing the concentration of glycerol in the arginine-free formulation (F5 vs. F4) or replacing it with mannitol, an alternative polyol, (F6 vs. F5) had only a minimal impact on the stability.
  • salts including sodium chloride (F7-F9), potassium chloride (F10) and sodium acetate (F1 1 ) resulted in better stability, both with respect to HMWS and with respect to chemically related species compared with formulations that did not contain salts.
  • the beneficial effect of a salt appeared to be concentration-dependent (F7-F9), and in all cases, it was better than that of the formulation F1 (i.e. formulation of NovoRapid®).
  • Table 3 Increase in HMWS (vs. start) in insulin aspart formulations F1 -F17 assessed by SEC following storage at 37 °C.
  • Table 4 Increase in chemically related species insulin (vs. start) aspart formulations F1 -F17 assessed by reversed-phase chromatography following storage at 37 °C.
  • SEQ ID NO: 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Epidemiology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Dermatology (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Inorganic Chemistry (AREA)
  • Diabetes (AREA)
  • Endocrinology (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
PCT/GB2018/051178 2017-05-05 2018-05-03 Novel formulations Ceased WO2018203060A2 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
EP18723926.4A EP3618804A2 (en) 2017-05-05 2018-05-03 Novel formulations
US16/610,805 US20200093894A1 (en) 2017-05-05 2018-05-03 Novel formulations
CN201880029092.2A CN110636832A (zh) 2017-05-05 2018-05-03 新制剂
JP2019560362A JP7534850B2 (ja) 2017-05-05 2018-05-03 新規の製剤
JP2023014791A JP2023071660A (ja) 2017-05-05 2023-02-02 新規の製剤
US19/009,689 US20250268987A1 (en) 2017-05-05 2025-01-03 Formulations

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1707187.9 2017-05-05
GBGB1707187.9A GB201707187D0 (en) 2017-05-05 2017-05-05 Novel formulations

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/610,805 A-371-Of-International US20200093894A1 (en) 2017-05-05 2018-05-03 Novel formulations
US19/009,689 Continuation US20250268987A1 (en) 2017-05-05 2025-01-03 Formulations

Publications (2)

Publication Number Publication Date
WO2018203060A2 true WO2018203060A2 (en) 2018-11-08
WO2018203060A3 WO2018203060A3 (en) 2018-12-13

Family

ID=59065623

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2018/051178 Ceased WO2018203060A2 (en) 2017-05-05 2018-05-03 Novel formulations

Country Status (6)

Country Link
US (2) US20200093894A1 (https=)
EP (1) EP3618804A2 (https=)
JP (2) JP7534850B2 (https=)
CN (1) CN110636832A (https=)
GB (1) GB201707187D0 (https=)
WO (1) WO2018203060A2 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11278624B2 (en) 2016-05-06 2022-03-22 Arecor Limited Formulations
US12357562B2 (en) 2018-04-04 2025-07-15 Arecor Limited Injection pen system for the delivery of an insulin compound
US12527845B2 (en) 2016-09-29 2026-01-20 Arecor Limited Formulations

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3094304A1 (en) * 2018-04-04 2019-10-10 Arecor Limited Medical infusion pump system for the delivery of an insulin compound

Citations (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0214826A2 (en) 1985-08-30 1987-03-18 Novo Nordisk A/S Insulin analogues and method of preparing the same
EP0375437A2 (en) 1988-12-23 1990-06-27 Novo Nordisk A/S Human insulin analogues
WO1991009617A1 (en) 1989-12-21 1991-07-11 Novo Nordisk A/S Insulin preparations containing nicotinic acid or nicotinamide
EP0678522A1 (en) 1989-02-09 1995-10-25 Eli Lilly And Company Insulin analogs
US5866538A (en) 1996-06-20 1999-02-02 Novo Nordisk A/S Insulin preparations containing NaCl
US7205276B2 (en) 2001-03-23 2007-04-17 Sanofi-Aventis Deutschland Gmb Zinc-free and low-zinc insulin preparations having improved stability
WO2008084237A2 (en) 2007-01-11 2008-07-17 Arecor Limited Stabilization of aqueous compositions of proteins with displacement buffers
US20080194461A1 (en) 2006-06-23 2008-08-14 Aegis Therapeutics Llc Stabilizing Alkylglycoside Compositions and Methods Thereof
US20100227795A1 (en) 2009-03-03 2010-09-09 Biodel Inc. Insulin formulations for rapid uptake
WO2010149772A1 (en) 2009-06-26 2010-12-29 Novo Nordisk A/S Preparation comprising insulin, nicotinamide and an amino acid
WO2012006283A1 (en) 2010-07-07 2012-01-12 Biodel Inc. Compositions and methods for modulating the pharmacokinetics and pharmacodynamics of insulin
US20130231281A1 (en) 2011-11-02 2013-09-05 Adocia Rapid acting insulin formulation comprising an oligosaccharide
WO2015120457A1 (en) 2014-02-10 2015-08-13 Biodel Inc. Stabilized ultra-rapid-acting insulin formulations
WO2015171484A1 (en) 2014-05-08 2015-11-12 Eli Lilly And Company Rapid-acting insulin compositions

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP5599543B2 (ja) * 2002-05-07 2014-10-01 ノヴォ ノルディスク アー/エス 単量体インスリン及びアシル化インスリンを含む可溶性製剤
US8173594B2 (en) * 2006-06-23 2012-05-08 Aegis Therapeutics, Llc Stabilizing alkylglycoside compositions and methods thereof
JP2013545782A (ja) * 2010-12-14 2013-12-26 ノヴォ ノルディスク アー/エス 長時間作用型インスリンと組み合わせた速効型インスリン
WO2013186138A1 (en) * 2012-06-14 2013-12-19 Novo Nordisk A/S Preparation comprising insulin, nicotinamide and arginine
TWI780236B (zh) * 2013-02-04 2022-10-11 法商賽諾菲公司 胰島素類似物及/或胰島素衍生物之穩定化醫藥調配物
WO2015106269A2 (en) * 2014-01-13 2015-07-16 Thermalin Diabetes, Llc Rapid action insulin formulations and pharmaceutical delivery systems
GB201607918D0 (en) * 2016-05-06 2016-06-22 Arecor Ltd Novel formulations

Patent Citations (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0214826A2 (en) 1985-08-30 1987-03-18 Novo Nordisk A/S Insulin analogues and method of preparing the same
EP0375437A2 (en) 1988-12-23 1990-06-27 Novo Nordisk A/S Human insulin analogues
EP0678522A1 (en) 1989-02-09 1995-10-25 Eli Lilly And Company Insulin analogs
WO1991009617A1 (en) 1989-12-21 1991-07-11 Novo Nordisk A/S Insulin preparations containing nicotinic acid or nicotinamide
US5866538A (en) 1996-06-20 1999-02-02 Novo Nordisk A/S Insulin preparations containing NaCl
US7205276B2 (en) 2001-03-23 2007-04-17 Sanofi-Aventis Deutschland Gmb Zinc-free and low-zinc insulin preparations having improved stability
US20080194461A1 (en) 2006-06-23 2008-08-14 Aegis Therapeutics Llc Stabilizing Alkylglycoside Compositions and Methods Thereof
WO2008084237A2 (en) 2007-01-11 2008-07-17 Arecor Limited Stabilization of aqueous compositions of proteins with displacement buffers
US20100227795A1 (en) 2009-03-03 2010-09-09 Biodel Inc. Insulin formulations for rapid uptake
WO2010149772A1 (en) 2009-06-26 2010-12-29 Novo Nordisk A/S Preparation comprising insulin, nicotinamide and an amino acid
WO2012006283A1 (en) 2010-07-07 2012-01-12 Biodel Inc. Compositions and methods for modulating the pharmacokinetics and pharmacodynamics of insulin
US20130231281A1 (en) 2011-11-02 2013-09-05 Adocia Rapid acting insulin formulation comprising an oligosaccharide
WO2015120457A1 (en) 2014-02-10 2015-08-13 Biodel Inc. Stabilized ultra-rapid-acting insulin formulations
WO2015171484A1 (en) 2014-05-08 2015-11-12 Eli Lilly And Company Rapid-acting insulin compositions

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11278624B2 (en) 2016-05-06 2022-03-22 Arecor Limited Formulations
US12527845B2 (en) 2016-09-29 2026-01-20 Arecor Limited Formulations
US12357562B2 (en) 2018-04-04 2025-07-15 Arecor Limited Injection pen system for the delivery of an insulin compound

Also Published As

Publication number Publication date
WO2018203060A3 (en) 2018-12-13
EP3618804A2 (en) 2020-03-11
US20200093894A1 (en) 2020-03-26
JP2023071660A (ja) 2023-05-23
GB201707187D0 (en) 2017-06-21
JP7534850B2 (ja) 2024-08-15
US20250268987A1 (en) 2025-08-28
JP2020518636A (ja) 2020-06-25
CN110636832A (zh) 2019-12-31

Similar Documents

Publication Publication Date Title
CA3034972C (en) A pharmaceutical insulin formulation
EP3452079B1 (en) Insulin formulations comprising polysorbate 80
EP3618840B1 (en) Stable insulin formulations
US20250268987A1 (en) Formulations
WO2018203061A1 (en) Stable insulin formulations
EP3773472A1 (en) Medical infusion pump system for the delivery of an insulin compound
EP3773474B1 (en) Medical infusion pump system for the delivery of an insulin compound
EP4125808A1 (en) Novel formulations
HK40013219B (en) Pharmaceutical formulation comprising an insulin compound

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18723926

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2019560362

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2018723926

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2018723926

Country of ref document: EP

Effective date: 20191205